metagRoot

F448084

General Info

Members	Datasets	Scaffolds	Average Seq Length
457	280	443	379

Family's Representative Sequence

Representative Sequence	3300053077\|Ga0495601_0043172\|Ga0495601_0043172_262_1599
Length	437
Sequence	VSPLEDTPRVAGQAAVAGRQAQQGNMRSLDQLDVLGKRVLVRVDFNVPLKKGQDGAIEVADDTRIVQALPTIEELRARGARLVLVSHLGRPEGRPEADLSLAPVVARLRELIDVVGASARALAHRLAYGEVLVLENVRFMPGETTNDPELARALAELADVYVNDAFGAAHRAHASTAGVAHLLPCAAGRLLEREVKTLTGILEHPERPLVAVIGGAKVADKIAVIDRFLAIADAVVIGGAMCFPFLAAQGHEVGDSLCDAEDVEHARALFVQAALPHKARLELPVDLVIGDRLAADAEHRVLGSQPGGRAGQAGEQTGLDVPEGWMGLDIGPATAERYAQLVENAGTVFWNGPMGAFELEPFAGGTRRVARAVAGAKGVTVVGGGDSAAALVHFGMEGSVDHLSTGGGATLELVEGRMLPGVQALETPSGVQVAGGA

Samples

	Sample ID	Description	Type	Environment
1	2547132424	Nocardia nova SH22a	Isolate	Unclassified
2	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
3	2687453257	Planctomyces sp. SH-PL62	Isolate	Unclassified
4	2852673933	Sporosarcina sp. JAI121	Isolate	Rhizosphere
5	2857609550	Domibacillus sp. R-71929	Isolate	Unclassified
6	2889415604	Paludisphaera rhizosphaerae JC665	Isolate	Rhizosphere
7	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
8	2920107658	Aquisphaera insulae JC669	Isolate	Rhizosphere
9	2928142448	Prescottella equi DPS 2018	Isolate	Unclassified
10	2928510474	Sporosarcina psychrophila 1288	Isolate	Rhizosphere
11	2939593269	Lysinibacillus parviboronicapiens 736	Isolate	Rhizosphere
12	2964375228	Anaerobacillus alkaliphilus B16-10	Isolate	Rhizosphere
13	3001119090	Lolliginicoccus lacisalsi G463	Isolate	Rhizosphere
14	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
15	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
16	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
17	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
18	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
21	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
22	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
26	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
27	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
28	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
29	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
30	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
31	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
37	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
38	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
39	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
40	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
41	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
42	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
43	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
44	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
50	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
51	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
52	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
53	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
54	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
55	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
56	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
57	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
58	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
59	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
60	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
61	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
62	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
63	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
64	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
65	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
66	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
68	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
71	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
73	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
74	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
75	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
76	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
77	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
78	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
79	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
80	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
83	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
84	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
85	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
86	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
87	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
88	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
89	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
139	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
140	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
141	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
142	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
143	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
144	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
145	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
146	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
147	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
148	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
149	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
150	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
151	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
152	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
153	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
154	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
155	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
156	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
157	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
158	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
159	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
160	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
161	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
162	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
163	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
164	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
165	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
166	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
167	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
168	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
169	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
170	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
171	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
172	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
173	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
174	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
175	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
176	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
177	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
178	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
179	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
180	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
181	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
182	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
183	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
184	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
185	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
186	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
187	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
188	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
189	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
190	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
191	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
192	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
193	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
194	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
195	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
196	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
197	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
198	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
199	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
200	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
201	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
202	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
203	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
204	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
205	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
206	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
207	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
208	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
209	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
210	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
211	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
212	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
213	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
214	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
215	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
216	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
217	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
218	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
219	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
220	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
221	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
222	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
223	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
224	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
225	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
226	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
227	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
228	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
229	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
230	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
231	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
232	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
233	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
234	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
235	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
236	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
237	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
238	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
239	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
248	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
251	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
252	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
253	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
254	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
255	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
258	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
262	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
263	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
264	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
265	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
266	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
267	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
268	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
269	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
270	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
271	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
272	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
273	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
274	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
275	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
276	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
277	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
278	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
279	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
280	8055531788	Lysinibacillus pakistanensis LY1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.72
Metatranscriptomes	0.22
Isolates	3.06

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.28
Nodule	0
Rhizoplane	9.63
Rhizosphere	83.59
Stem	0
Stem Tuber	0
Unclassified	3.5

