F447972

General Info

Members Datasets Scaffolds Average Seq Length
457 169 914 109

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101146714|Ga0075434_1011467141
Length 111
Sequence MRVKIRKGDTVEVISGRLEDKGKRGEVINVLLDNRRVVVQGVNIRTKHQKQVQTQAGRNINPGRIQFEGTVDISNVMLVCPKCGTPTRVAVQRDDDGAHRVCKNCQALIDQ

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
108 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
123 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
133 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
134 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
150 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
151 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
152 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
153 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.22
Metatranscriptomes 6.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 99.56
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_101146714 3300006871 Bacteria 790
2 SwRhRL2b_contig_488749 2162886007 Unclassified 2257
3 JGI25406J46586_10024839 3300003203 Unclassified 2339
4 Ga0058860_11506360 3300004801 Bacteria 783
5 Ga0065704_10070890 3300005289 Bacteria 14917
6 Ga0065704_10085506 3300005289 Bacteria 3195
7 Ga0065704_10101765 3300005289 Bacteria 2213
8 Ga0065704_10343018 3300005289 Bacteria 776
9 Ga0065712_10135921 3300005290 Bacteria 1498
10 Ga0065707_10082110 3300005295 Bacteria 21594
11 Ga0065707_10083718 3300005295 Bacteria 8386
12 Ga0065707_10086644 3300005295 Bacteria 5374
13 Ga0065707_10100665 3300005295 Bacteria 2914
14 Ga0065707_10148591 3300005295 Bacteria 1684
15 Ga0065707_10196241 3300005295 Bacteria 1334
16 Ga0065707_10580369 3300005295 Bacteria 702
17 Ga0065707_10881548 3300005295 Bacteria 572
18 Ga0065707_10953472 3300005295 Bacteria 551
19 Ga0070680_100487846 3300005336 Bacteria 1054
20 Ga0070680_101241965 3300005336 Unclassified 645
21 Ga0070689_100095292 3300005340 Bacteria 2351
22 Ga0070689_100250420 3300005340 Unclassified 1461
23 Ga0070689_100416390 3300005340 Bacteria 1138
24 Ga0070691_10685633 3300005341 Bacteria 614
25 Ga0070687_100141685 3300005343 Bacteria 1401
26 Ga0070669_100644441 3300005353 Bacteria 891
27 Ga0070673_100545967 3300005364 Bacteria 1052
28 Ga0070703_10604155 3300005406 Bacteria 506
29 Ga0070701_10611449 3300005438 Bacteria 723
30 Ga0070705_100010583 3300005440 Bacteria 4623
31 Ga0070705_100345809 3300005440 Bacteria 1082
32 Ga0070705_100776394 3300005440 Bacteria 760
33 Ga0070700_100027695 3300005441 Bacteria 3363
34 Ga0070700_100381401 3300005441 Bacteria 1054
35 Ga0070694_100058367 3300005444 Bacteria 2625
36 Ga0070694_100201791 3300005444 Bacteria 1483
37 Ga0070694_100294794 3300005444 Bacteria 1241
38 Ga0070694_100785399 3300005444 Bacteria 780
39 Ga0070663_101881425 3300005455 Bacteria 537
40 Ga0070662_100544545 3300005457 Bacteria 972
41 Ga0068867_101031924 3300005459 Bacteria 747
42 Ga0070706_100141823 3300005467 Bacteria 2243
43 Ga0070706_101132123 3300005467 Bacteria 720
44 Ga0070707_100039091 3300005468 Bacteria 4534
45 Ga0070707_100078348 3300005468 Bacteria 3188
46 Ga0070707_101392941 3300005468 Unclassified 668
47 Ga0070707_101488171 3300005468 Bacteria 644
48 Ga0070707_101560713 3300005468 Unclassified 627
49 Ga0070698_100012571 3300005471 Bacteria 8963
50 Ga0070698_100088545 3300005471 Bacteria 3081
51 Ga0070698_100089307 3300005471 Bacteria 3066
52 Ga0070698_100289111 3300005471 Bacteria 1570
53 Ga0070698_100366208 3300005471 Bacteria 1373
54 Ga0070698_101163829 3300005471 Bacteria 720
55 Ga0070698_101688798 3300005471 Bacteria 586
56 Ga0070699_100002160 3300005518 Bacteria 17784
57 Ga0070699_100044111 3300005518 Bacteria 3860
58 Ga0070699_100100488 3300005518 Bacteria 2535
59 Ga0070699_100672949 3300005518 Bacteria 945
60 Ga0070699_100964467 3300005518 Bacteria 781
61 Ga0070697_100254228 3300005536 Bacteria 1503
62 Ga0070697_100437245 3300005536 Bacteria 1138
63 Ga0070695_100853553 3300005545 Bacteria 733
64 Ga0070695_101188927 3300005545 Bacteria 627
65 Ga0070696_100422933 3300005546 Bacteria 1046
66 Ga0070696_100577088 3300005546 Bacteria 904
67 Ga0070696_100831044 3300005546 Bacteria 762
68 Ga0070693_100554187 3300005547 Bacteria 823
69 Ga0070704_100007865 3300005549 Bacteria 6363
70 Ga0070704_100049841 3300005549 Bacteria 2940
71 Ga0070704_100066792 3300005549 Bacteria 2595
