F447689

General Info

Members Datasets Scaffolds Average Seq Length
455 237 910 160

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221641|2644230299
Length 189
Sequence DLHPDAATHPTDSPTDGPTSGPTEQETGGPADLDVAVVRLDPDLPLPSYAHPGDAGADLHTTVDVTLAPGERALVPTGISIALPDGFVALVHPRSGLAARHGLSIVNTPGTVDAGYRGEIKVLLINHDPEEAVTLNRGDRIAQLVIQRFERARFVEVGVLPESTRGAGGYGSTGTGSRPGSGRDEGVLT

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
132 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2643221641 Nocardioides sp. Root122 Isolate Unclassified
227 2643221615 Nocardioides sp. Root224 Isolate Unclassified
228 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
229 2687453737 Frankia sp. BMG5.36 Isolate Nodule
230 2739367898 Nocardioides sp. CF479 Isolate Unclassified
231 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
232 2855683550 Micromonospora sp. RP3T Isolate Unclassified
233 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
234 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
235 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
236 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
237 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 1.32
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.77
Nodule 0.44
Rhizoplane 10.11
Rhizosphere 73.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001443 3300000549 Bacteria 3543
2 LJQas_1022335 3300000549 Bacteria 735
3 JGI25406J46586_10002944 3300003203 Bacteria 8029
4 Ga0070658_10050484 3300005327 Bacteria 3372
5 Ga0070683_100910868 3300005329 Bacteria 843
6 Ga0068869_100191661 3300005334 Bacteria 1608
7 Ga0070666_10368600 3300005335 Bacteria 1030
8 Ga0070680_100083989 3300005336 Bacteria 2630
9 Ga0070680_100369031 3300005336 Bacteria 1221
10 Ga0070682_100145659 3300005337 Bacteria 1620
11 Ga0070660_100157641 3300005339 Bacteria 1828
12 Ga0070668_100370279 3300005347 Bacteria 1217
13 Ga0070674_100037832 3300005356 Bacteria 3248
14 Ga0070688_100714949 3300005365 Bacteria 777
15 Ga0070659_100570507 3300005366 Bacteria 970
16 Ga0070667_100067477 3300005367 Bacteria 3041
17 Ga0070667_100167213 3300005367 Bacteria 1940
18 Ga0070708_100455238 3300005445 Bacteria 1207
19 Ga0070663_100416622 3300005455 Bacteria 1101
20 Ga0070678_100053658 3300005456 Bacteria 2933
21 Ga0070681_10051800 3300005458 Bacteria 4094
22 Ga0070685_10038241 3300005466 Bacteria 2721
23 Ga0070698_100010433 3300005471 Bacteria 9920
24 Ga0070679_100013115 3300005530 Bacteria 7937
25 Ga0070684_100196260 3300005535 Bacteria 1838
26 Ga0070684_100752783 3300005535 Bacteria 910
27 Ga0070684_100986205 3300005535 Bacteria 791
28 Ga0070684_101475258 3300005535 Bacteria 641
29 Ga0070702_100609091 3300005615 Bacteria 820
30 Ga0070702_100829102 3300005615 Bacteria 718
31 Ga0068866_10304824 3300005718 Bacteria 996
32 Ga0068860_100000560 3300005843 Bacteria 45058
33 Ga0068862_100939827 3300005844 Bacteria 852
34 Ga0081455_10000427 3300005937 Bacteria 55256
35 Ga0081455_10029881 3300005937 Bacteria 4962
36 Ga0081538_10023373 3300005981 Bacteria 4446
37 Ga0081539_10002050 3300005985 Bacteria 30294
38 Ga0075365_10005743 3300006038 Bacteria 6734
39 Ga0075365_10009542 3300006038 Bacteria 5589
