F448185

General Info

Members Datasets Scaffolds Average Seq Length
458 333 916 99

Family's Representative Sequence

Representative Sequence 3300012515|Ga0157338_1057479|Ga0157338_10574791
Length 108
Sequence VISINSTKAISTAKMTDRSVVSTCMLGVSNLGTGLSGISAVRPASSSVAPAGLPVRERNERPTEALEAVKGQAQAYAFTAAGAGFRKQTTQHHLMWASRGPEPWSDPA

Samples

Sample ID Description Type Environment
1 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
56 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
64 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
86 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
87 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
114 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
115 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
116 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
119 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
120 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
127 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
132 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
133 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
134 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
135 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
136 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
137 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
265 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
268 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
269 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
278 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
279 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
280 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
281 2643221548 Streptomyces sp. Root55 Isolate Unclassified
282 2643221647 Streptomyces sp. Root369 Isolate Unclassified
283 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
284 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
285 2643221714 Streptomyces sp. Root264 Isolate Unclassified
286 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
287 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
288 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
289 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
290 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
291 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
292 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
293 2808606448 Streptomyces sp. 193411 Isolate Unclassified
294 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
295 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
296 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
297 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
298 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
299 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
300 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
301 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
302 2867428634 Streptomyces sp. RP5T Isolate Unclassified
303 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
304 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
305 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
306 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
307 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
308 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
309 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
310 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
311 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
312 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
313 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
314 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
315 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
316 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
317 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
318 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
319 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
320 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
321 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
322 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
323 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
324 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
325 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
326 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
327 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
328 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