72 Ga0070704_100207958 3300005549 Bacteria 1584
73 Ga0068857_100495954 3300005577 Bacteria 1145
74 Ga0068857_100787089 3300005577 Bacteria 908
75 Ga0068857_100967775 3300005577 Bacteria 818
76 Ga0068854_100627327 3300005578 Bacteria 920
77 Ga0070702_100217707 3300005615 Bacteria 1275
78 Ga0070702_101838223 3300005615 Unclassified 507
79 Ga0068859_100011231 3300005617 Bacteria 9007
80 Ga0068859_100032785 3300005617 Bacteria 5218
81 Ga0068859_100887254 3300005617 Bacteria 977
82 Ga0068859_101258888 3300005617 Bacteria 815
83 Ga0068864_101144563 3300005618 Bacteria 775
84 Ga0068861_100081802 3300005719 Bacteria 2530
85 Ga0068861_100752351 3300005719 Bacteria 910
86 Ga0068861_101256722 3300005719 Bacteria 718
87 Ga0068870_10507745 3300005840 Bacteria 805
88 Ga0068860_100255370 3300005843 Bacteria 1708
89 Ga0068862_100112938 3300005844 Bacteria 2386
90 Ga0068862_100273501 3300005844 Bacteria 1546
91 Ga0068862_100847617 3300005844 Bacteria 895
92 Ga0081539_10003413 3300005985 Bacteria 19564
93 Ga0081539_10016658 3300005985 Bacteria 5227
94 Ga0075432_10263715 3300006058 Bacteria 703
95 Ga0075427_10000259 3300006194 Bacteria 5679
96 Ga0075428_100004783 3300006844 Bacteria 15000
97 Ga0075428_100006904 3300006844 Bacteria 12609
98 Ga0075428_100671031 3300006844 Bacteria 1105
99 Ga0075428_100916633 3300006844 Bacteria 929
100 Ga0075428_101840096 3300006844 Bacteria 630
101 Ga0075428_102639150 3300006844 Bacteria 513
102 Ga0075430_100278725 3300006846 Bacteria 1383
103 Ga0075430_101663170 3300006846 Unclassified 524
104 Ga0075431_100003767 3300006847 Bacteria 14739
105 Ga0075431_100046518 3300006847 Bacteria 4475
106 Ga0075431_100409362 3300006847 Unclassified 1356
107 Ga0075433_10528585 3300006852 Bacteria 1037
108 Ga0075434_100385196 3300006871 Bacteria 1423
109 Ga0075429_100005787 3300006880 Bacteria 10670
110 Ga0075429_100029758 3300006880 Bacteria 4744
111 Ga0075429_100052891 3300006880 Bacteria 3532
112 Ga0075429_100073786 3300006880 Bacteria 2971
113 Ga0075429_100102572 3300006880 Bacteria 2497
114 Ga0075429_100130113 3300006880 Bacteria 2201
115 Ga0075429_100140288 3300006880 Bacteria 2115
116 Ga0075429_100272007 3300006880 Unclassified 1484
117 Ga0097620_100011230 3300006931 Bacteria 9007
118 Ga0097620_100032783 3300006931 Bacteria 5218
119 Ga0097620_100887164 3300006931 Bacteria 977
120 Ga0097620_101258748 3300006931 Bacteria 815
121 Ga0105240_10880624 3300009093 Bacteria 964
122 Ga0111539_10076610 3300009094 Bacteria 3938
123 Ga0111539_10567377 3300009094 Bacteria 1322
124 Ga0111539_12194926 3300009094 Bacteria 641
125 Ga0105245_10211921 3300009098 Bacteria 1865
126 Ga0105247_10237606 3300009101 Bacteria 1240
127 Ga0114129_10002710 3300009147 Bacteria 24665
128 Ga0114129_10011857 3300009147 Bacteria 12398
129 Ga0114129_10027941 3300009147 Bacteria 7988
130 Ga0114129_10037280 3300009147 Bacteria 6865
131 Ga0114129_10038600 3300009147 Bacteria 6735
132 Ga0114129_11728067 3300009147 Bacteria 763
133 Ga0114129_13392407 3300009147 Unclassified 512
134 Ga0105243_10003080 3300009148 Bacteria 13726
135 Ga0105243_10557710 3300009148 Bacteria 1096
136 Ga0105243_10880256 3300009148 Bacteria 889
137 Ga0105243_11388185 3300009148 Bacteria 723
138 Ga0105242_11832336 3300009176 Bacteria 646
139 Ga0105238_11820927 3300009551 Bacteria 641
140 Ga0105249_10087384 3300009553 Bacteria 2909
141 Ga0105249_10140238 3300009553 Bacteria 2317
142 Ga0105249_10342510 3300009553 Bacteria 1512
143 Ga0105249_10871310 3300009553 Bacteria 967
144 Ga0105249_10963382 3300009553 Bacteria 921
145 Ga0105246_11079303 3300011119 Bacteria 732
146 Ga0163162_12584719 3300013306 Unclassified 584
147 Ga0163163_11507201 3300014325 Bacteria 734
148 Ga0157380_10209390 3300014326 Bacteria 1736
149 Ga0157379_12079925 3300014968 Bacteria 562
150 Ga0207643_10092241 3300025908 Bacteria 1767
151 Ga0207643_10166419 3300025908 Bacteria 1328
152 Ga0207643_11077234 3300025908 Bacteria 519
153 Ga0207684_10187383 3300025910 Bacteria 1784
154 Ga0207684_11574709 3300025910 Bacteria 533
155 Ga0207660_10173540 3300025917 Bacteria 1670
156 Ga0207662_10419479 3300025918 Bacteria 910
157 Ga0207646_10088699 3300025922 Bacteria 2768
158 Ga0207646_10089820 3300025922 Bacteria 2750
159 Ga0207659_11318864 3300025926 Bacteria 619
160 Ga0207687_10421668 3300025927 Bacteria 1101
161 Ga0207706_10574992 3300025933 Bacteria 969
162 Ga0207686_11033684 3300025934 Bacteria 668