40 Ga0075365_10071951 3300006038 Bacteria 2329
41 Ga0075365_10101194 3300006038 Bacteria 1973
42 Ga0075365_10224105 3300006038 Bacteria 1319
43 Ga0075365_10515227 3300006038 Bacteria 845
44 Ga0075365_10555922 3300006038 Bacteria 812
45 Ga0075368_10007197 3300006042 Bacteria 3922
46 Ga0075368_10045427 3300006042 Bacteria 1735
47 Ga0075363_100012711 3300006048 Bacteria 4063
48 Ga0075363_100017891 3300006048 Bacteria 3523
49 Ga0075363_100104342 3300006048 Bacteria 1571
50 Ga0075363_100202980 3300006048 Bacteria 1133
51 Ga0075363_100401062 3300006048 Bacteria 806
52 Ga0075364_10011060 3300006051 Bacteria 5476
53 Ga0075364_10130539 3300006051 Bacteria 1686
54 Ga0075364_10264302 3300006051 Bacteria 1170
55 Ga0075364_10412737 3300006051 Bacteria 921
56 Ga0075362_10003023 3300006177 Bacteria 5784
57 Ga0075367_10050833 3300006178 Bacteria 2448
58 Ga0075367_10211151 3300006178 Bacteria 1214
59 Ga0097621_100323583 3300006237 Bacteria 1366
60 Ga0097621_101403292 3300006237 Bacteria 661
61 Ga0075370_10009077 3300006353 Bacteria 5142
62 Ga0068871_100697698 3300006358 Bacteria 930
63 Ga0075428_100019842 3300006844 Bacteria 7440
64 Ga0075430_100134817 3300006846 Bacteria 2058
65 Ga0075431_100000141 3300006847 Bacteria 48843
66 Ga0075431_100005558 3300006847 Bacteria 12444
67 Ga0075429_100002915 3300006880 Bacteria 14508
68 Ga0075429_100396186 3300006880 Bacteria 1209
69 Ga0068865_100121496 3300006881 Bacteria 1943
70 Ga0105244_10184726 3300009036 Bacteria 988
71 Ga0111539_10009204 3300009094 Bacteria 12486
72 Ga0111539_10055055 3300009094 Bacteria 4729
73 Ga0111539_10426567 3300009094 Bacteria 1544
74 Ga0105245_10004822 3300009098 Bacteria 11892
75 Ga0105245_10013771 3300009098 Bacteria 7043
76 Ga0105245_10447238 3300009098 Bacteria 1300
77 Ga0105245_10514225 3300009098 Bacteria 1215
78 Ga0114129_10013785 3300009147 Bacteria 11519
79 Ga0105243_10002326 3300009148 Bacteria 15906
80 Ga0105243_10032091 3300009148 Bacteria 4054
81 Ga0105243_10178206 3300009148 Bacteria 1846
82 Ga0105243_10656290 3300009148 Bacteria 1017
83 Ga0105243_10663457 3300009148 Bacteria 1012
84 Ga0105242_10059599 3300009176 Bacteria 3132
85 Ga0105242_10069057 3300009176 Bacteria 2926
86 Ga0105242_10389409 3300009176 Bacteria 1298
87 Ga0105242_10398804 3300009176 Bacteria 1283
88 Ga0105248_10000876 3300009177 Bacteria 33746
89 Ga0105248_10046619 3300009177 Bacteria 4858
90 Ga0105237_10023116 3300009545 Bacteria 6374
91 Ga0105238_10089410 3300009551 Bacteria 3066
92 Ga0105249_10025236 3300009553 Bacteria 5348
93 Ga0105249_10177988 3300009553 Bacteria 2067
94 Ga0105249_12437828 3300009553 Bacteria 596
95 Ga0105246_10002456 3300011119 Bacteria 11188
96 Ga0105246_10020334 3300011119 Bacteria 4256
97 Ga0105246_10372200 3300011119 Bacteria 1177
98 Ga0105246_10688962 3300011119 Bacteria 894
99 Ga0105246_11289134 3300011119 Bacteria 676
100 Ga0105246_12580505 3300011119 Bacteria 502
101 Ga0157369_10020131 3300013105 Bacteria 7462
102 Ga0157369_10532189 3300013105 Bacteria 1215
103 Ga0157369_11659858 3300013105 Bacteria 650
104 Ga0157369_12181753 3300013105 Bacteria 562
105 Ga0157374_10057327 3300013296 Bacteria 3638
