F448132

General Info

Members Datasets Scaffolds Average Seq Length
458 214 916 146

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100279396|Ga0070675_1002793962
Length 172
Sequence MGKSARRETTRWDMSAGTSTGPELLSLVILGVAVLGLATVAFFWSKGRKIPGDHVFRASRMSRGNLWFPTQVAVTPTSVVHYTPELVGGREHSMHISHIASVLIDRNLMFSDVLIESSGGTSPVQCHGHRKGDAVEMKRLIEQFQTEYYRGGRDPMTARGPAGLAAAATKEA

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
132 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
137 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
138 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
185 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 6.33
Rhizosphere 92.36
Stem 0
Stem Tuber 0
Unclassified 21.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100279396 3300005354 Bacteria 1467
2 MBSR1b_contig_3060253 2162886012 Unclassified 1006
3 Ga0065712_10000850 3300005290 Bacteria 14397
4 Ga0065712_10034121 3300005290 Bacteria 1016
5 Ga0065715_10109416 3300005293 Bacteria 2669
6 Ga0065715_10110642 3300005293 Bacteria 2610
7 Ga0065715_10124929 3300005293 Bacteria 2143
8 Ga0065715_10131806 3300005293 Unclassified 2001
9 Ga0065715_10165709 3300005293 Bacteria 1588
10 Ga0070676_10116201 3300005328 Unclassified 1673
11 Ga0070676_10545779 3300005328 Bacteria 829
12 Ga0070683_100000395 3300005329 Bacteria 30161
13 Ga0070683_100697560 3300005329 Bacteria 972
14 Ga0070670_100460992 3300005331 Unclassified 1127
15 Ga0070670_100469821 3300005331 Unclassified 1116
16 Ga0068869_100154495 3300005334 Bacteria 1782
17 Ga0070682_100263771 3300005337 Bacteria 1248
18 Ga0068868_100113546 3300005338 Bacteria 2203
19 Ga0070660_100365516 3300005339 Unclassified 1190
20 Ga0070689_100010839 3300005340 Bacteria 6514
21 Ga0070689_100104105 3300005340 Bacteria 2250
22 Ga0070691_10424126 3300005341 Bacteria 754
23 Ga0070661_100130499 3300005344 Bacteria 1887
24 Ga0070661_100135373 3300005344 Bacteria 1853
25 Ga0070668_100128070 3300005347 Bacteria 2035
26 Ga0070675_100569053 3300005354 Unclassified 1026
27 Ga0070675_100769789 3300005354 Unclassified 879
28 Ga0070671_101085585 3300005355 Unclassified 703
29 Ga0070674_100028702 3300005356 Bacteria 3655
30 Ga0070674_100101182 3300005356 Bacteria 2100
31 Ga0070674_100123593 3300005356 Bacteria 1919
32 Ga0070674_100987729 3300005356 Bacteria 738
33 Ga0070673_100083161 3300005364 Unclassified 2600
34 Ga0070673_100109514 3300005364 Bacteria 2288
35 Ga0070673_100237447 3300005364 Bacteria 1583
36 Ga0070673_100424846 3300005364 Bacteria 1192
37 Ga0070688_100117517 3300005365 Bacteria 1777
38 Ga0070688_100138567 3300005365 Bacteria 1650
39 Ga0070688_100141747 3300005365 Bacteria 1634
40 Ga0070688_100172949 3300005365 Bacteria 1492
41 Ga0070688_100236722 3300005365 Unclassified 1294
42 Ga0070667_100008849 3300005367 Bacteria 8334
43 Ga0070694_100033993 3300005444 Bacteria 3359
44 Ga0070694_100679829 3300005444 Archaea 835
45 Ga0070663_100236981 3300005455 Bacteria 1439
46 Ga0070663_101411283 3300005455 Unclassified 617
47 Ga0070678_100014935 3300005456 Bacteria 4918
48 Ga0070678_100090600 3300005456 Bacteria 2344
49 Ga0070678_100218776 3300005456 Bacteria 1582
50 Ga0070662_100329578 3300005457 Bacteria 1247
51 Ga0070685_10068621 3300005466 Bacteria 2095
52 Ga0070685_10258568 3300005466 Unclassified 1157
53 Ga0070707_100055361 3300005468 Bacteria 3803
54 Ga0070698_100044182 3300005471 Bacteria 4565
55 Ga0070684_100000197 3300005535 Bacteria 42219
56 Ga0068853_100675719 3300005539 Bacteria 984
57 Ga0070672_100060753 3300005543 Bacteria 2977
58 Ga0070672_100255060 3300005543 Bacteria 1478
59 Ga0070695_100000811 3300005545 Bacteria 16822
60 Ga0070696_100346851 3300005546 Bacteria 1149
61 Ga0070696_100500994 3300005546 Unclassified 966
62 Ga0070696_101686337 3300005546 Bacteria 546
63 Ga0070693_100051696 3300005547 Bacteria 2354
64 Ga0070665_100480802 3300005548 Bacteria 1253
65 Ga0070665_100627372 3300005548 Bacteria 1088
66 Ga0070704_100323616 3300005549 Bacteria 1293
67 Ga0070704_100453966 3300005549 Bacteria 1104
68 Ga0070704_100496918 3300005549 Unclassified 1058
69 Ga0070664_100011277 3300005564 Bacteria 7250
70 Ga0070664_100017763 3300005564 Bacteria 5843
71 Ga0070664_100046643 3300005564 Bacteria 3660
72 Ga0070664_100391374 3300005564 Bacteria 1270
73 Ga0068857_101248686 3300005577 Unclassified 720
74 Ga0068852_100201404 3300005616 Bacteria 1884
75 Ga0068852_100390949 3300005616 Bacteria 1366
76 Ga0068859_100414081 3300005617 Bacteria 1444