163 Ga0207709_10010740 3300025935 Bacteria 5044
164 Ga0207709_10137601 3300025935 Bacteria 1674
165 Ga0207709_10700056 3300025935 Bacteria 811
166 Ga0207670_10311016 3300025936 Bacteria 1237
167 Ga0207670_11361360 3300025936 Bacteria 602
168 Ga0207670_11517505 3300025936 Bacteria 570
169 Ga0207712_10052075 3300025961 Bacteria 2866
170 Ga0207712_10971351 3300025961 Bacteria 753
171 Ga0207712_11716096 3300025961 Bacteria 563
172 Ga0207678_11598988 3300026067 Bacteria 574
173 Ga0207708_10044745 3300026075 Bacteria 3373
174 Ga0207708_10123195 3300026075 Bacteria 2021
175 Ga0207708_10963322 3300026075 Bacteria 740
176 Ga0207676_10400692 3300026095 Bacteria 1282
177 Ga0207674_10105544 3300026116 Bacteria 2795
178 Ga0207674_10242717 3300026116 Bacteria 1748
179 Ga0207674_10555855 3300026116 Bacteria 1109
180 Ga0207674_11069142 3300026116 Bacteria 776
181 Ga0207675_100050021 3300026118 Bacteria 3900
182 Ga0207675_100641738 3300026118 Bacteria 1067
183 Ga0207675_101406945 3300026118 Bacteria 718
184 Ga0209999_1023702 3300027543 Bacteria 1131
185 Ga0207428_10073879 3300027907 Bacteria 2674
186 Ga0268265_10022353 3300028380 Bacteria 4442
187 Ga0268265_10167027 3300028380 Bacteria 1876
188 Ga0268265_10680982 3300028380 Bacteria 991
189 Ga0265326_10017442 3300028558 Bacteria 2071
190 Ga0265326_10143855 3300028558 Bacteria 681
191 Ga0265334_10003349 3300028573 Bacteria 7314
192 Ga0265318_10004272 3300028577 Bacteria 6962
193 Ga0265318_10100072 3300028577 Bacteria 1067
194 Ga0265328_10017193 3300031239 Bacteria 2803
195 Ga0265320_10112174 3300031240 Bacteria 1248
196 Ga0265320_10309728 3300031240 Unclassified 698
197 Ga0265329_10093391 3300031242 Bacteria 955
198 Ga0265340_10018777 3300031247 Bacteria 3563
199 Ga0265327_10012244 3300031251 Bacteria 5812
200 Ga0265316_10180170 3300031344 Bacteria 1573
201 Ga0265316_10578384 3300031344 Bacteria 798
202 Ga0307408_100260760 3300031548 Bacteria 1434
203 Ga0307408_101695228 3300031548 Bacteria 602
204 Ga0307408_102124635 3300031548 Bacteria 542
205 Ga0316579_10016114 3300031691 Bacteria 3258
206 Ga0316579_10064138 3300031691 Bacteria 1732
207 Ga0316579_10098643 3300031691 Bacteria 1398
208 Ga0316576_10059595 3300031727 Bacteria 2795
209 Ga0316576_10072783 3300031727 Bacteria 2538
210 Ga0316576_10121992 3300031727 Bacteria 1958
211 Ga0316576_10236515 3300031727 Unclassified 1373
212 Ga0316578_10023634 3300031728 Bacteria 3441
213 Ga0316578_10063003 3300031728 Unclassified 2187
214 Ga0307405_10067269 3300031731 Bacteria 2288
215 Ga0307405_10121540 3300031731 Bacteria 1788
216 Ga0316577_10000831 3300031733 Bacteria 13456
217 Ga0316577_10077131 3300031733 Bacteria 1861
218 Ga0307413_10486811 3300031824 Bacteria 987
219 Ga0307413_12004537 3300031824 Bacteria 522
220 Ga0307410_10036900 3300031852 Bacteria 3187
221 Ga0307406_10358349 3300031901 Bacteria 1142
222 Ga0307407_10047924 3300031903 Bacteria 2428
223 Ga0307407_10449174 3300031903 Bacteria 935
224 Ga0307412_10110872 3300031911 Bacteria 1959
225 Ga0307412_11126241 3300031911 Bacteria 700
226 Ga0307409_100050771 3300031995 Bacteria 3170
227 Ga0307416_101964850 3300032002 Bacteria 688
228 Ga0307411_10794710 3300032005 Bacteria 833
229 Ga0307415_100046832 3300032126 Bacteria 2907
230 Ga0316585_10134997 3300032137 Bacteria 814
231 Ga0316585_10146332 3300032137 Unclassified 780
232 Ga0316593_10000074 3300032168 Bacteria 12104
233 Ga0316593_10000292 3300032168 Bacteria 8493
234 Ga0316593_10000617 3300032168 Bacteria 6770
235 Ga0316593_10004881 3300032168 Bacteria 3486
236 Ga0316593_10008100 3300032168 Unclassified 2915
237 Ga0316593_10021025 3300032168 Bacteria 2036
238 Ga0316593_10034983 3300032168 Bacteria 1650
239 Ga0316593_10068438 3300032168 Unclassified 1225
240 Ga0316593_10098650 3300032168 Bacteria 1034
241 Ga0316593_10109125 3300032168 Bacteria 987
242 Ga0316593_10201362 3300032168 Bacteria 736
243 Ga0316593_10371498 3300032168 Unclassified 549
244 Ga0316593_10449245 3300032168 Bacteria 503
245 Ga0316592_1000648 3300033524 Bacteria 5065
246 Ga0316592_1000962 3300033524 Bacteria 4429
247 Ga0316592_1001180 3300033524 Bacteria 4123
248 Ga0316592_1025015 3300033524 Bacteria 1286
249 Ga0316592_1063888 3300033524 Bacteria 828
250 Ga0316592_1089696 3300033524 Bacteria 703
251 Ga0316592_1101400 3300033524 Bacteria 662
252 Ga0316592_1111954 3300033524 Unclassified 631
253 Ga0316588_1064393 3300033528 Bacteria 897