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070683_100014931	3300005329	Bacteria	6808
2	Ga0070683_100054804	3300005329	Bacteria	3698
3	Ga0070683_100291684	3300005329	Bacteria	1551
4	Ga0070690_100121147	3300005330	Bacteria	1756
5	Ga0070670_100007187	3300005331	Bacteria	9432
6	Ga0070666_10033650	3300005335	Bacteria	3392
7	Ga0070682_100034749	3300005337	Bacteria	3072
8	Ga0070682_100138541	3300005337	Bacteria	1656
9	Ga0068868_100059389	3300005338	Bacteria	3024
10	Ga0070660_100017478	3300005339	Bacteria	5228
11	Ga0070691_10031886	3300005341	Bacteria	2473
12	Ga0070661_100033691	3300005344	Bacteria	3711
13	Ga0070661_100066043	3300005344	Bacteria	2658
14	Ga0070671_100065963	3300005355	Bacteria	3016
15	Ga0070671_100189300	3300005355	Bacteria	1744
16	Ga0070659_100096357	3300005366	Bacteria	2376
17	Ga0070714_100000695	3300005435	Bacteria	23799
18	Ga0070714_100039124	3300005435	Bacteria	3991
19	Ga0070713_100100264	3300005436	Bacteria	2507
20	Ga0070710_10011979	3300005437	Bacteria	4297
21	Ga0070701_10013623	3300005438	Bacteria	3704
22	Ga0070711_100036669	3300005439	Bacteria	3286
23	Ga0070711_100043189	3300005439	Bacteria	3052
24	Ga0070700_100042152	3300005441	Bacteria	2801
25	Ga0070708_100002425	3300005445	Bacteria	14451
26	Ga0070708_100014932	3300005445	Bacteria	6403
27	Ga0070708_100028098	3300005445	Bacteria	4837
28	Ga0070662_100135819	3300005457	Bacteria	1901
29	Ga0068867_100004348	3300005459	Bacteria	9973
30	Ga0070706_100025688	3300005467	Bacteria	5421
31	Ga0070707_100278425	3300005468	Bacteria	1626
32	Ga0070699_100089679	3300005518	Bacteria	2687
33	Ga0070679_100126052	3300005530	Bacteria	2543
34	Ga0070684_100206737	3300005535	Bacteria	1789
35	Ga0070693_100029205	3300005547	Bacteria	3006
36	Ga0070665_100000632	3300005548	Bacteria	47885
37	Ga0070665_100118331	3300005548	Bacteria	2651
38	Ga0070665_100168258	3300005548	Bacteria	2194
39	Ga0070665_100303679	3300005548	Bacteria	1599
40	Ga0068855_100023771	3300005563	Bacteria	7341
41	Ga0070664_100300698	3300005564	Bacteria	1450
42	Ga0068854_100180966	3300005578	Bacteria	1647
43	Ga0068856_100008405	3300005614	Bacteria	10055
44	Ga0068856_100264643	3300005614	Bacteria	1735
45	Ga0068856_100408782	3300005614	Bacteria	1377
46	Ga0070702_100010664	3300005615	Bacteria	4538
47	Ga0068852_100073599	3300005616	Bacteria	3006
48	Ga0068859_100152558	3300005617	Bacteria	2386
49	Ga0068864_100038213	3300005618	Bacteria	4098
50	Ga0068851_10002120	3300005834	Bacteria	8719
51	Ga0068858_100000497	3300005842	Bacteria	41136
52	Ga0068858_100089750	3300005842	Bacteria	2860
53	Ga0068860_100045753	3300005843	Bacteria	4173
54	Ga0068860_100290798	3300005843	Bacteria	1599
55	Ga0068862_100108641	3300005844	Bacteria	2433
56	Ga0081455_10050743	3300005937	Bacteria	3564
57	Ga0081538_10000514	3300005981	Bacteria	43252
58	Ga0081538_10001885	3300005981	Bacteria	21119
59	Ga0081538_10004433	3300005981	Bacteria	12939
60	Ga0081538_10044170	3300005981	Bacteria	2784
61	Ga0081540_1000306	3300005983	Bacteria	50547
62	Ga0081539_10003296	3300005985	Bacteria	20206
63	Ga0070717_10006562	3300006028	Bacteria	8570
64	Ga0070717_10038922	3300006028	Bacteria	3866
65	Ga0070717_10083087	3300006028	Bacteria	2692
66	Ga0075365_10038372	3300006038	Bacteria	3113
67	Ga0075363_100014085	3300006048	Bacteria	3896
68	Ga0075362_10012535	3300006177	Bacteria	3370
69	Ga0075367_10041164	3300006178	Bacteria	2700
70	Ga0075428_100061880	3300006844	Bacteria	4099
71	Ga0075428_100264462	3300006844	Bacteria	1852
72	Ga0075428_100281030	3300006844	Bacteria	1791
73	Ga0075430_100297706	3300006846	Bacteria	1334
74	Ga0075434_100005221	3300006871	Bacteria	11799
75	Ga0075429_100192739	3300006880	Bacteria	1785
76	Ga0097620_100152552	3300006931	Bacteria	2386
77	Ga0075435_100006532	3300007076	Bacteria	8247
78	Ga0105240_10000239	3300009093	Bacteria	109259
79	Ga0105240_10021155	3300009093	Bacteria	8660
80	Ga0105240_10021786	3300009093	Bacteria	8516
81	Ga0105240_10116988	3300009093	Bacteria	3215
82	Ga0111539_10014275	3300009094	Bacteria	9922
83	Ga0111539_10022251	3300009094	Bacteria	7792
84	Ga0111539_10190356	3300009094	Bacteria	2394
85	Ga0105245_10007321	3300009098	Bacteria	9664
86	Ga0105245_10213475	3300009098	Bacteria	1859
87	Ga0105245_10268807	3300009098	Bacteria	1662
88	Ga0114129_10115628	3300009147	Bacteria	3697
89	Ga0114129_10210949	3300009147	Bacteria	2625
90	Ga0114129_10258680	3300009147	Bacteria	2334
91	Ga0105243_10032229	3300009148	Bacteria	4047
92	Ga0105243_10165213	3300009148	Bacteria	1912
93	Ga0105241_10195841	3300009174	Bacteria	1685
94	Ga0105242_10012941	3300009176	Bacteria	6433
95	Ga0105242_10196349	3300009176	Bacteria	1790
96	Ga0105237_10001661	3300009545	Bacteria	28883
97	Ga0105237_10283697	3300009545	Bacteria	1659
98	Ga0105238_10007559	3300009551	Bacteria	10887
99	Ga0105238_10048591	3300009551	Bacteria	4275
100	Ga0105249_10157912	3300009553	Bacteria	2189
101	Ga0105249_10177748	3300009553	Bacteria	2068
102	Ga0105239_10116674	3300010375	Bacteria	2963
103	Ga0105246_10007821	3300011119	Bacteria	6559
104	Ga0105246_10014139	3300011119	Bacteria	5016
105	Ga0157371_10025496	3300013102	Bacteria	4307
106	Ga0157378_10010775	3300013297	Bacteria	7992
107	Ga0163163_10071286	3300014325	Bacteria	3462
108	Ga0157379_10058861	3300014968	Bacteria	3436
109	Ga0157379_10108836	3300014968	Bacteria	2489
110	Ga0206356_11066038	3300020070	Bacteria	3565
111	Ga0213873_10001448	3300021358	Bacteria	3937
112	Ga0213876_10018870	3300021384	Bacteria	3642
113	Ga0213875_10000095	3300021388	Bacteria	102332
114	Ga0213875_10032746	3300021388	Bacteria	2455
115	Ga0213871_10001375	3300021441	Bacteria	4040
116	Ga0209025_1016219	3300025294	Bacteria	4420
117	Ga0207656_10042815	3300025321	Bacteria	1928
118	Ga0207692_10008211	3300025898	Bacteria	4316
119	Ga0207688_10001500	3300025901	Bacteria	12251
120	Ga0207680_10009002	3300025903	Bacteria	4928
121	Ga0207647_10000326	3300025904	Bacteria	39076
122	Ga0207643_10056113	3300025908	Bacteria	2240
123	Ga0207684_10033625	3300025910	Bacteria	4360
124	Ga0207654_10029555	3300025911	Bacteria	3002
125	Ga0207695_10010063	3300025913	Bacteria	11612
126	Ga0207695_10070523	3300025913	Bacteria	3572
127	Ga0207671_10020272	3300025914	Bacteria	5064
128	Ga0207671_10057459	3300025914	Bacteria	2884
129	Ga0207671_10079762	3300025914	Bacteria	2453
130	Ga0207693_10014455	3300025915	Bacteria	6346
131	Ga0207693_10061426	3300025915	Bacteria	2943
132	Ga0207663_10004594	3300025916	Bacteria	6881
133	Ga0207663_10009452	3300025916	Bacteria	5149
134	Ga0207657_10009046	3300025919	Bacteria	10057
135	Ga0207657_10208492	3300025919	Bacteria	1569
136	Ga0207652_10171963	3300025921	Bacteria	1944
137	Ga0207646_10069779	3300025922	Bacteria	3139
138	Ga0207694_10006344	3300025924	Bacteria	9025
139	Ga0207694_10057972	3300025924	Bacteria	3012
140	Ga0207650_10009082	3300025925	Bacteria	6795
141	Ga0207650_10074069	3300025925	Bacteria	2566
142	Ga0207687_10002296	3300025927	Bacteria	13027
143	Ga0207687_10178228	3300025927	Bacteria	1644
144	Ga0207700_10071572	3300025928	Bacteria	2670
145	Ga0207664_10059599	3300025929	Bacteria	3040
146	Ga0207690_10028886	3300025932	Bacteria	3519
147	Ga0207706_10032594	3300025933	Bacteria	4640
148	Ga0207706_10063363	3300025933	Bacteria	3255
149	Ga0207706_10096762	3300025933	Bacteria	2596
150	Ga0207669_10009666	3300025937	Bacteria	4609
151	Ga0207704_10018009	3300025938	Bacteria	3677
152	Ga0207704_10165629	3300025938	Bacteria	1578
153	Ga0207665_10014888	3300025939	Bacteria	5111
154	Ga0207691_10052739	3300025940	Bacteria	3714
155	Ga0207689_10011563	3300025942	Bacteria	7561
156	Ga0207661_10021118	3300025944	Bacteria	4877
157	Ga0207661_10461902	3300025944	Bacteria	1157
158	Ga0207679_10010216	3300025945	Bacteria	6038
159	Ga0207679_10071163	3300025945	Bacteria	2623
160	Ga0207679_10206201	3300025945	Bacteria	1646
161	Ga0207667_10056773	3300025949	Bacteria	4111
162	Ga0207667_10117559	3300025949	Bacteria	2740
163	Ga0207651_10074729	3300025960	Bacteria	2415
164	Ga0207712_10000321	3300025961	Bacteria	43794
165	Ga0207640_10105391	3300025981	Bacteria	1987
166	Ga0207640_10287509	3300025981	Bacteria	1295
167	Ga0207677_10031855	3300026023	Bacteria	3381
168	Ga0207677_10046994	3300026023	Bacteria	2895
169	Ga0207703_10001632	3300026035	Bacteria	20217
170	Ga0207703_10077757	3300026035	Bacteria	2755
171	Ga0207703_10200079	3300026035	Bacteria	1775