329 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
330 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
331 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
332 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
333 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.66
Metatranscriptomes 5.9
Isolates 12.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.02
Nodule 0.66
Rhizoplane 2.84
Rhizosphere 77.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157338_1057479 3300012515 Bacteria 575
2 JGI24740J21852_10096466 3300001979 Bacteria 757
3 JGI24739J22299_10022883 3300001989 Bacteria 2213
4 JGI24737J22298_10014851 3300001990 Bacteria 2524
5 JGI24735J21928_10014632 3300002067 Bacteria 2456
6 JGI24738J21930_10019899 3300002075 Bacteria 1397
7 rootH1_10021248 3300003316 Bacteria 1675
8 rootH1_10024436 3300003316 Bacteria 6311
9 rootH2_10010069 3300003320 Bacteria 6743
10 rootL2_10019002 3300003322 Bacteria 6867
11 rootL2_10188328 3300003322 Bacteria 1186
12 rootH1_10027865 3300003323 Bacteria 1382
13 rootH1_10174933 3300003323 Bacteria 1355
14 rootH1_10213691 3300003323 Bacteria 1408
15 Ga0006562J51391_1160994 3300003578 Bacteria 1490
16 Ga0058692_1063353 3300003856 Bacteria 577
17 Ga0070683_100977396 3300005329 Bacteria 812
18 Ga0070666_10833926 3300005335 Bacteria 680
19 Ga0070662_100471920 3300005457 Bacteria 1044
20 Ga0068867_100869720 3300005459 Bacteria 809
21 Ga0070699_100719100 3300005518 Bacteria 913
22 Ga0068853_100099052 3300005539 Bacteria 2575
23 Ga0068853_100880244 3300005539 Bacteria 860
24 Ga0070665_100315402 3300005548 Bacteria 1567
25 Ga0068855_100290242 3300005563 Bacteria 1813
26 Ga0070664_100717939 3300005564 Bacteria 932
27 Ga0068857_101431478 3300005577 Bacteria 673
28 Ga0068851_10672695 3300005834 Bacteria 635
29 Ga0068858_101352698 3300005842 Bacteria 701
30 Ga0068860_101042793 3300005843 Bacteria 836
31 Ga0081455_10062299 3300005937 Bacteria 3136
32 Ga0075365_10094196 3300006038 Bacteria 2044
33 Ga0075368_10011902 3300006042 Bacteria 3174
34 Ga0075363_100094809 3300006048 Bacteria 1645
35 Ga0075363_100411486 3300006048 Bacteria 795
36 Ga0075367_10027791 3300006178 Bacteria 3222
37 Ga0075367_10966274 3300006178 Bacteria 544
38 Ga0075370_10187859 3300006353 Bacteria 1217
39 Ga0099826_10101514 3300006948 Bacteria 1734
40 Ga0105251_10037124 3300009011 Bacteria 2393
41 Ga0105244_10428872 3300009036 Bacteria 608
42 Ga0105250_10076960 3300009092 Bacteria 1350
43 Ga0105245_10492911 3300009098 Bacteria 1240
44 Ga0105245_10660372 3300009098 Bacteria 1076
45 Ga0105247_10120032 3300009101 Bacteria 1702
46 Ga0105243_10561753 3300009148 Bacteria 1092
47 Ga0105243_11286116 3300009148 Bacteria 748
48 Ga0105241_10610738 3300009174 Bacteria 986
49 Ga0105238_10404611 3300009551 Bacteria 1358
50 Ga0105238_10800501 3300009551 Bacteria 958
51 Ga0105238_11096977 3300009551 Bacteria 819
52 Ga0105249_11098612 3300009553 Bacteria 865
53 Ga0105239_10209808 3300010375 Bacteria 2183
54 Ga0105239_13068985 3300010375 Bacteria 544
55 Ga0105246_10290065 3300011119 Bacteria 1316
56 Ga0105246_10484415 3300011119 Bacteria 1047
57 Ga0105246_10632348 3300011119 Bacteria 929
58 Ga0157329_1013839 3300012491 Bacteria 678
59 Ga0157373_10223543 3300013100 Bacteria 1328
60 Ga0157369_10056533 3300013105 Bacteria 4234
61 Ga0157374_11177779 3300013296 Bacteria 787
62 Ga0157378_10556822 3300013297 Bacteria 1153
63 Ga0157372_10091122 3300013307 Bacteria 3467
64 Ga0157375_10846402 3300013308 Bacteria 1061
65 Ga0157375_10932512 3300013308 Bacteria 1011
66 Ga0182008_10000523 3300014497 Bacteria 28835
67 Ga0182006_1011830 3300015261 Bacteria 3825
68 Ga0182007_10000521 3300015262 Bacteria 22653
69 Ga0182005_1014648 3300015265 Bacteria 2193
70 Ga0183367_1002 3300015688 Bacteria 1101531
71 Ga0206349_1350141 3300020075 Bacteria 1139
72 Ga0206351_10667277 3300020077 Bacteria 1300
73 Ga0206352_10013382 3300020078 Bacteria 875
74 Ga0206352_10698269 3300020078 Bacteria 581
75 Ga0206350_10113011 3300020080 Bacteria 1368
76 Ga0206354_10481570 3300020081 Bacteria 1109
77 Ga0206353_11568354 3300020082 Bacteria 1329
78 Ga0224712_10237938 3300022467 Bacteria 838
79 Ga0256744_122975 3300023309 Bacteria 886
80 Ga0256720_148379 3300023438 Bacteria 688
81 Ga0209758_1009372 3300025297 Bacteria 6098
82 Ga0207426_1013660 3300025302 Bacteria 3000
83 Ga0207696_1155372 3300025711 Bacteria 610
84 Ga0207713_1029107 3300025735 Bacteria 2480
85 Ga0207647_10010084 3300025904 Bacteria 6683
86 Ga0207694_10735410 3300025924 Bacteria 833
87 Ga0207694_11295274 3300025924 Bacteria 616