254 Ga0316596_1000338 3300033541 Bacteria 7624
255 Ga0316596_1001674 3300033541 Bacteria 4576
256 Ga0316596_1031626 3300033541 Unclassified 1375
257 Ga0316596_1092502 3300033541 Bacteria 816
258 Ga0316596_1152722 3300033541 Unclassified 634
259 Ga0316596_1184433 3300033541 Bacteria 578
260 Ga0316596_1223913 3300033541 Unclassified 527
261 Ga0373950_0042225 3300034818 Bacteria 876
262 Ga0373940_0156625 3300035088 Unclassified 729
263 Ga0373932_0003230 3300035112 Bacteria 3951
264 Ga0373960_0040664 3300035121 Bacteria 1343
265 Ga0373961_0008302 3300035241 Bacteria 2526
266 Ga0316574_0161536 3300035398 Bacteria 1443
267 Ga0316574_0188399 3300035398 Bacteria 1327
268 Ga0316574_0213941 3300035398 Bacteria 1236
269 Ga0373933_0530720 3300035724 Bacteria 772
270 Ga0316582_0006061 3300036647 Bacteria 6303
271 Ga0316582_0103206 3300036647 Bacteria 1891
272 Ga0316582_0123842 3300036647 Bacteria 1732
273 Ga0316582_0288789 3300036647 Bacteria 1126
274 Ga0316582_0357442 3300036647 Bacteria 1005
275 Ga0316582_0469652 3300036647 Unclassified 867
276 Ga0316584_0001621 3300036712 Bacteria 13714
277 Ga0316584_0025317 3300036712 Bacteria 4351
278 Ga0316584_0047137 3300036712 Bacteria 3219
279 Ga0316584_0149906 3300036712 Bacteria 1736
280 Ga0316584_0433570 3300036712 Bacteria 932
281 Ga0316584_0496846 3300036712 Bacteria 858
282 Ga0316581_0173425 3300037588 Unclassified 665
283 Ga0242420_033431 3300038996 Bacteria 962
284 Ga0439433_0013236 3300041999 Bacteria 1810
285 Ga0439446_0039161 3300042156 Bacteria 1392
286 Ga0439434_0129544 3300042435 Bacteria 827
287 Ga0439434_0226200 3300042435 Unclassified 636
288 Ga0439435_0293261 3300042436 Bacteria 556
289 Ga0451577_0009630 3300042876 Bacteria 9274
290 Ga0451577_0027180 3300042876 Bacteria 5179
291 Ga0451577_0037231 3300042876 Bacteria 4379
292 Ga0451577_0059951 3300042876 Bacteria 3392
293 Ga0451577_0111861 3300042876 Bacteria 2443
294 Ga0451577_0179044 3300042876 Bacteria 1911
295 Ga0451577_0195631 3300042876 Bacteria 1825
296 Ga0451577_0241701 3300042876 Bacteria 1634
297 Ga0451577_0249337 3300042876 Bacteria 1607
298 Ga0451577_0256012 3300042876 Bacteria 1585
299 Ga0451577_0402837 3300042876 Bacteria 1242
300 Ga0451577_0611482 3300042876 Bacteria 989
301 Ga0451577_0725883 3300042876 Bacteria 899
302 Ga0451577_0787741 3300042876 Bacteria 859
303 Ga0451577_0806613 3300042876 Bacteria 848
304 Ga0451577_1207828 3300042876 Bacteria 674
305 Ga0451577_1526500 3300042876 Bacteria 590
306 Ga0451577_1568049 3300042876 Bacteria 581
307 Ga0451577_1612143 3300042876 Bacteria 572
308 Ga0453683_0010095 3300044673 Bacteria 6273
309 Ga0453683_0022921 3300044673 Bacteria 3980
310 Ga0453683_0059514 3300044673 Bacteria 2388
311 Ga0453683_0119593 3300044673 Bacteria 1658
312 Ga0453683_0128319 3300044673 Bacteria 1597
313 Ga0453683_0196685 3300044673 Bacteria 1280
314 Ga0453683_0553679 3300044673 Bacteria 748
315 Ga0453683_0726920 3300044673 Bacteria 651
316 Ga0453684_0000055 3300044712 Bacteria 532014
317 Ga0453684_0000171 3300044712 Bacteria 286600
318 Ga0453684_0000420 3300044712 Bacteria 172995
319 Ga0453684_0000588 3300044712 Bacteria 135201
320 Ga0453684_0001835 3300044712 Bacteria 55524
321 Ga0453684_0010317 3300044712 Bacteria 15993
322 Ga0453684_0016265 3300044712 Bacteria 11647
323 Ga0453684_0022996 3300044712 Bacteria 9215
324 Ga0453684_0025228 3300044712 Bacteria 8641
325 Ga0453684_0037245 3300044712 Bacteria 6679
326 Ga0453684_0052339 3300044712 Bacteria 5341
327 Ga0453684_0058940 3300044712 Bacteria 4955
328 Ga0453684_0069705 3300044712 Bacteria 4457
329 Ga0453684_0079436 3300044712 Bacteria 4101
330 Ga0453684_0130079 3300044712 Bacteria 3022
331 Ga0453684_0132993 3300044712 Bacteria 2982
332 Ga0453684_0186179 3300044712 Bacteria 2433
333 Ga0453684_0246937 3300044712 Bacteria 2052
334 Ga0453684_0255359 3300044712 Bacteria 2011
335 Ga0453684_0272251 3300044712 Bacteria 1934
336 Ga0453684_0326456 3300044712 Bacteria 1736
337 Ga0453684_0345959 3300044712 Bacteria 1678
338 Ga0453684_0350266 3300044712 Bacteria 1665
339 Ga0453684_0416136 3300044712 Bacteria 1502
340 Ga0453684_0417558 3300044712 Bacteria 1499
341 Ga0453684_0422110 3300044712 Bacteria 1489
342 Ga0453684_0454847 3300044712 Bacteria 1424
343 Ga0453684_0472723 3300044712 Bacteria 1392
344 Ga0453684_0509788 3300044712 Bacteria 1331
345 Ga0453684_0523313 3300044712 Bacteria 1310