172	Ga0207639_10025231	3300026041	Bacteria	4309
173	Ga0207678_10140545	3300026067	Bacteria	2060
174	Ga0207708_10095670	3300026075	Bacteria	2294
175	Ga0207708_10183620	3300026075	Bacteria	1661
176	Ga0207702_10147129	3300026078	Bacteria	2139
177	Ga0207648_10010142	3300026089	Bacteria	8957
178	Ga0207674_10300784	3300026116	Bacteria	1553
179	Ga0207675_100314084	3300026118	Bacteria	1529
180	Ga0207683_10037400	3300026121	Bacteria	4226
181	Ga0207683_10151678	3300026121	Bacteria	2092
182	Ga0207698_10080871	3300026142	Bacteria	2620
183	Ga0207428_10018799	3300027907	Bacteria	5896
184	Ga0207428_10153588	3300027907	Bacteria	1751
185	Ga0268266_10000008	3300028379	Bacteria	1161875
186	Ga0268266_10248947	3300028379	Bacteria	1643
187	Ga0268266_10278741	3300028379	Bacteria	1554
188	Ga0268265_10049869	3300028380	Bacteria	3151
189	Ga0268264_10017152	3300028381	Bacteria	5930
190	Ga0268264_10073902	3300028381	Bacteria	2895
191	Ga0265337_1006811	3300028556	Bacteria	4349
192	Ga0265326_10001791	3300028558	Bacteria	7415
193	Ga0265319_1000144	3300028563	Bacteria	52606
194	Ga0265318_10002150	3300028577	Bacteria	10707
195	Ga0265336_10000002	3300028666	Bacteria	830172
196	Ga0265338_10000001	3300028800	Bacteria	1177449
197	Ga0265324_10003810	3300029957	Bacteria	7048
198	Ga0265340_10000001	3300031247	Bacteria	1647668
199	Ga0265316_10044621	3300031344	Bacteria	3524
200	Ga0265342_10061593	3300031712	Bacteria	2210
201	Ga0316576_10028542	3300031727	Bacteria	3934
202	Ga0307413_10075276	3300031824	Bacteria	2142
203	Ga0307410_10105796	3300031852	Bacteria	2026
204	Ga0307406_10241710	3300031901	Bacteria	1354
205	Ga0307407_10007826	3300031903	Bacteria	4865
206	Ga0307412_10068641	3300031911	Bacteria	2411
207	Ga0307409_100007360	3300031995	Bacteria	6577
208	Ga0307409_100263862	3300031995	Bacteria	1582
209	Ga0307416_100008401	3300032002	Bacteria	6660
210	Ga0307416_100040230	3300032002	Bacteria	3629
211	Ga0307416_100318317	3300032002	Bacteria	1556
212	Ga0307414_10274618	3300032004	Bacteria	1413
213	Ga0307411_10030099	3300032005	Bacteria	3324
214	Ga0307411_10177903	3300032005	Bacteria	1611
215	Ga0307415_100001872	3300032126	Bacteria	10327
216	Ga0373945_0005296	3300035116	Bacteria	4128
217	Ga0373946_0018889	3300035171	Bacteria	2650
218	Ga0316574_0047369	3300035398	Bacteria	2668
219	Ga0373931_0081100	3300035691	Bacteria	1791
220	Ga0373935_0226487	3300035692	Bacteria	1300
221	Ga0373947_0003704	3300035725	Bacteria	9026
222	Ga0316584_0027794	3300036712	Bacteria	4165
223	Ga0373925_0003118	3300037068	Bacteria	13017
224	Ga0373925_0055534	3300037068	Bacteria	2965
225	Ga0395899_0003455	3300037312	Bacteria	12522
226	Ga0395900_0097494	3300037418	Bacteria	3020
227	Ga0395898_0033228	3300037466	Bacteria	5149
228	Ga0395905_0005339	3300037471	Bacteria	13132
229	Ga0436364_0860606	3300037853	Bacteria	3246
230	Ga0436364_1294613	3300037853	Bacteria	100298
231	Ga0436364_1447776	3300037853	Bacteria	4132
232	Ga0395901_0356500	3300038443	Bacteria	1509
233	Ga0400485_08530	3300038735	Bacteria	9384
234	Ga0436365_0405759	3300039437	Bacteria	1445
235	Ga0436365_1799679	3300039437	Bacteria	12113
236	Ga0436360_0121251	3300039438	Bacteria	3609
237	Ga0436361_0484246	3300039447	Bacteria	3668
238	Ga0436363_1335775	3300039450	Bacteria	3537
239	Ga0436362_0320430	3300039453	Bacteria	9108
240	Ga0451833_0911976	3300041491	Bacteria	1221
241	Ga0451577_0003411	3300042876	Bacteria	17723
242	Ga0466963_0013726	3300044694	Bacteria	4982
243	Ga0466963_0026609	3300044694	Bacteria	3700
244	Ga0466963_0026894	3300044694	Bacteria	3680
245	Ga0466963_0063532	3300044694	Bacteria	2471
246	Ga0466963_0149998	3300044694	Bacteria	1618
247	Ga0466964_0051638	3300044706	Bacteria	1689
248	Ga0453684_0021860	3300044712	Bacteria	9526
249	Ga0453684_0054884	3300044712	Bacteria	5185
250	Ga0466971_0074809	3300044719	Bacteria	1540
251	Ga0466958_0037916	3300045836	Bacteria	2890
252	Ga0466958_0066151	3300045836	Bacteria	2207
253	Ga0466967_0002553	3300045976	Bacteria	11410
254	Ga0466967_0008361	3300045976	Bacteria	7573
255	Ga0466967_0050299	3300045976	Bacteria	3649
256	Ga0466967_0050611	3300045976	Bacteria	3638
257	Ga0466967_0066789	3300045976	Bacteria	3206
258	Ga0466967_0197807	3300045976	Bacteria	1902
259	Ga0466967_0294340	3300045976	Bacteria	1560
260	Ga0466967_0298644	3300045976	Bacteria	1549
261	Ga0495603_0033723	3300046455	Bacteria	3079
262	Ga0495629_0051245	3300046459	Bacteria	2889
263	Ga0495641_0003915	3300046461	Bacteria	10822
264	Ga0495641_0034325	3300046461	Bacteria	2399
265	Ga0495641_0074041	3300046461	Bacteria	1528
266	Ga0495651_0067994	3300046462	Bacteria	2716
267	Ga0495653_0000718	3300046463	Bacteria	25191
268	Ga0495653_0007703	3300046463	Bacteria	8812
269	Ga0495653_0012191	3300046463	Bacteria	7014
270	Ga0495580_0011252	3300046472	Bacteria	6924
271	Ga0495582_0000011	3300046473	Bacteria	113352
272	Ga0495582_0003433	3300046473	Bacteria	8925
273	Ga0495639_0000900	3300046475	Bacteria	13432
274	Ga0495662_0004791	3300046476	Bacteria	6779
275	Ga0495662_0130496	3300046476	Bacteria	1235
276	Ga0495664_0000007	3300046477	Bacteria	386710
277	Ga0495664_0009688	3300046477	Bacteria	5395
278	Ga0495618_0000478	3300046514	Bacteria	28566
279	Ga0495618_0002981	3300046514	Bacteria	10699
280	Ga0495628_0001219	3300046516	Bacteria	23555
281	Ga0495628_0182826	3300046516	Bacteria	1585
282	Ga0495630_0003283	3300046517	Bacteria	11285
283	Ga0495630_0041078	3300046517	Bacteria	3454
284	Ga0495630_0075230	3300046517	Bacteria	2545
285	Ga0495652_0036988	3300046529	Bacteria	4239
286	Ga0495652_0121562	3300046529	Bacteria	2081
287	Ga0495665_0001729	3300046531	Bacteria	11727
288	Ga0495640_0070397	3300046533	Bacteria	2350
289	Ga0495640_0084861	3300046533	Bacteria	2099
290	Ga0495640_0152960	3300046533	Bacteria	1481
291	Ga0495586_0051824	3300046535	Bacteria	2221
292	Ga0495587_0050954	3300046536	Bacteria	2449
293	Ga0495645_0000051	3300046543	Bacteria	87212
294	Ga0495645_0079688	3300046543	Bacteria	2352
295	Ga0495645_0102329	3300046543	Bacteria	2036
296	Ga0495667_0016004	3300046559	Bacteria	5068
297	Ga0495667_0130913	3300046559	Bacteria	1618
298	Ga0495634_0008255	3300046642	Bacteria	7766
299	Ga0495634_0078735	3300046642	Bacteria	2159
300	Ga0495635_0011346	3300046663	Bacteria	6250
301	Ga0495657_0000013	3300046675	Bacteria	195590
302	Ga0495657_0003884	3300046675	Bacteria	12036
303	Ga0495623_0023337	3300046679	Bacteria	3993
304	Ga0495658_0003331	3300046683	Bacteria	7972
305	Ga0495613_0005324	3300046689	Bacteria	9668
306	Ga0495613_0042977	3300046689	Bacteria	3343
307	Ga0495624_0117833	3300046690	Bacteria	1631
308	Ga0495670_0041778	3300046691	Bacteria	2288
309	Ga0495600_0001759	3300046809	Bacteria	12113
310	Ga0495581_0009467	3300047315	Bacteria	5637
311	Ga0495604_0000824	3300047317	Bacteria	25900
312	Ga0495674_0124325	3300047319	Bacteria	2178
313	Ga0495674_0130271	3300047319	Bacteria	2119
314	Ga0495676_0010496	3300047321	Bacteria	8398
315	Ga0495683_0001669	3300047323	Bacteria	14143
316	Ga0495684_0006217	3300047471	Bacteria	9286
317	Ga0495684_0069147	3300047471	Bacteria	2685
318	Ga0495602_0000497	3300048088	Bacteria	36490
319	Ga0495602_0043100	3300048088	Bacteria	4106
320	Ga0496100_0010180	3300048903	Bacteria	5318
321	Ga0496100_0029866	3300048903	Bacteria	3376
322	Ga0496100_0085268	3300048903	Bacteria	2143
323	Ga0496101_0022760	3300048904	Bacteria	4318
324	Ga0496101_0032431	3300048904	Bacteria	3677
325	Ga0496101_0179858	3300048904	Bacteria	1628
326	Ga0496102_0000002	3300048905	Bacteria	814588
327	Ga0496102_0011579	3300048905	Bacteria	7609
328	Ga0496102_0024164	3300048905	Bacteria	5402
329	Ga0496103_0000017	3300048906	Bacteria	244768
330	Ga0496103_0046533	3300048906	Bacteria	2679
331	Ga0496104_0000129	3300048907	Bacteria	69982
332	Ga0496104_0076803	3300048907	Bacteria	3181
333	Ga0496104_0288643	3300048907	Bacteria	1553
334	Ga0496105_0000846	3300048908	Bacteria	20846
335	Ga0496105_0012203	3300048908	Bacteria	6802
336	Ga0496105_0147405	3300048908	Bacteria	1935
337	Ga0496106_0004621	3300048909	Bacteria	10212
338	Ga0496106_0164730	3300048909	Bacteria	1754
339	Ga0496106_0173196	3300048909	Bacteria	1711
340	Ga0496107_0063667	3300048910	Bacteria	2673
341	Ga0496108_0008252	3300048911	Bacteria	8450
342	Ga0496109_0020731	3300048912	Bacteria	5805
343	Ga0496109_0023811	3300048912	Bacteria	5435
344	Ga0496109_0049209	3300048912	Bacteria	3836