77 Ga0068859_101707724 3300005617 Bacteria 695
78 Ga0068859_102424045 3300005617 Unclassified 578
79 Ga0068859_102635015 3300005617 Bacteria 553
80 Ga0068861_100123355 3300005719 Bacteria 2093
81 Ga0068870_10201194 3300005840 Bacteria 1208
82 Ga0068863_100798703 3300005841 Unclassified 941
83 Ga0068863_101068695 3300005841 Unclassified 811
84 Ga0068860_101025441 3300005843 Bacteria 843
85 Ga0068862_100382023 3300005844 Bacteria 1314
86 Ga0068862_100721802 3300005844 Unclassified 967
87 Ga0068862_102778453 3300005844 Unclassified 501
88 Ga0075368_10030284 3300006042 Unclassified 2095
89 Ga0075367_10327663 3300006178 Bacteria 965
90 Ga0075427_10059561 3300006194 Unclassified 667
91 Ga0075366_10022461 3300006195 Bacteria 3670
92 Ga0097621_101014494 3300006237 Bacteria 777
93 Ga0068871_100261838 3300006358 Bacteria 1509
94 Ga0068871_100771320 3300006358 Unclassified 885
95 Ga0075428_100000086 3300006844 Bacteria 77110
96 Ga0075428_100055006 3300006844 Bacteria 4361
97 Ga0075428_100072724 3300006844 Bacteria 3755
98 Ga0075428_100360884 3300006844 Bacteria 1558
99 Ga0075428_100987603 3300006844 Bacteria 891
100 Ga0075430_100000028 3300006846 Bacteria 74712
101 Ga0075430_100063394 3300006846 Bacteria 3104
102 Ga0075430_100126379 3300006846 Bacteria 2131
103 Ga0075430_100211285 3300006846 Bacteria 1610
104 Ga0075430_100231794 3300006846 Bacteria 1531
105 Ga0075430_100283762 3300006846 Unclassified 1370
106 Ga0075430_100355390 3300006846 Bacteria 1210
107 Ga0075430_101660125 3300006846 Unclassified 524
108 Ga0075431_100003561 3300006847 Bacteria 15078
109 Ga0075431_100003906 3300006847 Bacteria 14507
110 Ga0075431_100022723 3300006847 Bacteria 6410
111 Ga0075431_100025573 3300006847 Bacteria 6052
112 Ga0075431_100028998 3300006847 Bacteria 5692
113 Ga0075431_100090424 3300006847 Unclassified 3160
114 Ga0075431_100106971 3300006847 Unclassified 2886
115 Ga0075431_100256420 3300006847 Bacteria 1776
116 Ga0075431_100379382 3300006847 Bacteria 1418
117 Ga0075431_101906436 3300006847 Unclassified 550
118 Ga0075433_10037409 3300006852 Bacteria 4187
119 Ga0075433_10093983 3300006852 Bacteria 2653
120 Ga0075433_10135348 3300006852 Bacteria 2190
121 Ga0075433_10198500 3300006852 Bacteria 1784
122 Ga0075433_10313625 3300006852 Unclassified 1388
123 Ga0075433_10412145 3300006852 Bacteria 1192
124 Ga0075433_10483485 3300006852 Unclassified 1091
125 Ga0075434_100108818 3300006871 Bacteria 2781
126 Ga0075434_100353053 3300006871 Bacteria 1491
127 Ga0075434_101760020 3300006871 Unclassified 627
128 Ga0075429_100004161 3300006880 Bacteria 12378
129 Ga0075429_100009460 3300006880 Bacteria 8457
130 Ga0075429_100027239 3300006880 Bacteria 4960
131 Ga0075429_100445358 3300006880 Unclassified 1135
132 Ga0075429_100689678 3300006880 Unclassified 895
133 Ga0068865_100221073 3300006881 Bacteria 1481
134 Ga0097620_100414111 3300006931 Bacteria 1444
135 Ga0097620_101707982 3300006931 Bacteria 695
136 Ga0097620_102422930 3300006931 Unclassified 578
137 Ga0097620_102635987 3300006931 Bacteria 553
138 Ga0075435_100002690 3300007076 Bacteria 11867
139 Ga0075435_100013785 3300007076 Bacteria 6025
140 Ga0111539_10000166 3300009094 Bacteria 76156
141 Ga0111539_10051720 3300009094 Bacteria 4891
142 Ga0111539_10205185 3300009094 Bacteria 2298
143 Ga0111539_10863511 3300009094 Bacteria 1053
144 Ga0111539_12890973 3300009094 Unclassified 556
145 Ga0114129_10000148 3300009147 Bacteria 74039
146 Ga0114129_10000400 3300009147 Bacteria 50737
147 Ga0114129_10009548 3300009147 Bacteria 13840
148 Ga0114129_10017703 3300009147 Bacteria 10145
149 Ga0114129_10023952 3300009147 Bacteria 8651
150 Ga0114129_10026994 3300009147 Bacteria 8129
151 Ga0114129_10036130 3300009147 Bacteria 6977
152 Ga0114129_10076746 3300009147 Bacteria 4651
153 Ga0114129_10209099 3300009147 Bacteria 2639
154 Ga0114129_10309212 3300009147 Bacteria 2104
155 Ga0114129_10379916 3300009147 Bacteria 1866
156 Ga0114129_10578612 3300009147 Bacteria 1457
157 Ga0114129_11812383 3300009147 Unclassified 742
158 Ga0105243_10629100 3300009148 Bacteria 1037
159 Ga0105243_11584960 3300009148 Unclassified 681
160 Ga0105242_10199034 3300009176 Bacteria 1778
161 Ga0105248_10010754 3300009177 Bacteria 10102
162 Ga0105248_10526537 3300009177 Bacteria 1333
163 Ga0105248_10612398 3300009177 Bacteria 1228
164 Ga0105249_10200367 3300009553 Bacteria 1953
165 Ga0105249_10273341 3300009553 Unclassified 1684