346 Ga0453684_0537562 3300044712 Bacteria 1289
347 Ga0453684_0539363 3300044712 Bacteria 1286
348 Ga0453684_0589985 3300044712 Bacteria 1219
349 Ga0453684_0597918 3300044712 Bacteria 1209
350 Ga0453684_0632799 3300044712 Bacteria 1169
351 Ga0453684_0706405 3300044712 Bacteria 1095
352 Ga0453684_0819316 3300044712 Bacteria 1002
353 Ga0453684_1186204 3300044712 Bacteria 802
354 Ga0453684_1705394 3300044712 Bacteria 643
355 Ga0453684_1713885 3300044712 Bacteria 641
356 Ga0451576_0000454 3300045051 Bacteria 93047
357 Ga0451576_0019853 3300045051 Bacteria 7328
358 Ga0451576_0023521 3300045051 Bacteria 6671
359 Ga0451576_0059482 3300045051 Bacteria 3988
360 Ga0451576_0081153 3300045051 Bacteria 3373
361 Ga0451576_0174724 3300045051 Bacteria 2242
362 Ga0451576_0234567 3300045051 Bacteria 1916
363 Ga0451576_0277115 3300045051 Bacteria 1753
364 Ga0451576_0300337 3300045051 Bacteria 1679
365 Ga0451576_0328227 3300045051 Bacteria 1601
366 Ga0451576_0364595 3300045051 Bacteria 1513
367 Ga0451576_0768941 3300045051 Bacteria 1012
368 Ga0451576_2362447 3300045051 Bacteria 544
369 Ga0496106_0355524 3300048909 Bacteria 1177
370 Ga0501292_088422 3300049515 Bacteria 599
371 Ga0501298_036939 3300049521 Bacteria 979
372 Ga0501298_154621 3300049521 Unclassified 563
373 Ga0501315_044761 3300049531 Bacteria 680
374 Ga0501036_0353834 3300049572 Bacteria 1226
375 Ga0501036_0508748 3300049572 Bacteria 1002
376 Ga0501038_0375890 3300049574 Bacteria 1103
377 Ga0501038_0382352 3300049574 Bacteria 1092
378 Ga0501040_0146962 3300049576 Bacteria 1662
379 Ga0501040_0409116 3300049576 Bacteria 975
380 Ga0501040_1004955 3300049576 Bacteria 605
381 Ga0501040_1017919 3300049576 Bacteria 601
382 Ga0501041_0546235 3300049577 Bacteria 738
383 Ga0501041_0744315 3300049577 Bacteria 628
384 Ga0501042_0603621 3300049578 Bacteria 798
385 Ga0501042_1017410 3300049578 Bacteria 604
386 Ga0501046_0195720 3300049580 Bacteria 1506
387 Ga0501048_0077938 3300049582 Bacteria 2339
388 Ga0501048_0101432 3300049582 Bacteria 2031
389 Ga0501048_0202238 3300049582 Bacteria 1408
390 Ga0501048_0294814 3300049582 Bacteria 1154
391 Ga0501068_0201024 3300049584 Bacteria 1264
392 Ga0501068_0525331 3300049584 Bacteria 769
393 Ga0501071_0292310 3300049587 Bacteria 1234
394 Ga0501071_1183308 3300049587 Bacteria 591
395 Ga0501072_0006600 3300049588 Bacteria 8835
396 Ga0501072_0179113 3300049588 Bacteria 1691
397 Ga0501073_0466393 3300049589 Bacteria 873
398 Ga0501074_0409509 3300049590 Bacteria 962
399 Ga0501075_0002791 3300049591 Bacteria 11695
400 Ga0501075_0043432 3300049591 Bacteria 3372
401 Ga0501076_0026731 3300049592 Bacteria 4473
402 Ga0501076_0077560 3300049592 Bacteria 2666
403 Ga0501076_0290028 3300049592 Bacteria 1341
404 Ga0501076_1331760 3300049592 Bacteria 590
405 Ga0501198_071193 3300049649 Bacteria 656
406 Ga0501223_113761 3300049663 Bacteria 567
407 Ga0501227_046384 3300049665 Bacteria 1087
408 Ga0501236_086326 3300049670 Bacteria 596
409 Ga0501239_060739 3300049672 Bacteria 568
410 Ga0501079_0023812 3300049741 Bacteria 4698
411 Ga0501079_0126059 3300049741 Bacteria 1992
412 Ga0501079_0147816 3300049741 Bacteria 1832
413 Ga0501079_1436208 3300049741 Bacteria 543
414 Ga0501080_0022383 3300049742 Bacteria 5855
415 Ga0501080_0131419 3300049742 Bacteria 2318
416 Ga0501081_0009161 3300049743 Bacteria 6444
417 Ga0501081_0088787 3300049743 Bacteria 2172
418 Ga0501081_0316298 3300049743 Bacteria 1147
419 Ga0501081_0452457 3300049743 Bacteria 954
420 Ga0501083_0195015 3300049744 Bacteria 1322
421 Ga0501283_037638 3300049779 Bacteria 830
422 Ga0501045_0740525 3300049824 Bacteria 725
423 Ga0501045_1274088 3300049824 Bacteria 535
424 nmdc:mga05p37_1391776_c1 3300050507 Bacteria 707
425 nmdc:mga05p37_1824984_c1 3300050507 Unclassified 585
426 nmdc:mga05p37_19882_c1 3300050507 Bacteria 8123
427 nmdc:mga05p37_32923_c1 3300050507 Bacteria 6345
428 nmdc:mga05p37_381403_c1 3300050507 Bacteria 1652
429 nmdc:mga05p37_448934_c1 3300050507 Bacteria 1493
430 nmdc:mga05p37_4654_c1 3300050507 Bacteria 16043
431 nmdc:mga05p37_5396_c1 3300050507 Bacteria 15029
432 nmdc:mga09592_11100_c1 3300050508 Bacteria 7329
433 nmdc:mga09592_161985_c1 3300050508 Bacteria 1933
434 nmdc:mga09592_191324_c1 3300050508 Unclassified 1771
435 nmdc:mga09592_29415_c1 3300050508 Bacteria 4570
436 nmdc:mga09592_305326_c1 3300050508 Bacteria 1379
437 nmdc:mga09592_42839_c1 3300050508 Bacteria 3808