345	Ga0496109_0064555	3300048912	Bacteria	3350
346	Ga0496109_0162734	3300048912	Bacteria	2091
347	Ga0496110_0003221	3300048913	Bacteria	12435
348	Ga0496110_0004469	3300048913	Bacteria	10841
349	Ga0496110_0027041	3300048913	Bacteria	4915
350	Ga0496110_0035690	3300048913	Bacteria	4315
351	Ga0496110_0155409	3300048913	Bacteria	2072
352	Ga0496110_0217993	3300048913	Bacteria	1735
353	Ga0496112_0003240	3300048915	Bacteria	13411
354	Ga0496113_0094443	3300048916	Bacteria	2310
355	Ga0496114_0011170	3300048917	Bacteria	7170
356	Ga0496114_0065404	3300048917	Bacteria	3047
357	Ga0496114_0089505	3300048917	Bacteria	2612
358	Ga0496115_0000075	3300048918	Bacteria	90155
359	Ga0496115_0000121	3300048918	Bacteria	71105
360	Ga0496115_0022542	3300048918	Bacteria	4880
361	Ga0496115_0025379	3300048918	Bacteria	4613
362	Ga0496115_0054627	3300048918	Bacteria	3207
363	Ga0496115_0172679	3300048918	Bacteria	1787
364	Ga0496121_0057097	3300048924	Bacteria	3237
365	Ga0501031_0066093	3300049568	Bacteria	2356
366	Ga0501034_0168275	3300049571	Bacteria	2160
367	Ga0501036_0158872	3300049572	Bacteria	1906
368	Ga0501038_0121738	3300049574	Bacteria	2151
369	Ga0501039_0008934	3300049575	Bacteria	7635
370	Ga0501039_0031961	3300049575	Bacteria	4058
371	Ga0501039_0091576	3300049575	Bacteria	2370
372	Ga0501040_0004863	3300049576	Bacteria	8698
373	Ga0501041_0029589	3300049577	Bacteria	3304
374	Ga0501041_0052475	3300049577	Bacteria	2486
375	Ga0501042_0020617	3300049578	Bacteria	4589
376	Ga0501042_0080860	3300049578	Bacteria	2328
377	Ga0501048_0042454	3300049582	Bacteria	3256
378	Ga0501048_0056224	3300049582	Bacteria	2792
379	Ga0501048_0089861	3300049582	Bacteria	2167
380	Ga0501068_0040733	3300049584	Bacteria	2790
381	Ga0501071_0036339	3300049587	Bacteria	3513
382	Ga0501071_0041530	3300049587	Bacteria	3294
383	Ga0501072_0035077	3300049588	Bacteria	3932
384	Ga0501072_0061451	3300049588	Bacteria	2963
385	Ga0501072_0071929	3300049588	Bacteria	2733
386	Ga0501072_0072427	3300049588	Bacteria	2723
387	Ga0501073_0203999	3300049589	Bacteria	1367
388	Ga0501074_0061398	3300049590	Bacteria	2708
389	Ga0501075_0012398	3300049591	Bacteria	6059
390	Ga0501075_0012727	3300049591	Bacteria	5987
391	Ga0501075_0061336	3300049591	Bacteria	2834
392	Ga0501075_0076746	3300049591	Bacteria	2528
393	Ga0501076_0009268	3300049592	Bacteria	7263
394	Ga0501076_0010603	3300049592	Bacteria	6843
395	Ga0501076_0054499	3300049592	Bacteria	3169
396	Ga0501079_0034231	3300049741	Bacteria	3909
397	Ga0501079_0045025	3300049741	Bacteria	3405
398	Ga0501080_0390237	3300049742	Bacteria	1253
399	Ga0501081_0037729	3300049743	Bacteria	3298
400	Ga0501081_0115466	3300049743	Bacteria	1908
401	Ga0501081_0237163	3300049743	Bacteria	1329
402	Ga0501083_0165044	3300049744	Bacteria	1448
403	Ga0501035_0093949	3300049822	Bacteria	2638
404	Ga0501044_0192424	3300049823	Bacteria	2002
405	Ga0501045_0023504	3300049824	Bacteria	4420
406	Ga0501045_0048324	3300049824	Bacteria	3102
407	Ga0501045_0082152	3300049824	Bacteria	2376
408	Ga0501045_0095285	3300049824	Bacteria	2202
409	Ga0501045_0109516	3300049824	Bacteria	2047
410	Ga0501045_0140019	3300049824	Bacteria	1799
411	nmdc:mga03683_85228_c1	3300050489	Bacteria	1370
412	nmdc:mga03n38_1833_c1	3300050490	Bacteria	6330
413	nmdc:mga03n38_20877_c1	3300050490	Bacteria	2627
414	nmdc:mga00v17_23284_c1	3300050491	Bacteria	3582
415	nmdc:mga0yw44_11056_c1	3300050492	Bacteria	4639
416	nmdc:mga0yw44_112257_c1	3300050492	Bacteria	1748
417	nmdc:mga0yw44_80328_c1	3300050492	Bacteria	2042
418	nmdc:mga0k408_63204_c1	3300050493	Bacteria	2153
419	nmdc:mga06z11_107427_c1	3300050494	Bacteria	1540
420	nmdc:mga05p37_17547_c1	3300050507	Bacteria	8641
421	nmdc:mga05p37_314192_c1	3300050507	Bacteria	1856
422	nmdc:mga06r32_26452_c1	3300050510	Bacteria	5410
423	nmdc:mga08y16_221135_c1	3300050511	Bacteria	1960
424	nmdc:mga08y16_22986_c1	3300050511	Bacteria	6582
425	nmdc:mga08y16_32338_c1	3300050511	Bacteria	5501
426	nmdc:mga0n895_12586_c1	3300050512	Bacteria	7594
427	nmdc:mga0n895_140917_c1	3300050512	Bacteria	2439
428	nmdc:mga0rr50_2158_c2	3300050513	Bacteria	8922
429	nmdc:mga0rr50_32514_c1	3300050513	Bacteria	3718
430	Ga0495601_0012329	3300053077	Bacteria	5127
431	Ga0495601_0037930	3300053077	Bacteria	3012
432	Ga0495601_0043172	3300053077	Bacteria	2832
433	Ga0495601_0054959	3300053077	Bacteria	2520
434	Ga0495601_0057388	3300053077	Bacteria	2466
435	Ga0495612_0000136	3300053078	Bacteria	31282
436	Ga0495619_0135864	3300053085	Bacteria	1691
437	Ga0500645_014762	3300053730	Bacteria	2485
438	Ga0501084_0002029	3300054114	Bacteria	16166
439	Ga0501084_0139872	3300054114	Bacteria	2038
440	Ga0501084_0176950	3300054114	Bacteria	1801
441	Ga0501082_0005768	3300060353	Bacteria	10745
442	Ga0501082_0089404	3300060353	Bacteria	2659
443	Ga0466962_0080097	3300061719	Bacteria	1561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049572	Ga0501036_0158872	Ga0501036_0158872_831_1829	291
2	3300049743	Ga0501081_0115466	Ga0501081_0115466_854_1822	308
3	3300046461	Ga0495641_0034325	Ga0495641_0034325_1195_2292	334
4	3300005468	Ga0070707_100278425	Ga0070707_1002784251	336
5	3300037853	Ga0436364_0860606	Ga0436364_0860606_1769_2887	337
6	3300005436	Ga0070713_100100264	Ga0070713_1001002642	339
7	3300039437	Ga0436365_1799679	Ga0436365_1799679_5133_6251	339
8	3300025944	Ga0207661_10461902	Ga0207661_104619021	340
9	3300054114	Ga0501084_0176950	Ga0501084_0176950_193_1329	340
10	3300005445	Ga0070708_100028098	Ga0070708_1000280981	341
11	3300009094	Ga0111539_10014275	Ga0111539_100142756	343
12	3300009094	Ga0111539_10190356	Ga0111539_101903562	343
13	3300009147	Ga0114129_10210949	Ga0114129_102109492	343
14	3300009147	Ga0114129_10258680	Ga0114129_102586802	343
15	3300021384	Ga0213876_10018870	Ga0213876_100188702	343
16	3300050507	nmdc:mga05p37_17547_c1	nmdc:mga05p37_17547_c1_1320_2393	343
17	3300050510	nmdc:mga06r32_26452_c1	nmdc:mga06r32_26452_c1_3701_4774	343
18	3300050511	nmdc:mga08y16_32338_c1	nmdc:mga08y16_32338_c1_914_1987	343
19	3300054114	Ga0501084_0139872	Ga0501084_0139872_17_1093	344
20	3300026075	Ga0207708_10183620	Ga0207708_101836202	345
21	3300037312	Ga0395899_0003455	Ga0395899_0003455_1242_2306	347
22	3300037418	Ga0395900_0097494	Ga0395900_0097494_675_1739	347
23	3300037466	Ga0395898_0033228	Ga0395898_0033228_2280_3344	347
24	3300037471	Ga0395905_0005339	Ga0395905_0005339_387_1451	347
25	3300035692	Ga0373935_0226487	Ga0373935_0226487_97_1239	349
26	3300046476	Ga0495662_0130496	Ga0495662_0130496_47_1189	349
27	3300046477	Ga0495664_0009688	Ga0495664_0009688_638_1780	349
28	3300046690	Ga0495624_0117833	Ga0495624_0117833_112_1254	349
29	3300047471	Ga0495684_0069147	Ga0495684_0069147_1317_2459	349
30	3300011119	Ga0105246_10014139	Ga0105246_100141392	351
31	3300049576	Ga0501040_0004863	Ga0501040_0004863_886_1992	351
32	3300049577	Ga0501041_0052475	Ga0501041_0052475_562_1668	351
33	3300049578	Ga0501042_0020617	Ga0501042_0020617_1281_2387	351
34	3300049587	Ga0501071_0036339	Ga0501071_0036339_1337_2443	351
35	3300049588	Ga0501072_0061451	Ga0501072_0061451_948_2054	351
36	3300049591	Ga0501075_0012727	Ga0501075_0012727_4247_5353	351
37	3300049592	Ga0501076_0009268	Ga0501076_0009268_841_1947	351
38	3300049741	Ga0501079_0045025	Ga0501079_0045025_994_2100	351
39	3300049742	Ga0501080_0390237	Ga0501080_0390237_113_1219	351
40	3300049743	Ga0501081_0037729	Ga0501081_0037729_1064_2170	351
41	3300054114	Ga0501084_0002029	Ga0501084_0002029_7427_8533	351
42	3300060353	Ga0501082_0005768	Ga0501082_0005768_3666_4772	351
43	3300005617	Ga0068859_100152558	Ga0068859_1001525582	354
44	3300005843	Ga0068860_100045753	Ga0068860_1000457533	354
45	3300006038	Ga0075365_10038372	Ga0075365_100383723	354
46	3300006048	Ga0075363_100014085	Ga0075363_1000140853	354
47	3300006177	Ga0075362_10012535	Ga0075362_100125352	354
48	3300006931	Ga0097620_100152552	Ga0097620_1001525522	354
49	3300028381	Ga0268264_10017152	Ga0268264_100171523	354
50	3300046459	Ga0495629_0051245	Ga0495629_0051245_913_2010	354
51	3300046533	Ga0495640_0084861	Ga0495640_0084861_268_1365	354
52	3300046642	Ga0495634_0008255	Ga0495634_0008255_3714_4811	354
53	3300046689	Ga0495613_0042977	Ga0495613_0042977_609_1706	354
54	3300048908	Ga0496105_0147405	Ga0496105_0147405_749_1855	354
55	3300048917	Ga0496114_0089505	Ga0496114_0089505_320_1426	354