88 Ga0207687_10191445 3300025927 Bacteria 1592
89 Ga0207687_11453977 3300025927 Bacteria 589
90 Ga0207709_10107548 3300025935 Bacteria 1858
91 Ga0207691_10185300 3300025940 Bacteria 1817
92 Ga0207661_11813254 3300025944 Bacteria 556
93 Ga0207679_10426153 3300025945 Bacteria 1172
94 Ga0207639_10085055 3300026041 Bacteria 2514
95 Ga0207639_11506545 3300026041 Bacteria 631
96 Ga0207678_10358746 3300026067 Bacteria 1258
97 Ga0207702_10501457 3300026078 Bacteria 1183
98 Ga0207648_12024733 3300026089 Bacteria 537
99 Ga0207674_10173649 3300026116 Bacteria 2108
100 Ga0209371_1015847 3300027312 Bacteria 2008
101 Ga0268266_10249359 3300028379 Bacteria 1642
102 Ga0268266_10702242 3300028379 Bacteria 975
103 Ga0307517_10044843 3300028786 Bacteria 4664
104 Ga0307515_10000730 3300028794 Bacteria 75859
105 Ga0307515_10035780 3300028794 Bacteria 8062
106 Ga0307515_10101600 3300028794 Bacteria 3468
107 Ga0311003_100975 3300029282 Bacteria 703
108 Ga0310981_1067133 3300029285 Bacteria 851
109 Ga0268256_1017599 3300030500 Bacteria 2008
110 Ga0307511_10000951 3300030521 Bacteria 30688
111 Ga0307511_10049888 3300030521 Bacteria 3379
112 Ga0307511_10124247 3300030521 Bacteria 1581
113 Ga0307512_10014431 3300030522 Bacteria 7358
114 Ga0307512_10099447 3300030522 Bacteria 1979
115 Ga0307513_10008149 3300031456 Bacteria 13453
116 Ga0307513_10144006 3300031456 Bacteria 2304
117 Ga0307509_10514995 3300031507 Bacteria 878
118 Ga0307509_10557162 3300031507 Bacteria 823
119 Ga0307408_100986515 3300031548 Bacteria 776
120 Ga0307408_101387513 3300031548 Bacteria 661
121 Ga0307508_10006702 3300031616 Bacteria 10803
122 Ga0307508_10010210 3300031616 Bacteria 8590
123 Ga0307508_10153333 3300031616 Bacteria 1908
124 Ga0307514_10057326 3300031649 Bacteria 2985
125 Ga0307514_10110154 3300031649 Bacteria 1953
126 Ga0307514_10236730 3300031649 Bacteria 1099
127 Ga0307516_10044215 3300031730 Bacteria 4408
128 Ga0307516_10471818 3300031730 Bacteria 910
129 Ga0307413_10086040 3300031824 Bacteria 2032
130 Ga0307413_10133457 3300031824 Bacteria 1703
131 Ga0307518_10050718 3300031838 Bacteria 3016
132 Ga0307518_10161470 3300031838 Bacteria 1539
133 Ga0307518_10300028 3300031838 Bacteria 977
134 Ga0307410_10363258 3300031852 Bacteria 1160
135 Ga0307409_101444819 3300031995 Bacteria 714
136 Ga0307409_102508777 3300031995 Bacteria 544
137 Ga0307416_100998523 3300032002 Bacteria 940
138 Ga0307416_101256600 3300032002 Bacteria 846
139 Ga0307507_10014835 3300033179 Bacteria 9240
140 Ga0307507_10150465 3300033179 Bacteria 1753
141 Ga0307510_10026299 3300033180 Bacteria 6692
142 Ga0395900_0254413 3300037418 Bacteria 1756
143 Ga0395900_0497256 3300037418 Bacteria 1170
144 Ga0395898_0011594 3300037466 Bacteria 9152
145 Ga0395898_0061212 3300037466 Bacteria 3657
146 Ga0395905_0538047 3300037471 Bacteria 1069
147 Ga0395901_0179394 3300038443 Bacteria 2221
148 Ga0439436_0000232 3300041404 Bacteria 13366
149 Ga0439436_0000485 3300041404 Bacteria 10329
150 Ga0439439_0004078 3300041406 Bacteria 3264
151 Ga0439453_0032569 3300041408 Bacteria 994
152 Ga0439465_0111150 3300041413 Bacteria 954
153 Ga0451787_085265 3300041441 Bacteria 1069
154 Ga0451797_1182298 3300041453 Bacteria 680
155 Ga0451795_0489955 3300041456 Bacteria 2098
156 Ga0451800_0774497 3300041459 Bacteria 995
157 Ga0451805_020491 3300041461 Bacteria 639
158 Ga0451835_0512882 3300041492 Bacteria 1590
159 Ga0451841_0410679 3300041498 Bacteria 613
160 Ga0451841_1388516 3300041498 Bacteria 1510
161 Ga0451846_53628 3300041502 Bacteria 539
162 Ga0451854_20027 3300041510 Bacteria 1099
163 Ga0451855_1211014 3300041511 Bacteria 520
164 Ga0451853_1254300 3300041512 Bacteria 3664
165 Ga0439433_0010025 3300041999 Bacteria 2068
166 Ga0439433_0015586 3300041999 Bacteria 1678
167 Ga0439442_092711 3300042002 Bacteria 650
168 Ga0439448_0018234 3300042005 Bacteria 2149
169 Ga0439449_0002566 3300042007 Bacteria 7091
170 Ga0439449_0011733 3300042007 Bacteria 3293
171 Ga0439450_072306 3300042008 Bacteria 848
172 Ga0439454_010089 3300042011 Bacteria 1239
173 Ga0439455_0020950 3300042012 Bacteria 1554
174 Ga0439457_000061 3300042014 Bacteria 23186
175 Ga0439457_002141 3300042014 Bacteria 5737
176 Ga0439457_005456 3300042014 Bacteria 3199
177 Ga0439462_0008188 3300042015 Bacteria 2631
178 Ga0439462_0017835 3300042015 Bacteria 1840
179 Ga0450890_019107 3300042127 Bacteria 921
180 Ga0450894_000117 3300042131 Bacteria 13529
181 Ga0450898_000870 3300042134 Bacteria 3771
182 Ga0450899_000916 3300042135 Bacteria 3353
183 Ga0450900_023845 3300042136 Bacteria 866