166 Ga0105249_10626368 3300009553 Unclassified 1132
167 Ga0105249_10914467 3300009553 Unclassified 945
168 Ga0105249_12336339 3300009553 Unclassified 607
169 Ga0105239_11316933 3300010375 Unclassified 833
170 Ga0105239_11325134 3300010375 Bacteria 831
171 Ga0105246_10056142 3300011119 Bacteria 2721
172 Ga0157374_10202586 3300013296 Bacteria 1943
173 Ga0157378_11304805 3300013297 Bacteria 767
174 Ga0163163_10017401 3300014325 Bacteria 6703
175 Ga0163163_10021873 3300014325 Bacteria 6043
176 Ga0157380_10005238 3300014326 Bacteria 9059
177 Ga0157380_10061585 3300014326 Bacteria 3003
178 Ga0157380_10378067 3300014326 Bacteria 1336
179 Ga0157380_11081764 3300014326 Bacteria 840
180 Ga0157380_11252119 3300014326 Unclassified 787
181 Ga0157377_10231399 3300014745 Bacteria 1188
182 Ga0157379_10425217 3300014968 Bacteria 1224
183 Ga0157376_10190434 3300014969 Bacteria 1881
184 Ga0207697_10001424 3300025315 Bacteria 13074
185 Ga0207697_10004300 3300025315 Bacteria 6826
186 Ga0207642_10072437 3300025899 Bacteria 1644
187 Ga0207642_10216155 3300025899 Unclassified 1068
188 Ga0207688_10003623 3300025901 Bacteria 8432
189 Ga0207688_10039075 3300025901 Bacteria 2636
190 Ga0207645_10236148 3300025907 Unclassified 1207
191 Ga0207645_10290829 3300025907 Bacteria 1086
192 Ga0207660_10168339 3300025917 Unclassified 1695
193 Ga0207662_10436138 3300025918 Bacteria 894
194 Ga0207662_10753624 3300025918 Bacteria 685
195 Ga0207649_10119725 3300025920 Bacteria 1773
196 Ga0207646_10258940 3300025922 Bacteria 1572
197 Ga0207681_10200504 3300025923 Bacteria 1532
198 Ga0207681_10351741 3300025923 Bacteria 1180
199 Ga0207650_10018735 3300025925 Bacteria 4861
200 Ga0207650_10023683 3300025925 Bacteria 4358
201 Ga0207650_10035915 3300025925 Bacteria 3602
202 Ga0207650_10038902 3300025925 Bacteria 3476
203 Ga0207659_10067332 3300025926 Unclassified 2601
204 Ga0207659_10104312 3300025926 Bacteria 2144
205 Ga0207659_11249352 3300025926 Bacteria 638
206 Ga0207644_10182530 3300025931 Bacteria 1645
207 Ga0207644_10544545 3300025931 Bacteria 960
208 Ga0207644_10621657 3300025931 Unclassified 898
209 Ga0207690_10361747 3300025932 Bacteria 1150
210 Ga0207686_10112910 3300025934 Bacteria 1836
211 Ga0207670_10158502 3300025936 Bacteria 1687
212 Ga0207670_10508700 3300025936 Unclassified 979
213 Ga0207669_10058262 3300025937 Bacteria 2356
214 Ga0207669_10116748 3300025937 Bacteria 1802
215 Ga0207669_10732538 3300025937 Bacteria 815
216 Ga0207669_11190679 3300025937 Unclassified 645
217 Ga0207691_10083924 3300025940 Bacteria 2860
218 Ga0207691_10120554 3300025940 Bacteria 2325
219 Ga0207691_10501213 3300025940 Unclassified 1031
220 Ga0207711_10050694 3300025941 Bacteria 3553
221 Ga0207711_10430217 3300025941 Bacteria 1228
222 Ga0207689_10084501 3300025942 Bacteria 2609
223 Ga0207661_10001796 3300025944 Bacteria 14663
224 Ga0207661_10222730 3300025944 Bacteria 1668
225 Ga0207679_10004009 3300025945 Bacteria 9143
226 Ga0207679_10011845 3300025945 Bacteria 5669
227 Ga0207679_10139363 3300025945 Bacteria 1958
228 Ga0207679_10329949 3300025945 Bacteria 1324
229 Ga0207651_10055721 3300025960 Unclassified 2717
230 Ga0207651_10059502 3300025960 Bacteria 2647
231 Ga0207651_10269494 3300025960 Unclassified 1402
232 Ga0207712_10128956 3300025961 Bacteria 1924
233 Ga0207712_10811194 3300025961 Bacteria 823
234 Ga0207668_10261211 3300025972 Unclassified 1411
235 Ga0207668_10684652 3300025972 Bacteria 900
236 Ga0207640_10079213 3300025981 Bacteria 2239
237 Ga0207658_10024099 3300025986 Bacteria 4254
238 Ga0207658_10504419 3300025986 Bacteria 1078
239 Ga0207677_10080053 3300026023 Bacteria 2339
240 Ga0207639_10306615 3300026041 Bacteria 1405
241 Ga0207678_10154269 3300026067 Bacteria 1961
242 Ga0207678_10175132 3300026067 Bacteria 1832
243 Ga0207708_10832713 3300026075 Bacteria 796
244 Ga0207648_11145814 3300026089 Bacteria 730
245 Ga0207675_100013531 3300026118 Bacteria 7615
246 Ga0207683_10084658 3300026121 Bacteria 2819
247 Ga0207683_10247003 3300026121 Bacteria 1628
248 Ga0207698_10049477 3300026142 Bacteria 3199
249 Ga0207698_10524710 3300026142 Bacteria 1156
250 Ga0209813_10121312 3300027866 Bacteria 910
251 Ga0207428_10000251 3300027907 Bacteria 73186
252 Ga0207428_10096061 3300027907 Bacteria 2295
253 Ga0207428_10529070 3300027907 Unclassified 854
254 Ga0268266_10540377 3300028379 Unclassified 1116
255 Ga0268264_10540751 3300028381 Bacteria 1141
256 Ga0307408_100014091 3300031548 Bacteria 5312