56	3300049575	Ga0501039_0031961	Ga0501039_0031961_1744_2856	354
57	3300049582	Ga0501048_0056224	Ga0501048_0056224_569_1681	354
58	3300049584	Ga0501068_0040733	Ga0501068_0040733_1653_2765	354
59	3300049588	Ga0501072_0072427	Ga0501072_0072427_1023_2135	354
60	3300049591	Ga0501075_0012398	Ga0501075_0012398_86_1198	354
61	3300049592	Ga0501076_0010603	Ga0501076_0010603_4546_5658	354
62	3300049741	Ga0501079_0034231	Ga0501079_0034231_2552_3664	354
63	3300049824	Ga0501045_0048324	Ga0501045_0048324_1425_2531	354
64	3300049824	Ga0501045_0109516	Ga0501045_0109516_421_1533	354
65	3300049824	Ga0501045_0140019	Ga0501045_0140019_450_1556	354
66	3300050489	nmdc:mga03683_85228_c1	nmdc:mga03683_85228_c1_95_1201	354
67	3300050490	nmdc:mga03n38_1833_c1	nmdc:mga03n38_1833_c1_1210_2316	354
68	3300050490	nmdc:mga03n38_20877_c1	nmdc:mga03n38_20877_c1_389_1495	354
69	3300050491	nmdc:mga00v17_23284_c1	nmdc:mga00v17_23284_c1_452_1558	354
70	3300050492	nmdc:mga0yw44_11056_c1	nmdc:mga0yw44_11056_c1_2864_3970	354
71	3300050492	nmdc:mga0yw44_112257_c1	nmdc:mga0yw44_112257_c1_462_1568	354
72	3300050492	nmdc:mga0yw44_80328_c1	nmdc:mga0yw44_80328_c1_870_1976	354
73	3300060353	Ga0501082_0089404	Ga0501082_0089404_985_2097	354
74	3300005459	Ga0068867_100004348	Ga0068867_1000043483	355
75	3300005467	Ga0070706_100025688	Ga0070706_1000256884	355
76	3300005844	Ga0068862_100108641	Ga0068862_1001086412	355
77	3300009098	Ga0105245_10213475	Ga0105245_102134752	355
78	3300009148	Ga0105243_10032229	Ga0105243_100322294	355
79	3300009176	Ga0105242_10012941	Ga0105242_100129415	355
80	3300013297	Ga0157378_10010775	Ga0157378_100107755	355
81	3300014968	Ga0157379_10108836	Ga0157379_101088363	355
82	3300025910	Ga0207684_10033625	Ga0207684_100336253	355
83	3300025933	Ga0207706_10096762	Ga0207706_100967623	355
84	3300025937	Ga0207669_10009666	Ga0207669_100096663	355
85	3300025940	Ga0207691_10052739	Ga0207691_100527393	355
86	3300025949	Ga0207667_10117559	Ga0207667_101175592	355
87	3300026089	Ga0207648_10010142	Ga0207648_100101427	355
88	3300026118	Ga0207675_100314084	Ga0207675_1003140842	355
89	3300036712	Ga0316584_0027794	Ga0316584_0027794_2620_3744	355
90	3300041491	Ga0451833_0911976	Ga0451833_0911976_51_1175	355
91	3300042876	Ga0451577_0003411	Ga0451577_0003411_13814_14935	355
92	3300044712	Ga0453684_0021860	Ga0453684_0021860_2789_3910	355
93	3300046516	Ga0495628_0182826	Ga0495628_0182826_366_1508	355
94	3300046529	Ga0495652_0121562	Ga0495652_0121562_735_1877	355
95	3300046679	Ga0495623_0023337	Ga0495623_0023337_149_1291	355
96	3300046691	Ga0495670_0041778	Ga0495670_0041778_692_1807	355
97	3300048088	Ga0495602_0043100	Ga0495602_0043100_2489_3631	355
98	3300048903	Ga0496100_0010180	Ga0496100_0010180_571_1683	355
99	3300048904	Ga0496101_0022760	Ga0496101_0022760_2321_3433	355
100	3300048905	Ga0496102_0024164	Ga0496102_0024164_1465_2577	355
101	3300048913	Ga0496110_0004469	Ga0496110_0004469_6102_7214	355
102	3300048913	Ga0496110_0217993	Ga0496110_0217993_458_1567	355
103	3300048917	Ga0496114_0011170	Ga0496114_0011170_3482_4594	355
104	3300005548	Ga0070665_100303679	Ga0070665_1003036792	356
105	3300009093	Ga0105240_10116988	Ga0105240_101169883	356
106	3300009551	Ga0105238_10007559	Ga0105238_100075592	356
107	3300010375	Ga0105239_10116674	Ga0105239_101166743	356
108	3300025933	Ga0207706_10032594	Ga0207706_100325944	356
109	3300026121	Ga0207683_10151678	Ga0207683_101516782	356
110	3300028379	Ga0268266_10248947	Ga0268266_102489471	356
111	3300028380	Ga0268265_10049869	Ga0268265_100498692	356
112	3300031852	Ga0307410_10105796	Ga0307410_101057962	356
113	3300031903	Ga0307407_10007826	Ga0307407_100078264	356
114	3300031995	Ga0307409_100007360	Ga0307409_1000073603	356
115	3300032002	Ga0307416_100040230	Ga0307416_1000402302	356
116	3300032004	Ga0307414_10274618	Ga0307414_102746181	356
117	3300032005	Ga0307411_10030099	Ga0307411_100300992	356
118	3300035398	Ga0316574_0047369	Ga0316574_0047369_403_1536	356
119	3300048904	Ga0496101_0032431	Ga0496101_0032431_819_1922	356
120	3300048905	Ga0496102_0011579	Ga0496102_0011579_4107_5210	356
121	3300048908	Ga0496105_0012203	Ga0496105_0012203_4471_5574	356
122	3300048909	Ga0496106_0004621	Ga0496106_0004621_6756_7859	356
123	3300048911	Ga0496108_0008252	Ga0496108_0008252_6846_7949	356
124	3300048912	Ga0496109_0049209	Ga0496109_0049209_563_1666	356
125	3300048913	Ga0496110_0003221	Ga0496110_0003221_574_1677	356
126	3300048915	Ga0496112_0003240	Ga0496112_0003240_9955_11058	356
127	3300048916	Ga0496113_0094443	Ga0496113_0094443_580_1683	356
128	3300048918	Ga0496115_0022542	Ga0496115_0022542_2735_3838	356
129	3300046533	Ga0495640_0070397	Ga0495640_0070397_1073_2215	357
130	3300046543	Ga0495645_0079688	Ga0495645_0079688_114_1286	357
131	3300006844	Ga0075428_100061880	Ga0075428_1000618804	358
132	3300006844	Ga0075428_100264462	Ga0075428_1002644622	358
133	3300006844	Ga0075428_100281030	Ga0075428_1002810302	358
134	3300006846	Ga0075430_100297706	Ga0075430_1002977062	358
135	3300006880	Ga0075429_100192739	Ga0075429_1001927392	358
136	3300009176	Ga0105242_10196349	Ga0105242_101963492	358
137	3300027907	Ga0207428_10153588	Ga0207428_101535881	358
138	3300037853	Ga0436364_1447776	Ga0436364_1447776_934_2085	358
139	3300044694	Ga0466963_0063532	Ga0466963_0063532_819_1946	358
140	3300045976	Ga0466967_0050611	Ga0466967_0050611_194_1321	358
141	3300045976	Ga0466967_0298644	Ga0466967_0298644_106_1224	358
142	3300048924	Ga0496121_0057097	Ga0496121_0057097_652_1794	358
143	3300049591	Ga0501075_0061336	Ga0501075_0061336_910_2121	358
144	3300050511	nmdc:mga08y16_221135_c1	nmdc:mga08y16_221135_c1_297_1430	358
145	3300005441	Ga0070700_100042152	Ga0070700_1000421523	359
146	3300005937	Ga0081455_10050743	Ga0081455_100507433	359
147	3300009094	Ga0111539_10022251	Ga0111539_100222512	359
148	3300014968	Ga0157379_10058861	Ga0157379_100588613	359
149	3300026067	Ga0207678_10140545	Ga0207678_101405452	359
150	3300027907	Ga0207428_10018799	Ga0207428_100187996	359
151	3300037068	Ga0373925_0055534	Ga0373925_0055534_103_1245	359
152	3300046514	Ga0495618_0000478	Ga0495618_0000478_14323_15528	359
153	3300050511	nmdc:mga08y16_22986_c1	nmdc:mga08y16_22986_c1_5372_6505	359
154	3300005981	Ga0081538_10001885	Ga0081538_1000188514	360
155	3300045836	Ga0466958_0066151	Ga0466958_0066151_413_1543	360
156	3300049575	Ga0501039_0091576	Ga0501039_0091576_698_1915	360
157	3300049588	Ga0501072_0035077	Ga0501072_0035077_2112_3329	360
158	3300049824	Ga0501045_0095285	Ga0501045_0095285_954_2171	360
159	3300021388	Ga0213875_10000095	Ga0213875_1000009539	361
160	3300035116	Ga0373945_0005296	Ga0373945_0005296_663_1805	361
161	3300035171	Ga0373946_0018889	Ga0373946_0018889_1072_2214	361
162	3300035725	Ga0373947_0003704	Ga0373947_0003704_4646_5788	361
163	3300037068	Ga0373925_0003118	Ga0373925_0003118_7953_9095	361
164	3300044694	Ga0466963_0149998	Ga0466963_0149998_472_1599	361
165	3300046455	Ga0495603_0033723	Ga0495603_0033723_1239_2381	361
166	3300046461	Ga0495641_0003915	Ga0495641_0003915_4969_6111	361
167	3300046462	Ga0495651_0067994	Ga0495651_0067994_49_1191	361
168	3300046463	Ga0495653_0007703	Ga0495653_0007703_7102_8244	361
169	3300046472	Ga0495580_0011252	Ga0495580_0011252_2498_3640	361
170	3300046473	Ga0495582_0003433	Ga0495582_0003433_3495_4637	361
171	3300046475	Ga0495639_0000900	Ga0495639_0000900_2806_3948	361
172	3300046476	Ga0495662_0004791	Ga0495662_0004791_3556_4698	361
173	3300046514	Ga0495618_0002981	Ga0495618_0002981_3688_4830	361
174	3300046517	Ga0495630_0041078	Ga0495630_0041078_793_1935	361
175	3300046531	Ga0495665_0001729	Ga0495665_0001729_4380_5522	361
176	3300046533	Ga0495640_0152960	Ga0495640_0152960_101_1243	361
177	3300046535	Ga0495586_0051824	Ga0495586_0051824_891_2033	361
178	3300046559	Ga0495667_0016004	Ga0495667_0016004_71_1213	361
179	3300046663	Ga0495635_0011346	Ga0495635_0011346_569_1711	361
180	3300046675	Ga0495657_0003884	Ga0495657_0003884_5968_7110	361
181	3300046683	Ga0495658_0003331	Ga0495658_0003331_3567_4709	361
182	3300046689	Ga0495613_0005324	Ga0495613_0005324_5208_6350	361
183	3300046809	Ga0495600_0001759	Ga0495600_0001759_5073_6215	361
184	3300047315	Ga0495581_0009467	Ga0495581_0009467_821_1963	361
185	3300047319	Ga0495674_0130271	Ga0495674_0130271_793_1935	361
186	3300047321	Ga0495676_0010496	Ga0495676_0010496_5778_6920	361