106 Ga0157374_11522058 3300013296 Bacteria 692
107 Ga0163162_10245358 3300013306 Bacteria 1923
108 Ga0163162_10740660 3300013306 Bacteria 1103
109 Ga0157372_10002563 3300013307 Bacteria 19710
110 Ga0157372_10595885 3300013307 Bacteria 1288
111 Ga0157372_12006860 3300013307 Bacteria 665
112 Ga0157375_10007927 3300013308 Bacteria 9297
113 Ga0157375_10021292 3300013308 Bacteria 5941
114 Ga0157375_10033031 3300013308 Bacteria 4913
115 Ga0157375_10571990 3300013308 Bacteria 1291
116 Ga0157375_11173710 3300013308 Bacteria 900
117 Ga0163163_10025600 3300014325 Bacteria 5625
118 Ga0163163_10090943 3300014325 Bacteria 3065
119 Ga0163163_10092074 3300014325 Bacteria 3046
120 Ga0163163_10126900 3300014325 Bacteria 2589
121 Ga0157380_10011577 3300014326 Bacteria 6376
122 Ga0157380_10198069 3300014326 Bacteria 1779
123 Ga0157380_11286423 3300014326 Bacteria 778
124 Ga0157377_10005040 3300014745 Bacteria 6165
125 Ga0157377_10384669 3300014745 Bacteria 951
126 Ga0157379_10009270 3300014968 Bacteria 8568
127 Ga0157376_10409993 3300014969 Bacteria 1312
128 Ga0163161_10573456 3300017792 Bacteria 927
129 Ga0197907_10096826 3300020069 Bacteria 4944
130 Ga0213874_10233119 3300021377 Bacteria 673
131 Ga0224712_10014536 3300022467 Bacteria 2538
132 Ga0207642_10203101 3300025899 Bacteria 1096
133 Ga0207710_10029475 3300025900 Bacteria 2389
134 Ga0207688_10198432 3300025901 Bacteria 1202
135 Ga0207680_10131431 3300025903 Bacteria 1650
136 Ga0207647_10021359 3300025904 Bacteria 4323
137 Ga0207705_10083401 3300025909 Bacteria 2332
138 Ga0207707_10410590 3300025912 Bacteria 1162
139 Ga0207671_10058142 3300025914 Bacteria 2866
140 Ga0207660_10196693 3300025917 Bacteria 1573
141 Ga0207660_10294229 3300025917 Bacteria 1291
142 Ga0207662_10158078 3300025918 Bacteria 1446
143 Ga0207657_10136853 3300025919 Bacteria 2003
144 Ga0207649_10086677 3300025920 Bacteria 2041
145 Ga0207659_10062605 3300025926 Bacteria 2686
146 Ga0207687_10682332 3300025927 Bacteria 871
147 Ga0207709_10184872 3300025935 Bacteria 1475
148 Ga0207709_10423915 3300025935 Bacteria 1023
149 Ga0207709_11208786 3300025935 Bacteria 623
150 Ga0207669_10668780 3300025937 Bacteria 851
151 Ga0207704_10090873 3300025938 Bacteria 2005
152 Ga0207691_10069627 3300025940 Bacteria 3178
153 Ga0207711_10003792 3300025941 Bacteria 13002
154 Ga0207661_10002795 3300025944 Bacteria 12041
155 Ga0207661_10166492 3300025944 Bacteria 1916
156 Ga0207679_11065375 3300025945 Bacteria 741
157 Ga0207658_10080775 3300025986 Bacteria 2491
158 Ga0207658_10178730 3300025986 Bacteria 1754
159 Ga0207703_10012091 3300026035 Bacteria 6725
160 Ga0207703_10191051 3300026035 Bacteria 1813
161 Ga0207678_10168480 3300026067 Bacteria 1870
162 Ga0207708_10121409 3300026075 Bacteria 2036
163 Ga0207702_10936331 3300026078 Bacteria 859
164 Ga0207641_11036302 3300026088 Bacteria 818
165 Ga0207648_10364430 3300026089 Bacteria 1304
166 Ga0207675_100073901 3300026118 Bacteria 3190
167 Ga0207675_100301079 3300026118 Bacteria 1562
168 Ga0207683_10011272 3300026121 Bacteria 7621
169 Ga0207683_10069571 3300026121 Bacteria 3109
170 Ga0207683_10127723 3300026121 Bacteria 2286
171 Ga0207683_10602332 3300026121 Bacteria 1017