438 nmdc:mga09592_6753_c1 3300050508 Bacteria 9335
439 nmdc:mga0qj67_114101_c1 3300050509 Bacteria 2182
440 nmdc:mga0qj67_223022_c1 3300050509 Bacteria 1530
441 nmdc:mga0qj67_247682_c1 3300050509 Bacteria 1446
442 nmdc:mga06r32_244070_c1 3300050510 Bacteria 1783
443 nmdc:mga06r32_55792_c1 3300050510 Bacteria 3791
444 nmdc:mga08y16_80553_c1 3300050511 Bacteria 3395
445 nmdc:mga08y16_864835_c1 3300050511 Bacteria 892
446 nmdc:mga0n895_762574_c1 3300050512 Bacteria 960
447 nmdc:mga0a205_256923_c1 3300050515 Bacteria 1625
448 nmdc:mga0a205_42417_c1 3300050515 Bacteria 4385
449 Ga0501084_0072311 3300054114 Bacteria 2888
450 Ga0501084_0136204 3300054114 Bacteria 2067
451 Ga0501082_0029342 3300060353 Bacteria 4739
452 Ga0501082_0110957 3300060353 Bacteria 2374
453 Ga0501082_0879434 3300060353 Bacteria 784
454 Ga0530510_0274268 3300061734 Bacteria 1259
455 Ga0530510_0284854 3300061734 Bacteria 1235
456 Ga0530510_0308641 3300061734 Bacteria 1185
457 Ga0530510_0375712 3300061734 Bacteria 1070
458 Ga0075434_101146714
459 SwRhRL2b_contig_488749
460 JGI25406J46586_10024839
461 Ga0058860_11506360
462 Ga0065704_10070890
463 Ga0065704_10085506
464 Ga0065704_10101765
465 Ga0065704_10343018
466 Ga0065712_10135921
467 Ga0065707_10082110
468 Ga0065707_10083718
469 Ga0065707_10086644
470 Ga0065707_10100665
471 Ga0065707_10148591
472 Ga0065707_10196241
473 Ga0065707_10580369
474 Ga0065707_10881548
475 Ga0065707_10953472
476 Ga0070680_100487846
477 Ga0070680_101241965
478 Ga0070689_100095292
479 Ga0070689_100250420
480 Ga0070689_100416390
481 Ga0070691_10685633
482 Ga0070687_100141685
483 Ga0070669_100644441
484 Ga0070673_100545967
485 Ga0070703_10604155
486 Ga0070701_10611449
487 Ga0070705_100010583
488 Ga0070705_100345809
489 Ga0070705_100776394
490 Ga0070700_100027695
491 Ga0070700_100381401
492 Ga0070694_100058367
493 Ga0070694_100201791
494 Ga0070694_100294794
495 Ga0070694_100785399
496 Ga0070663_101881425
497 Ga0070662_100544545
498 Ga0068867_101031924
499 Ga0070706_100141823
500 Ga0070706_101132123
501 Ga0070707_100039091
502 Ga0070707_100078348
503 Ga0070707_101392941
504 Ga0070707_101488171
505 Ga0070707_101560713
506 Ga0070698_100012571
507 Ga0070698_100088545
508 Ga0070698_100089307
509 Ga0070698_100289111
510 Ga0070698_100366208
511 Ga0070698_101163829
512 Ga0070698_101688798
513 Ga0070699_100002160
514 Ga0070699_100044111
515 Ga0070699_100100488
516 Ga0070699_100672949
517 Ga0070699_100964467
518 Ga0070697_100254228
519 Ga0070697_100437245
520 Ga0070695_100853553
521 Ga0070695_101188927
522 Ga0070696_100422933
523 Ga0070696_100577088
524 Ga0070696_100831044
525 Ga0070693_100554187
526 Ga0070704_100007865
527 Ga0070704_100049841
528 Ga0070704_100066792
529 Ga0070704_100207958
530 Ga0068857_100495954
531 Ga0068857_100787089
532 Ga0068857_100967775
533 Ga0068854_100627327
534 Ga0070702_100217707
535 Ga0070702_101838223
536 Ga0068859_100011231
537 Ga0068859_100032785
538 Ga0068859_100887254
539 Ga0068859_101258888
540 Ga0068864_101144563
541 Ga0068861_100081802
542 Ga0068861_100752351
543 Ga0068861_101256722
544 Ga0068870_10507745
545 Ga0068860_100255370
546 Ga0068862_100112938
547 Ga0068862_100273501
548 Ga0068862_100847617
549 Ga0081539_10003413
550 Ga0081539_10016658
551 Ga0075432_10263715
552 Ga0075427_10000259
553 Ga0075428_100004783
554 Ga0075428_100006904
555 Ga0075428_100671031
556 Ga0075428_100916633
557 Ga0075428_101840096
558 Ga0075428_102639150
559 Ga0075430_100278725
560 Ga0075430_101663170
561 Ga0075431_100003767
562 Ga0075431_100046518
563 Ga0075431_100409362
564 Ga0075433_10528585
565 Ga0075434_100385196
566 Ga0075429_100005787
567 Ga0075429_100029758
568 Ga0075429_100052891
569 Ga0075429_100073786
570 Ga0075429_100102572
571 Ga0075429_100130113
572 Ga0075429_100140288
573 Ga0075429_100272007
574 Ga0097620_100011230
575 Ga0097620_100032783
576 Ga0097620_100887164
577 Ga0097620_101258748
578 Ga0105240_10880624
579 Ga0111539_10076610
580 Ga0111539_10567377
581 Ga0111539_12194926
582 Ga0105245_10211921
583 Ga0105247_10237606
584 Ga0114129_10002710
585 Ga0114129_10011857
586 Ga0114129_10027941
587 Ga0114129_10037280
588 Ga0114129_10038600
589 Ga0114129_11728067
590 Ga0114129_13392407
591 Ga0105243_10003080
592 Ga0105243_10557710
593 Ga0105243_10880256
594 Ga0105243_11388185
595 Ga0105242_11832336
596 Ga0105238_11820927
597 Ga0105249_10087384
598 Ga0105249_10140238