187	3300049574	Ga0501038_0121738	Ga0501038_0121738_554_1681	361
188	3300049578	Ga0501042_0080860	Ga0501042_0080860_462_1589	361
189	3300049582	Ga0501048_0089861	Ga0501048_0089861_943_2070	361
190	3300049589	Ga0501073_0203999	Ga0501073_0203999_227_1354	361
191	3300049743	Ga0501081_0237163	Ga0501081_0237163_148_1275	361
192	3300049744	Ga0501083_0165044	Ga0501083_0165044_43_1170	361
193	3300049824	Ga0501045_0023504	Ga0501045_0023504_2504_3688	361
194	3300053085	Ga0495619_0135864	Ga0495619_0135864_229_1371	361
195	3300005330	Ga0070690_100121147	Ga0070690_1001211472	362
196	3300005337	Ga0070682_100138541	Ga0070682_1001385412	362
197	3300005438	Ga0070701_10013623	Ga0070701_100136232	362
198	3300005616	Ga0068852_100073599	Ga0068852_1000735992	362
199	3300005618	Ga0068864_100038213	Ga0068864_1000382134	362
200	3300009148	Ga0105243_10165213	Ga0105243_101652132	362
201	3300025933	Ga0207706_10063363	Ga0207706_100633633	362
202	3300026023	Ga0207677_10031855	Ga0207677_100318552	362
203	3300045976	Ga0466967_0002553	Ga0466967_0002553_4430_5560	362
204	3300045976	Ga0466967_0197807	Ga0466967_0197807_59_1192	362
205	3300048907	Ga0496104_0076803	Ga0496104_0076803_1523_2659	362
206	3300048909	Ga0496106_0164730	Ga0496106_0164730_84_1220	362
207	3300048912	Ga0496109_0064555	Ga0496109_0064555_392_1528	362
208	3300048918	Ga0496115_0172679	Ga0496115_0172679_562_1698	362
209	3300049568	Ga0501031_0066093	Ga0501031_0066093_505_1632	362
210	3300049575	Ga0501039_0008934	Ga0501039_0008934_5963_7090	362
211	3300049577	Ga0501041_0029589	Ga0501041_0029589_922_2049	362
212	3300049582	Ga0501048_0042454	Ga0501048_0042454_1948_3075	362
213	3300049587	Ga0501071_0041530	Ga0501071_0041530_2061_3188	362
214	3300049588	Ga0501072_0071929	Ga0501072_0071929_104_1231	362
215	3300049590	Ga0501074_0061398	Ga0501074_0061398_1223_2350	362
216	3300049591	Ga0501075_0076746	Ga0501075_0076746_1280_2407	362
217	3300049592	Ga0501076_0054499	Ga0501076_0054499_830_1957	362
218	3300049822	Ga0501035_0093949	Ga0501035_0093949_1434_2561	362
219	3300049824	Ga0501045_0082152	Ga0501045_0082152_727_1854	362
220	3300050512	nmdc:mga0n895_140917_c1	nmdc:mga0n895_140917_c1_803_1939	362
221	3300025908	Ga0207643_10056113	Ga0207643_100561132	363
222	3300025927	Ga0207687_10178228	Ga0207687_101782282	363
223	3300025945	Ga0207679_10010216	Ga0207679_100102165	363
224	3300026142	Ga0207698_10080871	Ga0207698_100808712	363
225	3300046543	Ga0495645_0102329	Ga0495645_0102329_862_2004	363
226	3300061719	Ga0466962_0080097	Ga0466962_0080097_407_1540	363
227	3300005355	Ga0070671_100065963	Ga0070671_1000659632	364
228	3300044694	Ga0466963_0013726	Ga0466963_0013726_2689_3819	365
229	3300045976	Ga0466967_0050299	Ga0466967_0050299_572_1702	365
230	3300050512	nmdc:mga0n895_12586_c1	nmdc:mga0n895_12586_c1_5810_6943	366
231	3300050513	nmdc:mga0rr50_2158_c2	nmdc:mga0rr50_2158_c2_4479_5612	366
232	3300053077	Ga0495601_0043172	Ga0495601_0043172_262_1599	367
233	3300046477	Ga0495664_0000007	Ga0495664_0000007_335276_336478	368
234	3300005337	Ga0070682_100034749	Ga0070682_1000347493	369
235	3300005338	Ga0068868_100059389	Ga0068868_1000593892	369
236	3300005339	Ga0070660_100017478	Ga0070660_1000174782	369
237	3300005341	Ga0070691_10031886	Ga0070691_100318862	369
238	3300005366	Ga0070659_100096357	Ga0070659_1000963572	369
239	3300005439	Ga0070711_100036669	Ga0070711_1000366692	369
240	3300005530	Ga0070679_100126052	Ga0070679_1001260522	369
241	3300005535	Ga0070684_100206737	Ga0070684_1002067372	369
242	3300005547	Ga0070693_100029205	Ga0070693_1000292053	369
243	3300005548	Ga0070665_100168258	Ga0070665_1001682582	369
244	3300005563	Ga0068855_100023771	Ga0068855_1000237715	369
245	3300005564	Ga0070664_100300698	Ga0070664_1003006982	369
246	3300005614	Ga0068856_100008405	Ga0068856_1000084058	369
247	3300005615	Ga0070702_100010664	Ga0070702_1000106644	369
248	3300005842	Ga0068858_100089750	Ga0068858_1000897502	369
249	3300005843	Ga0068860_100290798	Ga0068860_1002907982	369
250	3300005985	Ga0081539_10003296	Ga0081539_1000329611	369
251	3300006028	Ga0070717_10006562	Ga0070717_100065628	369
252	3300006871	Ga0075434_100005221	Ga0075434_1000052212	369
253	3300007076	Ga0075435_100006532	Ga0075435_1000065323	369
254	3300009098	Ga0105245_10007321	Ga0105245_1000732110	369
255	3300009174	Ga0105241_10195841	Ga0105241_101958412	369
256	3300009545	Ga0105237_10283697	Ga0105237_102836972	369
257	3300009553	Ga0105249_10177748	Ga0105249_101777482	369
258	3300011119	Ga0105246_10007821	Ga0105246_100078213	369
259	3300014325	Ga0163163_10071286	Ga0163163_100712863	369
260	3300025901	Ga0207688_10001500	Ga0207688_100015002	369
261	3300025911	Ga0207654_10029555	Ga0207654_100295552	369
262	3300025914	Ga0207671_10079762	Ga0207671_100797622	369
263	3300025916	Ga0207663_10004594	Ga0207663_100045945	369
264	3300025919	Ga0207657_10009046	Ga0207657_100090466	369
265	3300025921	Ga0207652_10171963	Ga0207652_101719632	369
266	3300025924	Ga0207694_10006344	Ga0207694_1000634410	369
267	3300025925	Ga0207650_10074069	Ga0207650_100740693	369
268	3300025927	Ga0207687_10002296	Ga0207687_100022967	369
269	3300025928	Ga0207700_10071572	Ga0207700_100715722	369
270	3300025929	Ga0207664_10059599	Ga0207664_100595992	369
271	3300025932	Ga0207690_10028886	Ga0207690_100288863	369
272	3300025938	Ga0207704_10165629	Ga0207704_101656292	369
273	3300025939	Ga0207665_10014888	Ga0207665_100148886	369
274	3300025942	Ga0207689_10011563	Ga0207689_100115635	369
275	3300025945	Ga0207679_10206201	Ga0207679_102062012	369
276	3300025949	Ga0207667_10056773	Ga0207667_100567732	369
277	3300025960	Ga0207651_10074729	Ga0207651_100747293	369
278	3300026035	Ga0207703_10077757	Ga0207703_100777572	369
279	3300026078	Ga0207702_10147129	Ga0207702_101471292	369
280	3300026121	Ga0207683_10037400	Ga0207683_100374003	369
281	3300028379	Ga0268266_10278741	Ga0268266_102787412	369
282	3300028381	Ga0268264_10073902	Ga0268264_100739023	369
283	3300035691	Ga0373931_0081100	Ga0373931_0081100_331_1482	369
284	3300046642	Ga0495634_0078735	Ga0495634_0078735_964_2106	369
285	3300048903	Ga0496100_0085268	Ga0496100_0085268_576_1718	369
286	3300048904	Ga0496101_0179858	Ga0496101_0179858_376_1518	369
287	3300048906	Ga0496103_0046533	Ga0496103_0046533_1422_2564	369
288	3300048907	Ga0496104_0288643	Ga0496104_0288643_101_1243	369
289	3300048909	Ga0496106_0173196	Ga0496106_0173196_86_1228	369
290	3300048912	Ga0496109_0023811	Ga0496109_0023811_3716_4858	369
291	3300048917	Ga0496114_0065404	Ga0496114_0065404_1254_2390	369
292	3300048918	Ga0496115_0025379	Ga0496115_0025379_143_1285	369
293	3300048918	Ga0496115_0054627	Ga0496115_0054627_1061_2197	369
294	3300005435	Ga0070714_100000695	Ga0070714_10000069516	370
295	3300006028	Ga0070717_10038922	Ga0070717_100389222	370
296	3300047319	Ga0495674_0124325	Ga0495674_0124325_384_1523	370
297	3300053077	Ga0495601_0054959	Ga0495601_0054959_572_1711	370
298	3300009551	Ga0105238_10048591	Ga0105238_100485915	371
299	3300009553	Ga0105249_10157912	Ga0105249_101579122	371
300	3300038735	Ga0400485_08530	Ga0400485_08530_3340_4509	372
301	iso_pu_bacteria	2547132424	2548696739	372
302	iso_pu_bacteria	2857609550	2857609953	372
303	iso_pu_bacteria	2919713450	2919717649	372
304	iso_pu_bacteria	2928142448	2928144570	372
305	iso_pu_bacteria	2964375228	2964376352	372
306	iso_pu_bacteria	3001119090	3001121609	372
307	3300005445	Ga0070708_100002425	Ga0070708_1000024253	373
308	3300048912	Ga0496109_0020731	Ga0496109_0020731_4589_5755	373
309	iso_pu_bacteria	2551306166	2552108852	373
310	iso_pu_bacteria	2687453257	2688069552	373
311	iso_pu_bacteria	2852673933	2852676915	373
312	iso_pu_bacteria	2889415604	2889418157	373
313	iso_pu_bacteria	2920107658	2920114449	373
314	iso_pu_bacteria	2928510474	2928514886	373
315	iso_pu_bacteria	2939593269	2939596052	373
316	3300005335	Ga0070666_10033650	Ga0070666_100336503	374
317	3300005344	Ga0070661_100033691	Ga0070661_1000336914	374
318	3300005355	Ga0070671_100189300	Ga0070671_1001893002	374
319	3300005435	Ga0070714_100039124	Ga0070714_1000391243	374
320	3300005457	Ga0070662_100135819	Ga0070662_1001358192	374
321	3300005548	Ga0070665_100000632	Ga0070665_10000063214	374
322	3300005578	Ga0068854_100180966	Ga0068854_1001809661	374
323	3300005614	Ga0068856_100408782	Ga0068856_1004087822	374
324	3300005834	Ga0068851_10002120	Ga0068851_100021209	374