257 Ga0307408_100026302 3300031548 Bacteria 3996
258 Ga0307408_100519566 3300031548 Unclassified 1045
259 Ga0307408_101548324 3300031548 Unclassified 628
260 Ga0307413_10439476 3300031824 Bacteria 1032
261 Ga0307410_10039318 3300031852 Bacteria 3105
262 Ga0307410_10064791 3300031852 Bacteria 2512
263 Ga0307406_10181316 3300031901 Bacteria 1533
264 Ga0307407_10011022 3300031903 Bacteria 4286
265 Ga0307412_10020737 3300031911 Bacteria 4004
266 Ga0307409_100010108 3300031995 Bacteria 5841
267 Ga0307409_100035325 3300031995 Bacteria 3662
268 Ga0307409_100088406 3300031995 Bacteria 2529
269 Ga0307416_100020517 3300032002 Bacteria 4718
270 Ga0307416_100032467 3300032002 Bacteria 3945
271 Ga0307416_100588117 3300032002 Unclassified 1191
272 Ga0307416_102877584 3300032002 Unclassified 576
273 Ga0307414_10782511 3300032004 Unclassified 869
274 Ga0307411_10012926 3300032005 Bacteria 4580
275 Ga0307411_10178000 3300032005 Bacteria 1611
276 Ga0307411_10270136 3300032005 Bacteria 1348
277 Ga0307411_10816305 3300032005 Bacteria 822
278 Ga0307411_11082560 3300032005 Unclassified 721
279 Ga0307415_100054385 3300032126 Bacteria 2732
280 Ga0307415_100743531 3300032126 Bacteria 890
281 Ga0373932_0365789 3300035112 Bacteria 551
282 Ga0373931_0589219 3300035691 Bacteria 726
283 Ga0373947_0163433 3300035725 Bacteria 1441
284 Ga0373925_0009079 3300037068 Bacteria 7239
285 Ga0373925_0507054 3300037068 Bacteria 991
286 Ga0395901_0542254 3300038443 Bacteria 1180
287 Ga0451802_1938805 3300041460 Unclassified 740
288 Ga0451807_2098033 3300041486 Unclassified 551
289 Ga0439433_0040132 3300041999 Bacteria 1088
290 Ga0439437_017128 3300042000 Unclassified 860
291 Ga0439437_038115 3300042000 Unclassified 618
292 Ga0439441_032040 3300042001 Unclassified 1023
293 Ga0439443_014006 3300042003 Bacteria 1204
294 Ga0439443_023053 3300042003 Unclassified 992
295 Ga0439450_000724 3300042008 Unclassified 4456
296 Ga0450920_013084 3300042122 Bacteria 1561
297 Ga0450923_018324 3300042125 Bacteria 1338
298 Ga0450898_028788 3300042134 Unclassified 1010
299 Ga0450898_089966 3300042134 Unclassified 632
300 Ga0439446_0020520 3300042156 Unclassified 1862
301 Ga0439434_0132866 3300042435 Unclassified 817
302 Ga0439435_0019309 3300042436 Bacteria 1745
303 Ga0439435_0262165 3300042436 Bacteria 584
304 Ga0439444_0031387 3300042437 Bacteria 999
305 Ga0439464_0018846 3300042439 Bacteria 1880
306 Ga0439460_0081436 3300042461 Unclassified 1016
307 Ga0439460_0166630 3300042461 Unclassified 741
308 Ga0450893_0027493 3300042532 Bacteria 1003
309 Ga0439440_0021521 3300042993 Bacteria 1454
310 Ga0495586_0302068 3300046535 Bacteria 917
311 Ga0495667_0652055 3300046559 Bacteria 654
312 Ga0495686_0162724 3300047472 Bacteria 1303
313 Ga0496100_0319482 3300048903 Bacteria 1166
314 Ga0496102_0584485 3300048905 Bacteria 1040
315 Ga0496102_1135565 3300048905 Bacteria 701
316 Ga0496103_0171854 3300048906 Unclassified 1392
317 Ga0496103_0208939 3300048906 Bacteria 1255
318 Ga0496104_0002010 3300048907 Bacteria 17653
319 Ga0496105_0004105 3300048908 Bacteria 10917
320 Ga0496106_0061140 3300048909 Bacteria 2857
321 Ga0496106_0780563 3300048909 Bacteria 758
322 Ga0496107_0097296 3300048910 Bacteria 2155
323 Ga0496107_0109279 3300048910 Bacteria 2031
324 Ga0496108_0004273 3300048911 Bacteria 11501
325 Ga0496108_0261470 3300048911 Bacteria 1506
326 Ga0496109_0000421 3300048912 Bacteria 37279
327 Ga0496109_0052467 3300048912 Bacteria 3717
328 Ga0496110_0005760 3300048913 Bacteria 9733
329 Ga0496110_0063119 3300048913 Bacteria 3273
330 Ga0496110_0278156 3300048913 Bacteria 1524
331 Ga0496111_0001922 3300048914 Bacteria 12282
332 Ga0496111_0288419 3300048914 Bacteria 1217
333 Ga0496112_0000526 3300048915 Bacteria 26132
334 Ga0496112_0027726 3300048915 Bacteria 5462
335 Ga0496112_0444437 3300048915 Bacteria 1234
336 Ga0496112_1280083 3300048915 Unclassified 649
337 Ga0496113_0100128 3300048916 Bacteria 2245
338 Ga0496113_0233600 3300048916 Bacteria 1466
339 Ga0496113_0258401 3300048916 Bacteria 1391
340 Ga0501298_006496 3300049521 Bacteria 1913
341 Ga0501031_0343760 3300049568 Bacteria 966
342 Ga0501032_0202357 3300049569 Bacteria 1296
343 Ga0501034_0990420 3300049571 Unclassified 725
344 Ga0501036_0011339 3300049572 Bacteria 7377
345 Ga0501036_0111211 3300049572 Bacteria 2315
346 Ga0501039_0096344 3300049575 Bacteria 2307
347 Ga0501040_0099420 3300049576 Bacteria 2028
348 Ga0501040_0348787 3300049576 Unclassified 1060