184 Ga0450902_010627 3300042137 Bacteria 1458
185 Ga0450903_000109 3300042138 Bacteria 17645
186 Ga0450906_000307 3300042145 Bacteria 9850
187 Ga0439458_0002792 3300042157 Bacteria 4204
188 Ga0439458_0024536 3300042157 Bacteria 1410
189 Ga0466972_0000512 3300044658 Bacteria 19287
190 Ga0466972_0061991 3300044658 Bacteria 1792
191 Ga0466972_0068640 3300044658 Bacteria 1693
192 Ga0466966_0001547 3300044684 Bacteria 14749
193 Ga0466966_0602528 3300044684 Bacteria 661
194 Ga0466961_0287574 3300044693 Bacteria 1005
195 Ga0466961_0445696 3300044693 Bacteria 784
196 Ga0466963_0004408 3300044694 Bacteria 8175
197 Ga0466968_0081246 3300044735 Bacteria 1424
198 Ga0466970_0001750 3300044765 Bacteria 10480
199 Ga0466970_0309965 3300044765 Bacteria 891
200 Ga0466957_0618038 3300044842 Bacteria 760
201 Ga0466957_1333566 3300044842 Bacteria 521
202 Ga0466960_0189932 3300044901 Bacteria 1117
203 Ga0466960_0331550 3300044901 Bacteria 864
204 Ga0466967_0014303 3300045976 Bacteria 6175
205 Ga0466967_0471069 3300045976 Bacteria 1229
206 Ga0495617_004407 3300046452 Bacteria 5128
207 Ga0495627_021314 3300046453 Bacteria 2150
208 Ga0495592_0002006 3300046454 Bacteria 14346
209 Ga0495603_0041621 3300046455 Bacteria 2746
210 Ga0495590_0103544 3300046457 Bacteria 1012
211 Ga0495629_0003657 3300046459 Bacteria 11627
212 Ga0495629_0017490 3300046459 Bacteria 5137
213 Ga0495629_0035633 3300046459 Bacteria 3516
214 Ga0495629_0495230 3300046459 Bacteria 824
215 Ga0495629_1130760 3300046459 Bacteria 505
216 Ga0495638_0121925 3300046460 Bacteria 1539
217 Ga0495638_0499462 3300046460 Bacteria 613
218 Ga0495651_0143149 3300046462 Bacteria 1731
219 Ga0495580_0051974 3300046472 Bacteria 2895
220 Ga0495582_0172552 3300046473 Bacteria 1231
221 Ga0495605_0028468 3300046474 Bacteria 2883
222 Ga0495639_0038944 3300046475 Bacteria 2136
223 Ga0495662_0017983 3300046476 Bacteria 3420
224 Ga0495662_0019337 3300046476 Bacteria 3293
225 Ga0495662_0145112 3300046476 Bacteria 1168
226 Ga0495662_0148051 3300046476 Bacteria 1156
227 Ga0495664_0220695 3300046477 Bacteria 1147
228 Ga0495584_0033606 3300046491 Bacteria 2595
229 Ga0495594_0194682 3300046499 Bacteria 1155
230 Ga0495594_0238454 3300046499 Bacteria 1036
231 Ga0495596_0018920 3300046500 Bacteria 2835
232 Ga0495607_0014952 3300046501 Bacteria 5045
233 Ga0495583_0039418 3300046506 Bacteria 2225
234 Ga0495606_0027250 3300046507 Bacteria 4056
235 Ga0495608_0034966 3300046511 Bacteria 3391
236 Ga0495610_0064132 3300046512 Bacteria 1737
237 Ga0495610_0247885 3300046512 Bacteria 707
238 Ga0495616_0004733 3300046513 Bacteria 8533
239 Ga0495618_0065367 3300046514 Bacteria 2311
240 Ga0495628_0041209 3300046516 Bacteria 3686
241 Ga0495630_0308149 3300046517 Bacteria 1210
242 Ga0495630_0645898 3300046517 Bacteria 810
243 Ga0495631_0011295 3300046518 Bacteria 4396
244 Ga0495632_0066657 3300046519 Bacteria 1737
245 Ga0495643_0004136 3300046522 Bacteria 10311
246 Ga0495644_0026630 3300046523 Bacteria 2193
247 Ga0495666_0013709 3300046526 Bacteria 4041
248 Ga0495642_0037270 3300046528 Bacteria 1967
249 Ga0495642_0160720 3300046528 Bacteria 974
250 Ga0495652_0023202 3300046529 Bacteria 5501
251 Ga0495654_0017142 3300046530 Bacteria 3813
252 Ga0495640_0172939 3300046533 Bacteria 1379
253 Ga0495609_0079675 3300046538 Bacteria 1432
254 Ga0495597_0107734 3300046542 Bacteria 1170
255 Ga0495645_0152467 3300046543 Bacteria 1604
256 Ga0495622_0016519 3300046557 Bacteria 3438
257 Ga0495622_0096341 3300046557 Bacteria 1358
258 Ga0495633_0010025 3300046558 Bacteria 5198
259 Ga0495667_0365987 3300046559 Bacteria 910
260 Ga0495667_0755020 3300046559 Bacteria 601
261 Ga0495656_0097876 3300046615 Bacteria 1352
262 Ga0495668_0007491 3300046616 Bacteria 6968
263 Ga0495668_0516100 3300046616 Bacteria 659
264 Ga0495634_0200845 3300046642 Bacteria 1238
265 Ga0495611_0025663 3300046648 Bacteria 2569
266 Ga0495611_0129959 3300046648 Bacteria 1175
267 Ga0495625_0035719 3300046660 Bacteria 3660
268 Ga0495625_0041805 3300046660 Bacteria 3334
269 Ga0495625_0081778 3300046660 Bacteria 2247
270 Ga0495635_0148214 3300046663 Bacteria 1597
271 Ga0495635_0153938 3300046663 Bacteria 1565
272 Ga0495661_0026195 3300046665 Bacteria 3757
273 Ga0495661_0328144 3300046665 Bacteria 759
274 Ga0495588_0019784 3300046674 Bacteria 3302
275 Ga0495588_0043188 3300046674 Bacteria 2306
276 Ga0495588_0498335 3300046674 Bacteria 638
277 Ga0495588_0735158 3300046674 Bacteria 516
278 Ga0495657_0084492 3300046675 Bacteria 2047
279 Ga0495657_0106473 3300046675 Bacteria 1780