599 Ga0105249_10342510
600 Ga0105249_10871310
601 Ga0105249_10963382
602 Ga0105246_11079303
603 Ga0163162_12584719
604 Ga0163163_11507201
605 Ga0157380_10209390
606 Ga0157379_12079925
607 Ga0207643_10092241
608 Ga0207643_10166419
609 Ga0207643_11077234
610 Ga0207684_10187383
611 Ga0207684_11574709
612 Ga0207660_10173540
613 Ga0207662_10419479
614 Ga0207646_10088699
615 Ga0207646_10089820
616 Ga0207659_11318864
617 Ga0207687_10421668
618 Ga0207706_10574992
619 Ga0207686_11033684
620 Ga0207709_10010740
621 Ga0207709_10137601
622 Ga0207709_10700056
623 Ga0207670_10311016
624 Ga0207670_11361360
625 Ga0207670_11517505
626 Ga0207712_10052075
627 Ga0207712_10971351
628 Ga0207712_11716096
629 Ga0207678_11598988
630 Ga0207708_10044745
631 Ga0207708_10123195
632 Ga0207708_10963322
633 Ga0207676_10400692
634 Ga0207674_10105544
635 Ga0207674_10242717
636 Ga0207674_10555855
637 Ga0207674_11069142
638 Ga0207675_100050021
639 Ga0207675_100641738
640 Ga0207675_101406945
641 Ga0209999_1023702
642 Ga0207428_10073879
643 Ga0268265_10022353
644 Ga0268265_10167027
645 Ga0268265_10680982
646 Ga0265326_10017442
647 Ga0265326_10143855
648 Ga0265334_10003349
649 Ga0265318_10004272
650 Ga0265318_10100072
651 Ga0265328_10017193
652 Ga0265320_10112174
653 Ga0265320_10309728
654 Ga0265329_10093391
655 Ga0265340_10018777
656 Ga0265327_10012244
657 Ga0265316_10180170
658 Ga0265316_10578384
659 Ga0307408_100260760
660 Ga0307408_101695228
661 Ga0307408_102124635
662 Ga0316579_10016114
663 Ga0316579_10064138
664 Ga0316579_10098643
665 Ga0316576_10059595
666 Ga0316576_10072783
667 Ga0316576_10121992
668 Ga0316576_10236515
669 Ga0316578_10023634
670 Ga0316578_10063003
671 Ga0307405_10067269
672 Ga0307405_10121540
673 Ga0316577_10000831
674 Ga0316577_10077131
675 Ga0307413_10486811
676 Ga0307413_12004537
677 Ga0307410_10036900
678 Ga0307406_10358349
679 Ga0307407_10047924
680 Ga0307407_10449174
681 Ga0307412_10110872
682 Ga0307412_11126241
683 Ga0307409_100050771
684 Ga0307416_101964850
685 Ga0307411_10794710
686 Ga0307415_100046832
687 Ga0316585_10134997
688 Ga0316585_10146332
689 Ga0316593_10000074
690 Ga0316593_10000292
691 Ga0316593_10000617
692 Ga0316593_10004881
693 Ga0316593_10008100
694 Ga0316593_10021025
695 Ga0316593_10034983
696 Ga0316593_10068438
697 Ga0316593_10098650
698 Ga0316593_10109125
699 Ga0316593_10201362
700 Ga0316593_10371498
701 Ga0316593_10449245
702 Ga0316592_1000648
703 Ga0316592_1000962
704 Ga0316592_1001180
705 Ga0316592_1025015
706 Ga0316592_1063888
707 Ga0316592_1089696
708 Ga0316592_1101400
709 Ga0316592_1111954
710 Ga0316588_1064393
711 Ga0316596_1000338
712 Ga0316596_1001674
713 Ga0316596_1031626
714 Ga0316596_1092502
715 Ga0316596_1152722
716 Ga0316596_1184433
717 Ga0316596_1223913
718 Ga0373950_0042225
719 Ga0373940_0156625
720 Ga0373932_0003230
721 Ga0373960_0040664
722 Ga0373961_0008302
723 Ga0316574_0161536
724 Ga0316574_0188399
725 Ga0316574_0213941
726 Ga0373933_0530720
727 Ga0316582_0006061
728 Ga0316582_0103206
729 Ga0316582_0123842
730 Ga0316582_0288789
731 Ga0316582_0357442
732 Ga0316582_0469652
733 Ga0316584_0001621
734 Ga0316584_0025317
735 Ga0316584_0047137
736 Ga0316584_0149906
737 Ga0316584_0433570
738 Ga0316584_0496846
739 Ga0316581_0173425
740 Ga0242420_033431
741 Ga0439433_0013236
742 Ga0439446_0039161
743 Ga0439434_0129544
744 Ga0439434_0226200
745 Ga0439435_0293261
746 Ga0451577_0009630
747 Ga0451577_0027180
748 Ga0451577_0037231
749 Ga0451577_0059951
750 Ga0451577_0111861
751 Ga0451577_0179044
752 Ga0451577_0195631
753 Ga0451577_0241701
754 Ga0451577_0249337
755 Ga0451577_0256012
756 Ga0451577_0402837
757 Ga0451577_0611482
758 Ga0451577_0725883
759 Ga0451577_0787741
760 Ga0451577_0806613
761 Ga0451577_1207828
762 Ga0451577_1526500
763 Ga0451577_1568049
764 Ga0451577_1612143
765 Ga0453683_0010095
766 Ga0453683_0022921
767 Ga0453683_0059514
768 Ga0453683_0119593
769 Ga0453683_0128319
770 Ga0453683_0196685
771 Ga0453683_0553679
772 Ga0453683_0726920
773 Ga0453684_0000055
774 Ga0453684_0000171
775 Ga0453684_0000420
776 Ga0453684_0000588
777 Ga0453684_0001835
778 Ga0453684_0010317
779 Ga0453684_0016265
780 Ga0453684_0022996
781 Ga0453684_0025228
782 Ga0453684_0037245
783 Ga0453684_0052339
784 Ga0453684_0058940
785 Ga0453684_0069705
786 Ga0453684_0079436
787 Ga0453684_0130079
788 Ga0453684_0132993
789 Ga0453684_0186179
790 Ga0453684_0246937