349 Ga0501040_0375948 3300049576 Bacteria 1019
350 Ga0501041_0129892 3300049577 Bacteria 1569
351 Ga0501042_0026445 3300049578 Bacteria 4078
352 Ga0501042_0068664 3300049578 Bacteria 2535
353 Ga0501042_0860147 3300049578 Bacteria 660
354 Ga0501046_0131423 3300049580 Unclassified 1899
355 Ga0501048_0066914 3300049582 Bacteria 2540
356 Ga0501048_0150023 3300049582 Bacteria 1649
357 Ga0501067_0090974 3300049583 Bacteria 1694
358 Ga0501067_0733015 3300049583 Bacteria 556
359 Ga0501068_0370545 3300049584 Bacteria 921
360 Ga0501069_0423088 3300049585 Unclassified 790
361 Ga0501071_0156582 3300049587 Unclassified 1701
362 Ga0501071_0335104 3300049587 Unclassified 1150
363 Ga0501071_0550432 3300049587 Bacteria 886
364 Ga0501072_0019058 3300049588 Bacteria 5299
365 Ga0501072_0082647 3300049588 Bacteria 2546
366 Ga0501072_0418471 3300049588 Bacteria 1062
367 Ga0501073_0026338 3300049589 Bacteria 4167
368 Ga0501074_0012025 3300049590 Bacteria 6290
369 Ga0501074_0482725 3300049590 Unclassified 878
370 Ga0501075_0082074 3300049591 Bacteria 2441
371 Ga0501075_0129920 3300049591 Bacteria 1919
372 Ga0501075_0240154 3300049591 Unclassified 1381
373 Ga0501075_0484790 3300049591 Bacteria 943
374 Ga0501076_0040538 3300049592 Bacteria 3661
375 Ga0501076_0247564 3300049592 Bacteria 1458
376 Ga0501076_0288683 3300049592 Bacteria 1344
377 Ga0501077_0032643 3300049593 Bacteria 3314
378 Ga0501077_0149166 3300049593 Bacteria 1484
379 Ga0501230_046235 3300049667 Unclassified 855
380 Ga0501233_092686 3300049668 Bacteria 791
381 Ga0501235_047825 3300049669 Unclassified 987
382 Ga0501249_093337 3300049679 Unclassified 716
383 Ga0501257_034640 3300049686 Unclassified 1226
384 Ga0501221_083198 3300049704 Unclassified 773
385 Ga0501234_006513 3300049707 Bacteria 1827
386 Ga0501079_0091396 3300049741 Bacteria 2358
387 Ga0501080_0051706 3300049742 Bacteria 3824
388 Ga0501080_0172861 3300049742 Bacteria 1992
389 Ga0501080_0284935 3300049742 Unclassified 1501
390 Ga0501081_0021404 3300049743 Bacteria 4316
391 Ga0501281_06388 3300049777 Bacteria 826
392 Ga0501035_0091034 3300049822 Bacteria 2685
393 Ga0501045_0125683 3300049824 Bacteria 1905
394 Ga0501045_0396924 3300049824 Unclassified 1026
395 nmdc:mga0k408_158979_c1 3300050493 Bacteria 1346
396 nmdc:mga04h51_22036_c1 3300050495 Bacteria 1923
397 nmdc:mga05p37_154233_c1 3300050507 Bacteria 2808
398 nmdc:mga05p37_173553_c1 3300050507 Bacteria 2628
399 nmdc:mga05p37_195649_c1 3300050507 Bacteria 2452
400 nmdc:mga05p37_20825_c1 3300050507 Bacteria 7937
401 nmdc:mga05p37_221_c1 3300050507 Bacteria 57542
402 nmdc:mga05p37_225781_c1 3300050507 Bacteria 2258
403 nmdc:mga05p37_255602_c1 3300050507 Bacteria 2099
404 nmdc:mga05p37_2601_c1 3300050507 Bacteria 19727
405 nmdc:mga05p37_434919_c1 3300050507 Bacteria 1523
406 nmdc:mga05p37_474_c1 3300050507 Bacteria 43786
407 nmdc:mga05p37_542433_c1 3300050507 Bacteria 1326
408 nmdc:mga05p37_947829_c1 3300050507 Bacteria 921
409 nmdc:mga09592_179536_c1 3300050508 Unclassified 1831
410 nmdc:mga09592_25391_c1 3300050508 Bacteria 4904
411 nmdc:mga09592_27548_c1 3300050508 Bacteria 4716
412 nmdc:mga09592_328303_c1 3300050508 Bacteria 1325
413 nmdc:mga09592_462283_c1 3300050508 Bacteria 1094
414 nmdc:mga09592_52608_c1 3300050508 Bacteria 3437
415 nmdc:mga09592_72536_c1 3300050508 Bacteria 2923
416 nmdc:mga0qj67_1087_c1 3300050509 Bacteria 18814
417 nmdc:mga0qj67_1356818_c1 3300050509 Unclassified 550
418 nmdc:mga0qj67_21533_c1 3300050509 Bacteria 4946
419 nmdc:mga0qj67_285373_c1 3300050509 Bacteria 1338
420 nmdc:mga0qj67_363853_c1 3300050509 Bacteria 1169
421 nmdc:mga0qj67_499473_c1 3300050509 Bacteria 978
422 nmdc:mga0qj67_83648_c1 3300050509 Bacteria 2558
423 nmdc:mga06r32_17322_c1 3300050510 Bacteria 6578
424 nmdc:mga06r32_20184_c1 3300050510 Bacteria 6131
425 nmdc:mga06r32_39645_c1 3300050510 Bacteria 4470
426 nmdc:mga06r32_415625_c1 3300050510 Bacteria 1326
427 nmdc:mga06r32_94343_c1 3300050510 Bacteria 2928
428 nmdc:mga08y16_125145_c1 3300050511 Bacteria 2674
429 nmdc:mga08y16_209344_c1 3300050511 Bacteria 2020
430 nmdc:mga08y16_239771_c1 3300050511 Bacteria 1874
431 nmdc:mga08y16_464_c1 3300050511 Bacteria 37766
432 nmdc:mga08y16_587514_c1 3300050511 Bacteria 1124
433 nmdc:mga08y16_951221_c1 3300050511 Unclassified 842
434 nmdc:mga0n895_116364_c1 3300050512 Bacteria 2692
435 nmdc:mga0n895_68972_c1 3300050512 Bacteria 3503
436 nmdc:mga0rr50_11189_c1 3300050513 Bacteria 5726