280 Ga0495623_0167778 3300046679 Bacteria 1285
281 Ga0495613_0041759 3300046689 Bacteria 3395
282 Ga0495613_0055356 3300046689 Bacteria 2914
283 Ga0495671_0108553 3300046692 Bacteria 1355
284 Ga0495671_0134913 3300046692 Bacteria 1203
285 Ga0495649_0147731 3300046694 Bacteria 1235
286 Ga0495649_0243441 3300046694 Bacteria 925
287 Ga0495589_0099330 3300046794 Bacteria 1409
288 Ga0495589_0143232 3300046794 Bacteria 1143
289 Ga0495660_0034233 3300046810 Bacteria 2843
290 Ga0495581_0689113 3300047315 Bacteria 589
291 Ga0495636_0027175 3300047318 Bacteria 2331
292 Ga0495636_0110847 3300047318 Bacteria 1207
293 Ga0495636_0436605 3300047318 Bacteria 627
294 Ga0495674_0102390 3300047319 Bacteria 2435
295 Ga0495672_0142384 3300047320 Bacteria 1251
296 Ga0495676_0022260 3300047321 Bacteria 5517
297 Ga0495676_0379252 3300047321 Bacteria 941
298 Ga0495680_0015180 3300047322 Bacteria 6650
299 Ga0495683_0044277 3300047323 Bacteria 2238
300 Ga0495687_004466 3300047443 Bacteria 9426
301 Ga0495687_047568 3300047443 Bacteria 1845
302 Ga0495687_119683 3300047443 Bacteria 952
303 Ga0495675_0002692 3300047444 Bacteria 10644
304 Ga0495677_0030314 3300047445 Bacteria 1968
305 Ga0495677_0285131 3300047445 Bacteria 648
306 Ga0495685_004913 3300047447 Bacteria 4340
307 Ga0495685_006088 3300047447 Bacteria 3946
308 Ga0495685_051944 3300047447 Bacteria 1389
309 Ga0495685_292944 3300047447 Bacteria 512
310 Ga0495681_0002206 3300047470 Bacteria 14039
311 Ga0495681_0091474 3300047470 Bacteria 1342
312 Ga0495684_0038976 3300047471 Bacteria 3642
313 Ga0495686_0088343 3300047472 Bacteria 1884
314 Ga0495593_0103726 3300047673 Bacteria 1456
315 Ga0495614_0011179 3300048089 Bacteria 3949
316 Ga0495614_0283238 3300048089 Bacteria 763
317 Ga0495626_0228025 3300048091 Bacteria 754
318 Ga0496102_1049898 3300048905 Bacteria 735
319 Ga0496104_0584391 3300048907 Bacteria 1027
320 Ga0496104_1516904 3300048907 Bacteria 573
321 Ga0496105_0286565 3300048908 Bacteria 1327
322 Ga0496107_0745942 3300048910 Bacteria 719
323 Ga0496109_0008813 3300048912 Bacteria 8591
324 Ga0496109_1531958 3300048912 Bacteria 601
325 Ga0496110_0666036 3300048913 Bacteria 941
326 Ga0496126_1062628 3300048929 Bacteria 604
327 Ga0495682_0011528 3300049460 Bacteria 3401
328 Ga0501313_024464 3300049529 Bacteria 760
329 Ga0501315_005914 3300049531 Bacteria 1343
330 Ga0501321_003561 3300049537 Bacteria 1434
331 Ga0501323_033586 3300049539 Bacteria 730
332 Ga0501325_005426 3300049541 Bacteria 1013
333 Ga0501031_0004027 3300049568 Bacteria 9485
334 Ga0501032_0003318 3300049569 Bacteria 12384
335 Ga0501032_0177273 3300049569 Bacteria 1396
336 Ga0501033_0009963 3300049570 Bacteria 7297
337 Ga0501033_0190582 3300049570 Bacteria 1467
338 Ga0501033_0213764 3300049570 Bacteria 1374
339 Ga0501034_0040087 3300049571 Bacteria 4742
340 Ga0501034_0056194 3300049571 Bacteria 3961
341 Ga0501034_0159075 3300049571 Bacteria 2231
342 Ga0501034_0327609 3300049571 Bacteria 1463
343 Ga0501036_0094904 3300049572 Bacteria 2521
344 Ga0501036_0096940 3300049572 Bacteria 2493
345 Ga0501036_0157170 3300049572 Bacteria 1917
346 Ga0501036_0677219 3300049572 Bacteria 853
347 Ga0501037_0001976 3300049573 Bacteria 14833
348 Ga0501037_0307559 3300049573 Bacteria 1099
349 Ga0501037_0537351 3300049573 Bacteria 790
350 Ga0501038_0031467 3300049574 Bacteria 4688
351 Ga0501038_0069933 3300049574 Bacteria 2981
352 Ga0501038_0099874 3300049574 Bacteria 2419
353 Ga0501039_0177835 3300049575 Bacteria 1673
354 Ga0501039_0192198 3300049575 Bacteria 1605
355 Ga0501042_0037843 3300049578 Bacteria 3425
356 Ga0501043_0008133 3300049579 Bacteria 8276
357 Ga0501043_0069964 3300049579 Bacteria 2756
358 Ga0501046_0010544 3300049580 Bacteria 7928
359 Ga0501047_0013076 3300049581 Bacteria 7861
360 Ga0501047_0022900 3300049581 Bacteria 5997
361 Ga0501047_0161624 3300049581 Bacteria 2111
362 Ga0501048_0008004 3300049582 Bacteria 8001
363 Ga0501048_0088440 3300049582 Bacteria 2185
364 Ga0501069_0389140 3300049585 Bacteria 824
365 Ga0501070_0874550 3300049586 Bacteria 702
366 Ga0501073_1095941 3300049589 Bacteria 547
367 Ga0501217_058243 3300049661 Bacteria 1026
368 Ga0501080_0556235 3300049742 Bacteria 1021
369 Ga0501035_0017036 3300049822 Bacteria 6697
370 Ga0501035_0018653 3300049822 Bacteria 6389
371 Ga0501035_0273376 3300049822 Bacteria 1429
372 Ga0501035_0667299 3300049822 Bacteria 841
373 Ga0501035_1109869 3300049822 Bacteria 617
374 Ga0501044_0005945 3300049823 Bacteria 13510
375 Ga0501044_0167913 3300049823 Bacteria 2167
376 Ga0501044_0223968 3300049823 Bacteria 1830