172 Ga0209813_10001195 3300027866 Bacteria 5795
173 Ga0209813_10019127 3300027866 Bacteria 1900
174 Ga0207428_10003709 3300027907 Bacteria 14670
175 Ga0268265_10524718 3300028380 Bacteria 1120
176 Ga0265340_10000226 3300031247 Bacteria 28801
177 Ga0307513_10018418 3300031456 Bacteria 8342
178 Ga0307408_100959418 3300031548 Bacteria 786
179 Ga0307508_10012015 3300031616 Bacteria 7923
180 Ga0316575_10228448 3300031665 Bacteria 778
181 Ga0307405_10094031 3300031731 Bacteria 1993
182 Ga0307405_10124155 3300031731 Bacteria 1772
183 Ga0307405_10228477 3300031731 Bacteria 1370
184 Ga0307405_10478771 3300031731 Bacteria 993
185 Ga0307413_10597140 3300031824 Bacteria 903
186 Ga0307410_10041983 3300031852 Bacteria 3020
187 Ga0307410_10420258 3300031852 Bacteria 1084
188 Ga0307410_10613375 3300031852 Bacteria 909
189 Ga0307410_10714449 3300031852 Bacteria 846
190 Ga0307407_10044931 3300031903 Bacteria 2493
191 Ga0307412_10120668 3300031911 Bacteria 1887
192 Ga0307412_10988620 3300031911 Bacteria 743
193 Ga0307409_100072320 3300031995 Bacteria 2746
194 Ga0307409_100258171 3300031995 Bacteria 1597
195 Ga0307409_100284453 3300031995 Bacteria 1530
196 Ga0307409_100464713 3300031995 Bacteria 1224
197 Ga0307409_100675445 3300031995 Bacteria 1029
198 Ga0307416_100035130 3300032002 Bacteria 3824
199 Ga0307416_100042511 3300032002 Bacteria 3548
200 Ga0307416_100062307 3300032002 Bacteria 3049
201 Ga0307416_100469621 3300032002 Bacteria 1315
202 Ga0307414_10397708 3300032004 Bacteria 1196
203 Ga0307411_10601940 3300032005 Bacteria 945
204 Ga0307415_100081846 3300032126 Bacteria 2308
205 Ga0307415_100104160 3300032126 Bacteria 2090
206 Ga0307415_100168249 3300032126 Bacteria 1707
207 Ga0307415_100356487 3300032126 Bacteria 1233
208 Ga0307415_100724799 3300032126 Bacteria 900
209 Ga0373933_0487266 3300035724 Bacteria 807
210 Ga0373925_0173198 3300037068 Bacteria 1704
211 Ga0395900_0036034 3300037418 Bacteria 5098
212 Ga0395898_0081104 3300037466 Bacteria 3128
213 Ga0395905_0046636 3300037471 Bacteria 4064
214 Ga0395901_0445484 3300038443 Bacteria 1325
215 Ga0436363_1116670 3300039450 Bacteria 924
216 Ga0439465_0316911 3300041413 Bacteria 586
217 Ga0451791_0429948 3300041451 Bacteria 604
218 Ga0451791_0512520 3300041451 Bacteria 809
219 Ga0451797_0065225 3300041453 Bacteria 1577
220 Ga0451795_0523373 3300041456 Bacteria 1446
221 Ga0451833_0635419 3300041491 Bacteria 908
222 Ga0451837_0142596 3300041494 Bacteria 2531
223 Ga0451841_0069239 3300041498 Bacteria 1389
224 Ga0451845_0481619 3300041501 Bacteria 1164
225 Ga0451851_0308672 3300041507 Bacteria 633
226 Ga0451843_0574821 3300041509 Bacteria 1923
227 Ga0451853_1544006 3300041512 Bacteria 1465
228 Ga0451853_1801265 3300041512 Bacteria 612
229 Ga0439435_0317748 3300042436 Bacteria 536
230 Ga0466972_0320998 3300044658 Bacteria 724
231 Ga0466965_0052082 3300044683 Bacteria 2032
232 Ga0466966_0262567 3300044684 Bacteria 1040
233 Ga0466961_0054963 3300044693 Bacteria 2539
234 Ga0466961_0649114 3300044693 Bacteria 633
235 Ga0466963_0123229 3300044694 Bacteria 1785
236 Ga0466963_0190645 3300044694 Bacteria 1432
237 Ga0466964_0117199 3300044706 Bacteria 1195