437 nmdc:mga0rr50_8900_c1 3300050513 Bacteria 6272
438 nmdc:mga0a205_148778_c1 3300050515 Bacteria 2242
439 nmdc:mga0a205_199987_c1 3300050515 Bacteria 1889
440 nmdc:mga0a205_352637_c1 3300050515 Bacteria 1338
441 nmdc:mga0a205_39047_c1 3300050515 Bacteria 4569
442 nmdc:mga0a205_493745_c1 3300050515 Unclassified 1081
443 nmdc:mga0a205_494572_c1 3300050515 Bacteria 1080
444 nmdc:mga0a205_848339_c1 3300050515 Unclassified 761
445 nmdc:mga0a205_89929_c1 3300050515 Bacteria 2967
446 Ga0495619_0394573 3300053085 Bacteria 956
447 Ga0501084_0277153 3300054114 Bacteria 1416
448 Ga0501084_0307836 3300054114 Unclassified 1338
449 Ga0590071_000323 3300059421 Bacteria 14020
450 Ga0590071_011972 3300059421 Bacteria 2033
451 Ga0590074_000501 3300059423 Bacteria 5804
452 Ga0590075_000746 3300059424 Bacteria 8614
453 Ga0590075_056402 3300059424 Bacteria 1010
454 Ga0590077_000781 3300059426 Bacteria 8307
455 Ga0590077_025695 3300059426 Bacteria 1270
456 Ga0501082_0483159 3300060353 Unclassified 1083
457 Ga0530510_0533392 3300061734 Bacteria 891
458 Ga0530510_0979382 3300061734 Bacteria 647
459 Ga0070675_100279396
460 MBSR1b_contig_3060253
461 Ga0065712_10000850
462 Ga0065712_10034121
463 Ga0065715_10109416
464 Ga0065715_10110642
465 Ga0065715_10124929
466 Ga0065715_10131806
467 Ga0065715_10165709
468 Ga0070676_10116201
469 Ga0070676_10545779
470 Ga0070683_100000395
471 Ga0070683_100697560
472 Ga0070670_100460992
473 Ga0070670_100469821
474 Ga0068869_100154495
475 Ga0070682_100263771
476 Ga0068868_100113546
477 Ga0070660_100365516
478 Ga0070689_100010839
479 Ga0070689_100104105
480 Ga0070691_10424126
481 Ga0070661_100130499
482 Ga0070661_100135373
483 Ga0070668_100128070
484 Ga0070675_100569053
485 Ga0070675_100769789
486 Ga0070671_101085585
487 Ga0070674_100028702
488 Ga0070674_100101182
489 Ga0070674_100123593
490 Ga0070674_100987729
491 Ga0070673_100083161
492 Ga0070673_100109514
493 Ga0070673_100237447
494 Ga0070673_100424846
495 Ga0070688_100117517
496 Ga0070688_100138567
497 Ga0070688_100141747
498 Ga0070688_100172949
499 Ga0070688_100236722
500 Ga0070667_100008849
501 Ga0070694_100033993
502 Ga0070694_100679829
503 Ga0070663_100236981
504 Ga0070663_101411283
505 Ga0070678_100014935
506 Ga0070678_100090600
507 Ga0070678_100218776
508 Ga0070662_100329578
509 Ga0070685_10068621
510 Ga0070685_10258568
511 Ga0070707_100055361
512 Ga0070698_100044182
513 Ga0070684_100000197
514 Ga0068853_100675719
515 Ga0070672_100060753
516 Ga0070672_100255060
517 Ga0070695_100000811
518 Ga0070696_100346851
519 Ga0070696_100500994
520 Ga0070696_101686337
521 Ga0070693_100051696
522 Ga0070665_100480802
523 Ga0070665_100627372
524 Ga0070704_100323616
525 Ga0070704_100453966
526 Ga0070704_100496918
527 Ga0070664_100011277
528 Ga0070664_100017763
529 Ga0070664_100046643
530 Ga0070664_100391374
531 Ga0068857_101248686
532 Ga0068852_100201404
533 Ga0068852_100390949
534 Ga0068859_100414081
535 Ga0068859_101707724
536 Ga0068859_102424045
537 Ga0068859_102635015
538 Ga0068861_100123355
539 Ga0068870_10201194
540 Ga0068863_100798703
541 Ga0068863_101068695
542 Ga0068860_101025441
543 Ga0068862_100382023
544 Ga0068862_100721802
545 Ga0068862_102778453
546 Ga0075368_10030284
547 Ga0075367_10327663
548 Ga0075427_10059561
549 Ga0075366_10022461
550 Ga0097621_101014494
551 Ga0068871_100261838
552 Ga0068871_100771320
553 Ga0075428_100000086
554 Ga0075428_100055006
555 Ga0075428_100072724
556 Ga0075428_100360884
557 Ga0075428_100987603
558 Ga0075430_100000028
559 Ga0075430_100063394
560 Ga0075430_100126379
561 Ga0075430_100211285
562 Ga0075430_100231794
563 Ga0075430_100283762
564 Ga0075430_100355390
565 Ga0075430_101660125
566 Ga0075431_100003561
567 Ga0075431_100003906
568 Ga0075431_100022723
569 Ga0075431_100025573
570 Ga0075431_100028998
571 Ga0075431_100090424
572 Ga0075431_100106971
573 Ga0075431_100256420
574 Ga0075431_100379382
575 Ga0075431_101906436
576 Ga0075433_10037409
577 Ga0075433_10093983
578 Ga0075433_10135348
579 Ga0075433_10198500
580 Ga0075433_10313625
581 Ga0075433_10412145
582 Ga0075433_10483485
583 Ga0075434_100108818
584 Ga0075434_100353053
585 Ga0075434_101760020
586 Ga0075429_100004161
587 Ga0075429_100009460
588 Ga0075429_100027239
589 Ga0075429_100445358
590 Ga0075429_100689678
591 Ga0068865_100221073
592 Ga0097620_100414111
593 Ga0097620_101707982
594 Ga0097620_102422930
595 Ga0097620_102635987
596 Ga0075435_100002690
597 Ga0075435_100013785
598 Ga0111539_10000166
599 Ga0111539_10051720