377 Ga0501044_0365862 3300049823 Bacteria 1359
378 nmdc:mga03n38_33666_c1 3300050490 Bacteria 2182
379 nmdc:mga0yw44_139891_c1 3300050492 Bacteria 1572
380 nmdc:mga06z11_18031_c1 3300050494 Bacteria 3217
381 nmdc:mga04h51_20911_c1 3300050495 Bacteria 1962
382 nmdc:mga07m45_469007_c1 3300050496 Bacteria 730
383 Ga0500610_0124672 3300053079 Bacteria 1315
384 Ga0495655_0008007 3300053083 Bacteria 1991
385 Ga0500644_0087600 3300053088 Bacteria 1158
386 Ga0500583_0136460 3300053092 Bacteria 1218
387 Ga0500650_0168593 3300053098 Bacteria 1007
388 Ga0500560_046497 3300053107 Bacteria 1380
389 Ga0500652_243154 3300053131 Bacteria 716
390 Ga0500577_0450767 3300053142 Bacteria 562
391 Ga0500600_0202234 3300053149 Bacteria 934
392 Ga0500634_0146556 3300053161 Bacteria 1109
393 Ga0501084_0190822 3300054114 Bacteria 1729
394 Ga0587083_0075975 3300059505 Bacteria 790
395 Ga0587067_055547 3300059640 Bacteria 814
396 Ga0587067_127069 3300059640 Bacteria 618
397 Ga0587075_011967 3300059644 Bacteria 1172
398 Ga0587114_006430 3300059655 Bacteria 1313
399 Ga0587119_028930 3300059658 Bacteria 748
400 Ga0466962_0082633 3300061719 Bacteria 1536
401 Ga0466962_0157044 3300061719 Bacteria 1105
402 2547408562 2547132111 Bacteria 8013147
403 2585306988 2582581313 Bacteria 10042643
404 2585318666 2582581314 Bacteria 11452267
405 2616697117 2616644814 Bacteria 11555299
406 2643763827 2643221548 Bacteria 8053412
407 2644265995 2643221647 Bacteria 10741251
408 2644439847 2643221678 Bacteria 9540101
409 2644461737 2643221682 Bacteria 6743283
410 2644632820 2643221714 Bacteria 9015452
411 2784590231 2784132148 Bacteria 8627943
412 2785341388 2784746763 Bacteria 9783172
413 2785371293 2784746768 Bacteria 10036182
414 2786672480 2786546132 Bacteria 10419719
415 2804847731 2802429296 Bacteria 7227771
416 2808843855 2808606359 Bacteria 9866990
417 2808913395 2808606375 Bacteria 9466072
418 2809233905 2808606448 Bacteria 8656184
419 2812356188 2811994879 Bacteria 9313447
420 2812478942 2811994917 Bacteria 7761064
421 2819694794 2818991463 Bacteria 7948711
422 2852642088 2852635781 Bacteria 8251373
423 2862284950 2862281513 Bacteria 9621493
424 2862388846 2862382967 Bacteria 10317375
425 2862513301 2862507626 Bacteria 9425308
426 2863408421 2863404153 Bacteria 9672205
427 2867433904 2867428634 Bacteria 9590268
428 2873154230 2873151551 Bacteria 8625867
429 2877679309 2877676314 Bacteria 9512378
430 2912717908 2912715099 Bacteria 9460473
431 2912730332 2912723979 Bacteria 8557534
432 2919471532 2919468124 Bacteria 9133025
433 2935394496 2935390628 Bacteria 7043367
434 2946069668 2946064051 Bacteria 8957905
435 2946077562 2946072368 Bacteria 8999607
436 2947227143 2947224130 Bacteria 9938529
437 2954005271 2954002825 Bacteria 9173742
438 2954384196 2954380949 Bacteria 10050426
439 2954678752 2954673503 Bacteria 9685905
440 2954685402 2954682443 Bacteria 9862841
441 2954695018 2954691527 Bacteria 10720516
442 2954710193 2954701450 Bacteria 10834262
443 2954714510 2954711539 Bacteria 10867210
444 2954724455 2954721474 Bacteria 10456478
445 2954737363 2954731030 Bacteria 10243860
446 2954743377 2954740390 Bacteria 10229294
447 2954756216 2954749733 Bacteria 10366972
448 2954762334 2954759201 Bacteria 9358192
449 2966601029 2966598605 Bacteria 7676064
450 2990064569 2990059506 Bacteria 9321252
451 3006396660 3006393351 Bacteria 6615579
452 3006498071 3006493962 Bacteria 8825450
453 8008562591 8008558824 Bacteria 10610750
454 8008577344 8008574985 Bacteria 7815457
455 8023631227 8023623736 Bacteria 8593882
456 8025416536 8025413630 Bacteria 7014048
457 8048406646 8048406513 Bacteria 8936924
458 8056831967 8056829672 Bacteria 9045328
459 Ga0157338_1057479
460 JGI24740J21852_10096466
461 JGI24739J22299_10022883
462 JGI24737J22298_10014851
463 JGI24735J21928_10014632
464 JGI24738J21930_10019899
465 rootH1_10021248
466 rootH1_10024436
467 rootH2_10010069
468 rootL2_10019002
469 rootL2_10188328
470 rootH1_10027865
471 rootH1_10174933
472 rootH1_10213691
473 Ga0006562J51391_1160994
474 Ga0058692_1063353
475 Ga0070683_100977396
476 Ga0070666_10833926
477 Ga0070662_100471920
478 Ga0068867_100869720
479 Ga0070699_100719100
480 Ga0068853_100099052
481 Ga0068853_100880244
482 Ga0070665_100315402
483 Ga0068855_100290242
484 Ga0070664_100717939
485 Ga0068857_101431478
486 Ga0068851_10672695
487 Ga0068858_101352698
488 Ga0068860_101042793
489 Ga0081455_10062299
490 Ga0075365_10094196
491 Ga0075368_10011902
492 Ga0075363_100094809
493 Ga0075363_100411486
494 Ga0075367_10027791