325	3300005842	Ga0068858_100000497	Ga0068858_10000049732	374
326	3300005981	Ga0081538_10000514	Ga0081538_1000051433	374
327	3300005981	Ga0081538_10004433	Ga0081538_100044338	374
328	3300005981	Ga0081538_10044170	Ga0081538_100441702	374
329	3300005983	Ga0081540_1000306	Ga0081540_100030647	374
330	3300006028	Ga0070717_10083087	Ga0070717_100830872	374
331	3300006178	Ga0075367_10041164	Ga0075367_100411643	374
332	3300009093	Ga0105240_10000239	Ga0105240_1000023953	374
333	3300009093	Ga0105240_10021155	Ga0105240_100211553	374
334	3300009098	Ga0105245_10268807	Ga0105245_102688072	374
335	3300009147	Ga0114129_10115628	Ga0114129_101156285	374
336	3300013102	Ga0157371_10025496	Ga0157371_100254965	374
337	3300021388	Ga0213875_10032746	Ga0213875_100327462	374
338	3300025294	Ga0209025_1016219	Ga0209025_10162193	374
339	3300025321	Ga0207656_10042815	Ga0207656_100428152	374
340	3300025903	Ga0207680_10009002	Ga0207680_100090026	374
341	3300025904	Ga0207647_10000326	Ga0207647_1000032614	374
342	3300025913	Ga0207695_10010063	Ga0207695_100100636	374
343	3300025914	Ga0207671_10057459	Ga0207671_100574592	374
344	3300025919	Ga0207657_10208492	Ga0207657_102084921	374
345	3300025924	Ga0207694_10057972	Ga0207694_100579722	374
346	3300025938	Ga0207704_10018009	Ga0207704_100180091	374
347	3300025961	Ga0207712_10000321	Ga0207712_1000032114	374
348	3300025981	Ga0207640_10105391	Ga0207640_101053912	374
349	3300026023	Ga0207677_10046994	Ga0207677_100469944	374
350	3300026035	Ga0207703_10001632	Ga0207703_1000163211	374
351	3300026035	Ga0207703_10200079	Ga0207703_102000792	374
352	3300026041	Ga0207639_10025231	Ga0207639_100252312	374
353	3300026075	Ga0207708_10095670	Ga0207708_100956701	374
354	3300026116	Ga0207674_10300784	Ga0207674_103007842	374
355	3300028379	Ga0268266_10000008	Ga0268266_10000008888	374
356	3300031727	Ga0316576_10028542	Ga0316576_100285423	374
357	3300031995	Ga0307409_100263862	Ga0307409_1002638621	374
358	3300032002	Ga0307416_100318317	Ga0307416_1003183172	374
359	3300037853	Ga0436364_1294613	Ga0436364_1294613_61724_62902	374
360	3300038443	Ga0395901_0356500	Ga0395901_0356500_45_1271	374
361	3300039437	Ga0436365_0405759	Ga0436365_0405759_27_1232	374
362	3300039450	Ga0436363_1335775	Ga0436363_1335775_2253_3425	374
363	3300044694	Ga0466963_0026609	Ga0466963_0026609_2498_3658	374
364	3300044712	Ga0453684_0054884	Ga0453684_0054884_989_2257	374
365	3300044719	Ga0466971_0074809	Ga0466971_0074809_303_1475	374
366	3300045836	Ga0466958_0037916	Ga0466958_0037916_682_1860	374
367	3300046473	Ga0495582_0000011	Ga0495582_0000011_18634_19872	374
368	3300046516	Ga0495628_0001219	Ga0495628_0001219_14030_15232	374
369	3300046529	Ga0495652_0036988	Ga0495652_0036988_1337_2527	374
370	3300046559	Ga0495667_0130913	Ga0495667_0130913_11_1183	374
371	3300047323	Ga0495683_0001669	Ga0495683_0001669_11891_13153	374
372	3300048088	Ga0495602_0000497	Ga0495602_0000497_19398_20600	374
373	3300048907	Ga0496104_0000129	Ga0496104_0000129_26377_27564	374
374	3300048908	Ga0496105_0000846	Ga0496105_0000846_5769_6956	374
375	3300048910	Ga0496107_0063667	Ga0496107_0063667_186_1391	374
376	3300048912	Ga0496109_0162734	Ga0496109_0162734_654_1781	374
377	3300048913	Ga0496110_0035690	Ga0496110_0035690_1636_2808	374
378	3300048913	Ga0496110_0155409	Ga0496110_0155409_601_1737	374
379	3300049823	Ga0501044_0192424	Ga0501044_0192424_67_1287	374
380	3300050493	nmdc:mga0k408_63204_c1	nmdc:mga0k408_63204_c1_431_1624	374
381	3300050494	nmdc:mga06z11_107427_c1	nmdc:mga06z11_107427_c1_257_1450	374
382	3300050507	nmdc:mga05p37_314192_c1	nmdc:mga05p37_314192_c1_643_1806	374
383	3300053077	Ga0495601_0037930	Ga0495601_0037930_438_1628	374
384	3300053077	Ga0495601_0057388	Ga0495601_0057388_900_2087	374
385	3300053730	Ga0500645_014762	Ga0500645_014762_127_1320	374
386	iso_pu_bacteria	8055531788	8055536294	374
387	3300005329	Ga0070683_100014931	Ga0070683_1000149312	375
388	3300005329	Ga0070683_100054804	Ga0070683_1000548043	375
389	3300005329	Ga0070683_100291684	Ga0070683_1002916841	375
390	3300005331	Ga0070670_100007187	Ga0070670_1000071872	375
391	3300005344	Ga0070661_100066043	Ga0070661_1000660432	375
392	3300005437	Ga0070710_10011979	Ga0070710_100119793	375
393	3300005439	Ga0070711_100043189	Ga0070711_1000431893	375
394	3300005445	Ga0070708_100014932	Ga0070708_1000149326	375
395	3300005518	Ga0070699_100089679	Ga0070699_1000896792	375
396	3300005548	Ga0070665_100118331	Ga0070665_1001183313	375
397	3300005614	Ga0068856_100264643	Ga0068856_1002646431	375
398	3300009093	Ga0105240_10021786	Ga0105240_100217864	375
399	3300009545	Ga0105237_10001661	Ga0105237_100016614	375
400	3300020070	Ga0206356_11066038	Ga0206356_110660382	375
401	3300021358	Ga0213873_10001448	Ga0213873_100014484	375
402	3300021441	Ga0213871_10001375	Ga0213871_100013753	375
403	3300025898	Ga0207692_10008211	Ga0207692_100082113	375
404	3300025913	Ga0207695_10070523	Ga0207695_100705233	375
405	3300025914	Ga0207671_10020272	Ga0207671_100202722	375
406	3300025915	Ga0207693_10014455	Ga0207693_100144552	375
407	3300025915	Ga0207693_10061426	Ga0207693_100614263	375
408	3300025916	Ga0207663_10009452	Ga0207663_100094523	375
409	3300025922	Ga0207646_10069779	Ga0207646_100697791	375
410	3300025925	Ga0207650_10009082	Ga0207650_100090822	375
411	3300025944	Ga0207661_10021118	Ga0207661_100211182	375
412	3300025945	Ga0207679_10071163	Ga0207679_100711631	375
413	3300025981	Ga0207640_10287509	Ga0207640_102875091	375
414	3300028556	Ga0265337_1006811	Ga0265337_10068114	375
415	3300028558	Ga0265326_10001791	Ga0265326_100017912	375
416	3300028563	Ga0265319_1000144	Ga0265319_100014417	375
417	3300028577	Ga0265318_10002150	Ga0265318_100021507	375
418	3300028666	Ga0265336_10000002	Ga0265336_10000002419	375
419	3300028800	Ga0265338_10000001	Ga0265338_10000001394	375
420	3300029957	Ga0265324_10003810	Ga0265324_100038103	375
421	3300031247	Ga0265340_10000001	Ga0265340_10000001393	375
422	3300031344	Ga0265316_10044621	Ga0265316_100446213	375
423	3300031712	Ga0265342_10061593	Ga0265342_100615932	375
424	3300031824	Ga0307413_10075276	Ga0307413_100752762	375
425	3300031901	Ga0307406_10241710	Ga0307406_102417102	375
426	3300031911	Ga0307412_10068641	Ga0307412_100686411	375
427	3300032002	Ga0307416_100008401	Ga0307416_1000084013	375
428	3300032005	Ga0307411_10177903	Ga0307411_101779032	375
429	3300032126	Ga0307415_100001872	Ga0307415_1000018724	375
430	3300039438	Ga0436360_0121251	Ga0436360_0121251_1552_2742	375
431	3300039447	Ga0436361_0484246	Ga0436361_0484246_1130_2320	375
432	3300039453	Ga0436362_0320430	Ga0436362_0320430_2634_3824	375
433	3300044694	Ga0466963_0026894	Ga0466963_0026894_428_1555	375
434	3300044706	Ga0466964_0051638	Ga0466964_0051638_463_1590	375
435	3300045976	Ga0466967_0008361	Ga0466967_0008361_1676_2803	375
436	3300045976	Ga0466967_0066789	Ga0466967_0066789_1812_2951	375
437	3300045976	Ga0466967_0294340	Ga0466967_0294340_183_1310	375
438	3300046461	Ga0495641_0074041	Ga0495641_0074041_289_1425	375
439	3300046463	Ga0495653_0000718	Ga0495653_0000718_21613_22854	375
440	3300046463	Ga0495653_0012191	Ga0495653_0012191_2483_3694	375
441	3300046517	Ga0495630_0003283	Ga0495630_0003283_6687_7922	375
442	3300046517	Ga0495630_0075230	Ga0495630_0075230_799_1935	375
443	3300046536	Ga0495587_0050954	Ga0495587_0050954_510_1793	375
444	3300046543	Ga0495645_0000051	Ga0495645_0000051_14696_15928	375
445	3300046675	Ga0495657_0000013	Ga0495657_0000013_86143_87378	375
446	3300047317	Ga0495604_0000824	Ga0495604_0000824_1142_2344	375
447	3300047471	Ga0495684_0006217	Ga0495684_0006217_7932_9143	375
448	3300048903	Ga0496100_0029866	Ga0496100_0029866_1545_2762	375
449	3300048905	Ga0496102_0000002	Ga0496102_0000002_456457_457659	375
450	3300048906	Ga0496103_0000017	Ga0496103_0000017_49674_50876	375
451	3300048913	Ga0496110_0027041	Ga0496110_0027041_1907_3034	375
452	3300048918	Ga0496115_0000075	Ga0496115_0000075_39202_40407	375
453	3300048918	Ga0496115_0000121	Ga0496115_0000121_17789_18994	375
454	3300049571	Ga0501034_0168275	Ga0501034_0168275_909_2099	375
455	3300050513	nmdc:mga0rr50_32514_c1	nmdc:mga0rr50_32514_c1_1622_2791	375
456	3300053077	Ga0495601_0012329	Ga0495601_0012329_2291_3529	375
457	3300053078	Ga0495612_0000136	Ga0495612_0000136_16049_17293	375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00162