600 Ga0111539_10205185
601 Ga0111539_10863511
602 Ga0111539_12890973
603 Ga0114129_10000148
604 Ga0114129_10000400
605 Ga0114129_10009548
606 Ga0114129_10017703
607 Ga0114129_10023952
608 Ga0114129_10026994
609 Ga0114129_10036130
610 Ga0114129_10076746
611 Ga0114129_10209099
612 Ga0114129_10309212
613 Ga0114129_10379916
614 Ga0114129_10578612
615 Ga0114129_11812383
616 Ga0105243_10629100
617 Ga0105243_11584960
618 Ga0105242_10199034
619 Ga0105248_10010754
620 Ga0105248_10526537
621 Ga0105248_10612398
622 Ga0105249_10200367
623 Ga0105249_10273341
624 Ga0105249_10626368
625 Ga0105249_10914467
626 Ga0105249_12336339
627 Ga0105239_11316933
628 Ga0105239_11325134
629 Ga0105246_10056142
630 Ga0157374_10202586
631 Ga0157378_11304805
632 Ga0163163_10017401
633 Ga0163163_10021873
634 Ga0157380_10005238
635 Ga0157380_10061585
636 Ga0157380_10378067
637 Ga0157380_11081764
638 Ga0157380_11252119
639 Ga0157377_10231399
640 Ga0157379_10425217
641 Ga0157376_10190434
642 Ga0207697_10001424
643 Ga0207697_10004300
644 Ga0207642_10072437
645 Ga0207642_10216155
646 Ga0207688_10003623
647 Ga0207688_10039075
648 Ga0207645_10236148
649 Ga0207645_10290829
650 Ga0207660_10168339
651 Ga0207662_10436138
652 Ga0207662_10753624
653 Ga0207649_10119725
654 Ga0207646_10258940
655 Ga0207681_10200504
656 Ga0207681_10351741
657 Ga0207650_10018735
658 Ga0207650_10023683
659 Ga0207650_10035915
660 Ga0207650_10038902
661 Ga0207659_10067332
662 Ga0207659_10104312
663 Ga0207659_11249352
664 Ga0207644_10182530
665 Ga0207644_10544545
666 Ga0207644_10621657
667 Ga0207690_10361747
668 Ga0207686_10112910
669 Ga0207670_10158502
670 Ga0207670_10508700
671 Ga0207669_10058262
672 Ga0207669_10116748
673 Ga0207669_10732538
674 Ga0207669_11190679
675 Ga0207691_10083924
676 Ga0207691_10120554
677 Ga0207691_10501213
678 Ga0207711_10050694
679 Ga0207711_10430217
680 Ga0207689_10084501
681 Ga0207661_10001796
682 Ga0207661_10222730
683 Ga0207679_10004009
684 Ga0207679_10011845
685 Ga0207679_10139363
686 Ga0207679_10329949
687 Ga0207651_10055721
688 Ga0207651_10059502
689 Ga0207651_10269494
690 Ga0207712_10128956
691 Ga0207712_10811194
692 Ga0207668_10261211
693 Ga0207668_10684652
694 Ga0207640_10079213
695 Ga0207658_10024099
696 Ga0207658_10504419
697 Ga0207677_10080053
698 Ga0207639_10306615
699 Ga0207678_10154269
700 Ga0207678_10175132
701 Ga0207708_10832713
702 Ga0207648_11145814
703 Ga0207675_100013531
704 Ga0207683_10084658
705 Ga0207683_10247003
706 Ga0207698_10049477
707 Ga0207698_10524710
708 Ga0209813_10121312
709 Ga0207428_10000251
710 Ga0207428_10096061
711 Ga0207428_10529070
712 Ga0268266_10540377
713 Ga0268264_10540751
714 Ga0307408_100014091
715 Ga0307408_100026302
716 Ga0307408_100519566
717 Ga0307408_101548324
718 Ga0307413_10439476
719 Ga0307410_10039318
720 Ga0307410_10064791
721 Ga0307406_10181316
722 Ga0307407_10011022
723 Ga0307412_10020737
724 Ga0307409_100010108
725 Ga0307409_100035325
726 Ga0307409_100088406
727 Ga0307416_100020517
728 Ga0307416_100032467
729 Ga0307416_100588117
730 Ga0307416_102877584
731 Ga0307414_10782511
732 Ga0307411_10012926
733 Ga0307411_10178000
734 Ga0307411_10270136
735 Ga0307411_10816305
736 Ga0307411_11082560
737 Ga0307415_100054385
738 Ga0307415_100743531
739 Ga0373932_0365789
740 Ga0373931_0589219
741 Ga0373947_0163433
742 Ga0373925_0009079
743 Ga0373925_0507054
744 Ga0395901_0542254
745 Ga0451802_1938805
746 Ga0451807_2098033
747 Ga0439433_0040132
748 Ga0439437_017128
749 Ga0439437_038115
750 Ga0439441_032040
751 Ga0439443_014006
752 Ga0439443_023053
753 Ga0439450_000724
754 Ga0450920_013084
755 Ga0450923_018324
756 Ga0450898_028788
757 Ga0450898_089966
758 Ga0439446_0020520
759 Ga0439434_0132866
760 Ga0439435_0019309
761 Ga0439435_0262165
762 Ga0439444_0031387
763 Ga0439464_0018846
764 Ga0439460_0081436
765 Ga0439460_0166630
766 Ga0450893_0027493
767 Ga0439440_0021521
768 Ga0495586_0302068
769 Ga0495667_0652055
770 Ga0495686_0162724
771 Ga0496100_0319482
772 Ga0496102_0584485
773 Ga0496102_1135565
774 Ga0496103_0171854
775 Ga0496103_0208939
776 Ga0496104_0002010
777 Ga0496105_0004105
778 Ga0496106_0061140
779 Ga0496106_0780563
780 Ga0496107_0097296
781 Ga0496107_0109279
782 Ga0496108_0004273
783 Ga0496108_0261470
784 Ga0496109_0000421
785 Ga0496109_0052467
786 Ga0496110_0005760
787 Ga0496110_0063119
788 Ga0496110_0278156
789 Ga0496111_0001922
790 Ga0496111_0288419
791 Ga0496112_0000526
792 Ga0496112_0027726
793 Ga0496112_0444437