495 Ga0075367_10966274
496 Ga0075370_10187859
497 Ga0099826_10101514
498 Ga0105251_10037124
499 Ga0105244_10428872
500 Ga0105250_10076960
501 Ga0105245_10492911
502 Ga0105245_10660372
503 Ga0105247_10120032
504 Ga0105243_10561753
505 Ga0105243_11286116
506 Ga0105241_10610738
507 Ga0105238_10404611
508 Ga0105238_10800501
509 Ga0105238_11096977
510 Ga0105249_11098612
511 Ga0105239_10209808
512 Ga0105239_13068985
513 Ga0105246_10290065
514 Ga0105246_10484415
515 Ga0105246_10632348
516 Ga0157329_1013839
517 Ga0157373_10223543
518 Ga0157369_10056533
519 Ga0157374_11177779
520 Ga0157378_10556822
521 Ga0157372_10091122
522 Ga0157375_10846402
523 Ga0157375_10932512
524 Ga0182008_10000523
525 Ga0182006_1011830
526 Ga0182007_10000521
527 Ga0182005_1014648
528 Ga0183367_1002
529 Ga0206349_1350141
530 Ga0206351_10667277
531 Ga0206352_10013382
532 Ga0206352_10698269
533 Ga0206350_10113011
534 Ga0206354_10481570
535 Ga0206353_11568354
536 Ga0224712_10237938
537 Ga0256744_122975
538 Ga0256720_148379
539 Ga0209758_1009372
540 Ga0207426_1013660
541 Ga0207696_1155372
542 Ga0207713_1029107
543 Ga0207647_10010084
544 Ga0207694_10735410
545 Ga0207694_11295274
546 Ga0207687_10191445
547 Ga0207687_11453977
548 Ga0207709_10107548
549 Ga0207691_10185300
550 Ga0207661_11813254
551 Ga0207679_10426153
552 Ga0207639_10085055
553 Ga0207639_11506545
554 Ga0207678_10358746
555 Ga0207702_10501457
556 Ga0207648_12024733
557 Ga0207674_10173649
558 Ga0209371_1015847
559 Ga0268266_10249359
560 Ga0268266_10702242
561 Ga0307517_10044843
562 Ga0307515_10000730
563 Ga0307515_10035780
564 Ga0307515_10101600
565 Ga0311003_100975
566 Ga0310981_1067133
567 Ga0268256_1017599
568 Ga0307511_10000951
569 Ga0307511_10049888
570 Ga0307511_10124247
571 Ga0307512_10014431
572 Ga0307512_10099447
573 Ga0307513_10008149
574 Ga0307513_10144006
575 Ga0307509_10514995
576 Ga0307509_10557162
577 Ga0307408_100986515
578 Ga0307408_101387513
579 Ga0307508_10006702
580 Ga0307508_10010210
581 Ga0307508_10153333
582 Ga0307514_10057326
583 Ga0307514_10110154
584 Ga0307514_10236730
585 Ga0307516_10044215
586 Ga0307516_10471818
587 Ga0307413_10086040
588 Ga0307413_10133457
589 Ga0307518_10050718
590 Ga0307518_10161470
591 Ga0307518_10300028
592 Ga0307410_10363258
593 Ga0307409_101444819
594 Ga0307409_102508777
595 Ga0307416_100998523
596 Ga0307416_101256600
597 Ga0307507_10014835
598 Ga0307507_10150465
599 Ga0307510_10026299
600 Ga0395900_0254413
601 Ga0395900_0497256
602 Ga0395898_0011594
603 Ga0395898_0061212
604 Ga0395905_0538047
605 Ga0395901_0179394
606 Ga0439436_0000232
607 Ga0439436_0000485
608 Ga0439439_0004078
609 Ga0439453_0032569
610 Ga0439465_0111150
611 Ga0451787_085265
612 Ga0451797_1182298
613 Ga0451795_0489955
614 Ga0451800_0774497
615 Ga0451805_020491
616 Ga0451835_0512882
617 Ga0451841_0410679
618 Ga0451841_1388516
619 Ga0451846_53628
620 Ga0451854_20027
621 Ga0451855_1211014
622 Ga0451853_1254300
623 Ga0439433_0010025
624 Ga0439433_0015586
625 Ga0439442_092711
626 Ga0439448_0018234
627 Ga0439449_0002566
628 Ga0439449_0011733
629 Ga0439450_072306
630 Ga0439454_010089
631 Ga0439455_0020950
632 Ga0439457_000061
633 Ga0439457_002141
634 Ga0439457_005456
635 Ga0439462_0008188
636 Ga0439462_0017835
637 Ga0450890_019107
638 Ga0450894_000117
639 Ga0450898_000870
640 Ga0450899_000916
641 Ga0450900_023845
642 Ga0450902_010627
643 Ga0450903_000109
644 Ga0450906_000307
645 Ga0439458_0002792
646 Ga0439458_0024536
647 Ga0466972_0000512
648 Ga0466972_0061991
649 Ga0466972_0068640
650 Ga0466966_0001547
651 Ga0466966_0602528
652 Ga0466961_0287574
653 Ga0466961_0445696
654 Ga0466963_0004408
655 Ga0466968_0081246
656 Ga0466970_0001750
657 Ga0466970_0309965
658 Ga0466957_0618038
659 Ga0466957_1333566
660 Ga0466960_0189932
661 Ga0466960_0331550
662 Ga0466967_0014303
663 Ga0466967_0471069
664 Ga0495617_004407
665 Ga0495627_021314
666 Ga0495592_0002006
667 Ga0495603_0041621
668 Ga0495590_0103544
669 Ga0495629_0003657
670 Ga0495629_0017490
671 Ga0495629_0035633
672 Ga0495629_0495230
673 Ga0495629_1130760
674 Ga0495638_0121925
675 Ga0495638_0499462
676 Ga0495651_0143149
677 Ga0495580_0051974
678 Ga0495582_0172552
679 Ga0495605_0028468
680 Ga0495639_0038944
681 Ga0495662_0017983
682 Ga0495662_0019337
683 Ga0495662_0145112
684 Ga0495662_0148051
685 Ga0495664_0220695
686 Ga0495584_0033606
687 Ga0495594_0194682
688 Ga0495594_0238454
689 Ga0495596_0018920
690 Ga0495607_0014952
691 Ga0495583_0039418
692 Ga0495606_0027250
693 Ga0495608_0034966
694 Ga0495610_0064132
695 Ga0495610_0247885
696 Ga0495616_0004733