PGK

Phosphoglycerate kinase

29

417

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1php-assembly1.cif.gz_A	structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms	0.9663	2	374
3uwd-assembly1.cif.gz_A	crystal structure of phosphoglycerate kinase from bacillus anthracis	0.9597	2	375
6i06-assembly1.cif.gz_A	crystal structure of psychrophilic phosphoglycerate kinase from pseudomonas tacii18	0.9595	1	374
1zmr-assembly1.cif.gz_A	crystal structure of the e. coli phosphoglycerate kinase	0.9589	1	374
1php-assembly1.cif.gz_A	structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms	0.9587	2	374

ID	Description	Score	Start	End	Superfamily
af_P9WID1_191_392_3.40.50.1260	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain	0.9799	170	363	3.40.50.1260
af_A0A1D6FSN1_1_174_3.40.50.1260	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain	0.9705	210	375	3.40.50.1260
af_A0A1D6FSN1_4_156_3.40.50.1260	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain	0.9658	214	357	3.40.50.1260
af_P0A799_178_379_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.9644	172	371	3.30.200.20
af_E9AGU0_88_417_3.40.50.1260	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain	0.9565	70	375	3.40.50.1260

ID	Description	Score	Start	End	GO Terms
AF-A0A1Y2T1S8-F1-model_v4	Phosphoglycerate kinase (EC 2.7.2.3)	0.9965	270	375	GO:0004618 GO:0005524 GO:0005829 GO:0006094 GO:0006096 GO:0043531
AF-A0A7C5D8X0-F1-model_v4	Phosphoglycerate kinase (EC 2.7.2.3)	0.993	1	85	GO:0004618 GO:0005524 GO:0005829 GO:0006094 GO:0006096 GO:0043531
AF-W1XYT3-F1-model_v4	phosphoglycerate kinase (EC 2.7.2.3)	0.9904	277	357	GO:0004618 GO:0005524 GO:0005829 GO:0006094 GO:0006096 GO:0043531
AF-A0A2D5FKL4-F1-model_v4	Phosphoglycerate kinase (EC 2.7.2.3)	0.9891	279	374	GO:0004618 GO:0005524 GO:0005829 GO:0006094 GO:0006096 GO:0043531
AF-A0A4Q2KKC6-F1-model_v4	deleted	0.9889	282	374

Feature Viewer

pLDDT	pTM	Quality
95.11	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448084

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00162

PGK

Phosphoglycerate kinase

29

417

0.93

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map