791 Ga0453684_0255359
792 Ga0453684_0272251
793 Ga0453684_0326456
794 Ga0453684_0345959
795 Ga0453684_0350266
796 Ga0453684_0416136
797 Ga0453684_0417558
798 Ga0453684_0422110
799 Ga0453684_0454847
800 Ga0453684_0472723
801 Ga0453684_0509788
802 Ga0453684_0523313
803 Ga0453684_0537562
804 Ga0453684_0539363
805 Ga0453684_0589985
806 Ga0453684_0597918
807 Ga0453684_0632799
808 Ga0453684_0706405
809 Ga0453684_0819316
810 Ga0453684_1186204
811 Ga0453684_1705394
812 Ga0453684_1713885
813 Ga0451576_0000454
814 Ga0451576_0019853
815 Ga0451576_0023521
816 Ga0451576_0059482
817 Ga0451576_0081153
818 Ga0451576_0174724
819 Ga0451576_0234567
820 Ga0451576_0277115
821 Ga0451576_0300337
822 Ga0451576_0328227
823 Ga0451576_0364595
824 Ga0451576_0768941
825 Ga0451576_2362447
826 Ga0496106_0355524
827 Ga0501292_088422
828 Ga0501298_036939
829 Ga0501298_154621
830 Ga0501315_044761
831 Ga0501036_0353834
832 Ga0501036_0508748
833 Ga0501038_0375890
834 Ga0501038_0382352
835 Ga0501040_0146962
836 Ga0501040_0409116
837 Ga0501040_1004955
838 Ga0501040_1017919
839 Ga0501041_0546235
840 Ga0501041_0744315
841 Ga0501042_0603621
842 Ga0501042_1017410
843 Ga0501046_0195720
844 Ga0501048_0077938
845 Ga0501048_0101432
846 Ga0501048_0202238
847 Ga0501048_0294814
848 Ga0501068_0201024
849 Ga0501068_0525331
850 Ga0501071_0292310
851 Ga0501071_1183308
852 Ga0501072_0006600
853 Ga0501072_0179113
854 Ga0501073_0466393
855 Ga0501074_0409509
856 Ga0501075_0002791
857 Ga0501075_0043432
858 Ga0501076_0026731
859 Ga0501076_0077560
860 Ga0501076_0290028
861 Ga0501076_1331760
862 Ga0501198_071193
863 Ga0501223_113761
864 Ga0501227_046384
865 Ga0501236_086326
866 Ga0501239_060739
867 Ga0501079_0023812
868 Ga0501079_0126059
869 Ga0501079_0147816
870 Ga0501079_1436208
871 Ga0501080_0022383
872 Ga0501080_0131419
873 Ga0501081_0009161
874 Ga0501081_0088787
875 Ga0501081_0316298
876 Ga0501081_0452457
877 Ga0501083_0195015
878 Ga0501283_037638
879 Ga0501045_0740525
880 Ga0501045_1274088
881 nmdc:mga05p37_1391776_c1
882 nmdc:mga05p37_1824984_c1
883 nmdc:mga05p37_19882_c1
884 nmdc:mga05p37_32923_c1
885 nmdc:mga05p37_381403_c1
886 nmdc:mga05p37_448934_c1
887 nmdc:mga05p37_4654_c1
888 nmdc:mga05p37_5396_c1
889 nmdc:mga09592_11100_c1
890 nmdc:mga09592_161985_c1
891 nmdc:mga09592_191324_c1
892 nmdc:mga09592_29415_c1
893 nmdc:mga09592_305326_c1
894 nmdc:mga09592_42839_c1
895 nmdc:mga09592_6753_c1
896 nmdc:mga0qj67_114101_c1
897 nmdc:mga0qj67_223022_c1
898 nmdc:mga0qj67_247682_c1
899 nmdc:mga06r32_244070_c1
900 nmdc:mga06r32_55792_c1
901 nmdc:mga08y16_80553_c1
902 nmdc:mga08y16_864835_c1
903 nmdc:mga0n895_762574_c1
904 nmdc:mga0a205_256923_c1
905 nmdc:mga0a205_42417_c1
906 Ga0501084_0072311
907 Ga0501084_0136204
908 Ga0501082_0029342
909 Ga0501082_0110957
910 Ga0501082_0879434
911 Ga0530510_0274268
912 Ga0530510_0284854
913 Ga0530510_0308641
914 Ga0530510_0375712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

42

109

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9276 5 109
6wqn-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with the antibiotic, contezolid 0.9186 5 109
6ddg-assembly1.cif.gz_G structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.917 5 107
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9169 3 109
8cgk-assembly1.cif.gz_t lincomycin and avilamycin bound to the 50s subunit 0.9156 3 109
ID Description Score Start End Superfamily
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9305 5 107 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8936 5 106 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8844 4 107 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8771 5 106 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8659 3 106 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1F5J9P2-F1-model_v4 Large ribosomal subunit protein uL24 0.9502 5 110 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1W2Q8-F1-model_v4 Large ribosomal subunit protein uL24 0.9464 5 109 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A142GUB2-F1-model_v4 Large ribosomal subunit protein uL24 0.9401 3 110 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F6HF57-F1-model_v4 Large ribosomal subunit protein uL24 0.9374 4 109 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7X9EJ22-F1-model_v4 Large ribosomal subunit protein uL24 0.933 3 110 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map