697 Ga0495618_0065367
698 Ga0495628_0041209
699 Ga0495630_0308149
700 Ga0495630_0645898
701 Ga0495631_0011295
702 Ga0495632_0066657
703 Ga0495643_0004136
704 Ga0495644_0026630
705 Ga0495666_0013709
706 Ga0495642_0037270
707 Ga0495642_0160720
708 Ga0495652_0023202
709 Ga0495654_0017142
710 Ga0495640_0172939
711 Ga0495609_0079675
712 Ga0495597_0107734
713 Ga0495645_0152467
714 Ga0495622_0016519
715 Ga0495622_0096341
716 Ga0495633_0010025
717 Ga0495667_0365987
718 Ga0495667_0755020
719 Ga0495656_0097876
720 Ga0495668_0007491
721 Ga0495668_0516100
722 Ga0495634_0200845
723 Ga0495611_0025663
724 Ga0495611_0129959
725 Ga0495625_0035719
726 Ga0495625_0041805
727 Ga0495625_0081778
728 Ga0495635_0148214
729 Ga0495635_0153938
730 Ga0495661_0026195
731 Ga0495661_0328144
732 Ga0495588_0019784
733 Ga0495588_0043188
734 Ga0495588_0498335
735 Ga0495588_0735158
736 Ga0495657_0084492
737 Ga0495657_0106473
738 Ga0495623_0167778
739 Ga0495613_0041759
740 Ga0495613_0055356
741 Ga0495671_0108553
742 Ga0495671_0134913
743 Ga0495649_0147731
744 Ga0495649_0243441
745 Ga0495589_0099330
746 Ga0495589_0143232
747 Ga0495660_0034233
748 Ga0495581_0689113
749 Ga0495636_0027175
750 Ga0495636_0110847
751 Ga0495636_0436605
752 Ga0495674_0102390
753 Ga0495672_0142384
754 Ga0495676_0022260
755 Ga0495676_0379252
756 Ga0495680_0015180
757 Ga0495683_0044277
758 Ga0495687_004466
759 Ga0495687_047568
760 Ga0495687_119683
761 Ga0495675_0002692
762 Ga0495677_0030314
763 Ga0495677_0285131
764 Ga0495685_004913
765 Ga0495685_006088
766 Ga0495685_051944
767 Ga0495685_292944
768 Ga0495681_0002206
769 Ga0495681_0091474
770 Ga0495684_0038976
771 Ga0495686_0088343
772 Ga0495593_0103726
773 Ga0495614_0011179
774 Ga0495614_0283238
775 Ga0495626_0228025
776 Ga0496102_1049898
777 Ga0496104_0584391
778 Ga0496104_1516904
779 Ga0496105_0286565
780 Ga0496107_0745942
781 Ga0496109_0008813
782 Ga0496109_1531958
783 Ga0496110_0666036
784 Ga0496126_1062628
785 Ga0495682_0011528
786 Ga0501313_024464
787 Ga0501315_005914
788 Ga0501321_003561
789 Ga0501323_033586
790 Ga0501325_005426
791 Ga0501031_0004027
792 Ga0501032_0003318
793 Ga0501032_0177273
794 Ga0501033_0009963
795 Ga0501033_0190582
796 Ga0501033_0213764
797 Ga0501034_0040087
798 Ga0501034_0056194
799 Ga0501034_0159075
800 Ga0501034_0327609
801 Ga0501036_0094904
802 Ga0501036_0096940
803 Ga0501036_0157170
804 Ga0501036_0677219
805 Ga0501037_0001976
806 Ga0501037_0307559
807 Ga0501037_0537351
808 Ga0501038_0031467
809 Ga0501038_0069933
810 Ga0501038_0099874
811 Ga0501039_0177835
812 Ga0501039_0192198
813 Ga0501042_0037843
814 Ga0501043_0008133
815 Ga0501043_0069964
816 Ga0501046_0010544
817 Ga0501047_0013076
818 Ga0501047_0022900
819 Ga0501047_0161624
820 Ga0501048_0008004
821 Ga0501048_0088440
822 Ga0501069_0389140
823 Ga0501070_0874550
824 Ga0501073_1095941
825 Ga0501217_058243
826 Ga0501080_0556235
827 Ga0501035_0017036
828 Ga0501035_0018653
829 Ga0501035_0273376
830 Ga0501035_0667299
831 Ga0501035_1109869
832 Ga0501044_0005945
833 Ga0501044_0167913
834 Ga0501044_0223968
835 Ga0501044_0365862
836 nmdc:mga03n38_33666_c1
837 nmdc:mga0yw44_139891_c1
838 nmdc:mga06z11_18031_c1
839 nmdc:mga04h51_20911_c1
840 nmdc:mga07m45_469007_c1
841 Ga0500610_0124672
842 Ga0495655_0008007
843 Ga0500644_0087600
844 Ga0500583_0136460
845 Ga0500650_0168593
846 Ga0500560_046497
847 Ga0500652_243154
848 Ga0500577_0450767
849 Ga0500600_0202234
850 Ga0500634_0146556
851 Ga0501084_0190822
852 Ga0587083_0075975
853 Ga0587067_055547
854 Ga0587067_127069
855 Ga0587075_011967
856 Ga0587114_006430
857 Ga0587119_028930
858 Ga0466962_0082633
859 Ga0466962_0157044
860 2547408562
861 2585306988
862 2585318666
863 2616697117
864 2643763827
865 2644265995
866 2644439847
867 2644461737
868 2644632820
869 2784590231
870 2785341388
871 2785371293
872 2786672480
873 2804847731
874 2808843855
875 2808913395
876 2809233905
877 2812356188
878 2812478942
879 2819694794
880 2852642088
881 2862284950
882 2862388846
883 2862513301
884 2863408421
885 2867433904
886 2873154230
887 2877679309
888 2912717908
889 2912730332
890 2919471532
891 2935394496
892 2946069668
893 2946077562
894 2947227143
895 2954005271
896 2954384196
897 2954678752
898 2954685402
899 2954695018
900 2954710193
901 2954714510
902 2954724455
903 2954737363
904 2954743377
905 2954756216
906 2954762334
907 2966601029
908 2990064569
909 3006396660
910 3006498071
911 8008562591
912 8008577344
913 8023631227
914 8025416536
915 8048406646
916 8056831967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map