794 Ga0496112_1280083
795 Ga0496113_0100128
796 Ga0496113_0233600
797 Ga0496113_0258401
798 Ga0501298_006496
799 Ga0501031_0343760
800 Ga0501032_0202357
801 Ga0501034_0990420
802 Ga0501036_0011339
803 Ga0501036_0111211
804 Ga0501039_0096344
805 Ga0501040_0099420
806 Ga0501040_0348787
807 Ga0501040_0375948
808 Ga0501041_0129892
809 Ga0501042_0026445
810 Ga0501042_0068664
811 Ga0501042_0860147
812 Ga0501046_0131423
813 Ga0501048_0066914
814 Ga0501048_0150023
815 Ga0501067_0090974
816 Ga0501067_0733015
817 Ga0501068_0370545
818 Ga0501069_0423088
819 Ga0501071_0156582
820 Ga0501071_0335104
821 Ga0501071_0550432
822 Ga0501072_0019058
823 Ga0501072_0082647
824 Ga0501072_0418471
825 Ga0501073_0026338
826 Ga0501074_0012025
827 Ga0501074_0482725
828 Ga0501075_0082074
829 Ga0501075_0129920
830 Ga0501075_0240154
831 Ga0501075_0484790
832 Ga0501076_0040538
833 Ga0501076_0247564
834 Ga0501076_0288683
835 Ga0501077_0032643
836 Ga0501077_0149166
837 Ga0501230_046235
838 Ga0501233_092686
839 Ga0501235_047825
840 Ga0501249_093337
841 Ga0501257_034640
842 Ga0501221_083198
843 Ga0501234_006513
844 Ga0501079_0091396
845 Ga0501080_0051706
846 Ga0501080_0172861
847 Ga0501080_0284935
848 Ga0501081_0021404
849 Ga0501281_06388
850 Ga0501035_0091034
851 Ga0501045_0125683
852 Ga0501045_0396924
853 nmdc:mga0k408_158979_c1
854 nmdc:mga04h51_22036_c1
855 nmdc:mga05p37_154233_c1
856 nmdc:mga05p37_173553_c1
857 nmdc:mga05p37_195649_c1
858 nmdc:mga05p37_20825_c1
859 nmdc:mga05p37_221_c1
860 nmdc:mga05p37_225781_c1
861 nmdc:mga05p37_255602_c1
862 nmdc:mga05p37_2601_c1
863 nmdc:mga05p37_434919_c1
864 nmdc:mga05p37_474_c1
865 nmdc:mga05p37_542433_c1
866 nmdc:mga05p37_947829_c1
867 nmdc:mga09592_179536_c1
868 nmdc:mga09592_25391_c1
869 nmdc:mga09592_27548_c1
870 nmdc:mga09592_328303_c1
871 nmdc:mga09592_462283_c1
872 nmdc:mga09592_52608_c1
873 nmdc:mga09592_72536_c1
874 nmdc:mga0qj67_1087_c1
875 nmdc:mga0qj67_1356818_c1
876 nmdc:mga0qj67_21533_c1
877 nmdc:mga0qj67_285373_c1
878 nmdc:mga0qj67_363853_c1
879 nmdc:mga0qj67_499473_c1
880 nmdc:mga0qj67_83648_c1
881 nmdc:mga06r32_17322_c1
882 nmdc:mga06r32_20184_c1
883 nmdc:mga06r32_39645_c1
884 nmdc:mga06r32_415625_c1
885 nmdc:mga06r32_94343_c1
886 nmdc:mga08y16_125145_c1
887 nmdc:mga08y16_209344_c1
888 nmdc:mga08y16_239771_c1
889 nmdc:mga08y16_464_c1
890 nmdc:mga08y16_587514_c1
891 nmdc:mga08y16_951221_c1
892 nmdc:mga0n895_116364_c1
893 nmdc:mga0n895_68972_c1
894 nmdc:mga0rr50_11189_c1
895 nmdc:mga0rr50_8900_c1
896 nmdc:mga0a205_148778_c1
897 nmdc:mga0a205_199987_c1
898 nmdc:mga0a205_352637_c1
899 nmdc:mga0a205_39047_c1
900 nmdc:mga0a205_493745_c1
901 nmdc:mga0a205_494572_c1
902 nmdc:mga0a205_848339_c1
903 nmdc:mga0a205_89929_c1
904 Ga0495619_0394573
905 Ga0501084_0277153
906 Ga0501084_0307836
907 Ga0590071_000323
908 Ga0590071_011972
909 Ga0590074_000501
910 Ga0590075_000746
911 Ga0590075_056402
912 Ga0590077_000781
913 Ga0590077_025695
914 Ga0501082_0483159
915 Ga0530510_0533392
916 Ga0530510_0979382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tw1-assembly1.cif.gz_A structure of rtt106-ahn 0.8112 43 131
3gyp-assembly1.cif.gz_A rtt106p 0.8027 43 132
4wj7-assembly4.cif.gz_D ccm2 ptb domain in complex with krit1 npxy/f3 0.8013 57 132
3to1-assembly1.cif.gz_A two surfaces on rtt106 mediate histone binding and chaperone activity 0.7967 43 129
3dcx-assembly1.cif.gz_E crystal structure of a duf1696 family protein with a pleckstrin-homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution 0.7897 36 133
ID Description Score Start End Superfamily
af_O33223_7_176_3.90.320.10 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.8601 58 139 3.90.320.10
af_Q3ECP0_12_100_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8254 60 132 2.30.29.30
af_Q54S40_938_1039_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8206 43 134 2.30.29.30
af_P40161_206_302_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8183 43 132 2.30.29.30
af_P15038_1_164_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8172 43 139 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A1Q6XDA6-F1-model_v4 YokE-like PH domain-containing protein 0.9874 43 133
AF-A0A2V9JU21-F1-model_v4 DUF304 domain-containing protein 0.9835 43 135
AF-A0A538REW4-F1-model_v4 DUF304 domain-containing protein 0.983 5 141 GO:0016020
AF-A0A522LVD8-F1-model_v4 PH domain-containing protein 0.9813 43 135
AF-A0A7V5ZJK8-F1-model_v4 PH domain-containing protein 0.9777 42 135

Map