238 Ga0466964_0465508 3300044706 Bacteria 673
239 Ga0466964_0621107 3300044706 Bacteria 595
240 Ga0466971_0399628 3300044719 Bacteria 670
241 Ga0466970_0715466 3300044765 Bacteria 584
242 Ga0466957_0035019 3300044842 Bacteria 3012
243 Ga0466957_1262059 3300044842 Bacteria 535
244 Ga0466960_0035189 3300044901 Bacteria 2339
245 Ga0466960_0040925 3300044901 Bacteria 2193
246 Ga0466960_0237517 3300044901 Bacteria 1008
247 Ga0466960_0620813 3300044901 Bacteria 643
248 Ga0466960_0685984 3300044901 Bacteria 613
249 Ga0466958_0045629 3300045836 Bacteria 2644
250 Ga0466967_0063930 3300045976 Bacteria 3271
251 Ga0466967_0385094 3300045976 Bacteria 1362
252 Ga0466967_2487856 3300045976 Bacteria 513
253 Ga0495641_0417243 3300046461 Bacteria 609
254 Ga0495586_0413208 3300046535 Bacteria 777
255 Ga0495658_0307203 3300046683 Bacteria 1004
256 Ga0495658_0436807 3300046683 Bacteria 836
257 Ga0495670_0566672 3300046691 Bacteria 618
258 Ga0495680_0384418 3300047322 Bacteria 972
259 Ga0496100_0062555 3300048903 Bacteria 2457
260 Ga0496100_0672077 3300048903 Bacteria 807
261 Ga0496101_0134631 3300048904 Bacteria 1879
262 Ga0496101_0451094 3300048904 Bacteria 1015
263 Ga0496102_0007593 3300048905 Bacteria 9264
264 Ga0496102_0015032 3300048905 Bacteria 6737
265 Ga0496102_0077273 3300048905 Bacteria 3064
266 Ga0496102_0240099 3300048905 Bacteria 1709
267 Ga0496102_0875663 3300048905 Bacteria 820
268 Ga0496103_0862014 3300048906 Bacteria 569
269 Ga0496104_0004379 3300048907 Bacteria 12297
270 Ga0496105_0002817 3300048908 Bacteria 12708
271 Ga0496105_0044193 3300048908 Bacteria 3674
272 Ga0496106_0909779 3300048909 Bacteria 694
273 Ga0496107_0017345 3300048910 Bacteria 5063
274 Ga0496107_0282786 3300048910 Bacteria 1235
275 Ga0496108_0086138 3300048911 Bacteria 2667
276 Ga0496108_0111405 3300048911 Bacteria 2341
277 Ga0496108_0254048 3300048911 Bacteria 1529
278 Ga0496108_0343680 3300048911 Bacteria 1302
279 Ga0496109_0011043 3300048912 Bacteria 7744
280 Ga0496109_0020808 3300048912 Bacteria 5796
281 Ga0496109_0037023 3300048912 Bacteria 4407
282 Ga0496109_0253832 3300048912 Bacteria 1656
283 Ga0496109_0695212 3300048912 Bacteria 954
284 Ga0496109_0906569 3300048912 Bacteria 819
285 Ga0496110_0003350 3300048913 Bacteria 12248
286 Ga0496110_0156680 3300048913 Bacteria 2063
287 Ga0496110_0307924 3300048913 Bacteria 1443
288 Ga0496111_0000864 3300048914 Bacteria 16432
289 Ga0496111_0074146 3300048914 Bacteria 2478
290 Ga0496111_0181025 3300048914 Bacteria 1567
291 Ga0496111_0393692 3300048914 Bacteria 1024
292 Ga0496111_0615502 3300048914 Bacteria 794
293 Ga0496112_0373811 3300048915 Bacteria 1367
294 Ga0496112_1024547 3300048915 Bacteria 745
295 Ga0496113_0219419 3300048916 Bacteria 1515
296 Ga0496114_0003096 3300048917 Bacteria 12748
297 Ga0496114_0054224 3300048917 Bacteria 3343
298 Ga0496114_0103104 3300048917 Bacteria 2438
299 Ga0496114_0286406 3300048917 Bacteria 1453
300 Ga0496114_0337022 3300048917 Bacteria 1333
301 Ga0496118_0034158 3300048921 Bacteria 4156
302 Ga0496118_0094034 3300048921 Bacteria 2051
303 Ga0496118_0436639 3300048921 Bacteria 669
304 Ga0496124_0076167 3300048927 Bacteria 2770
305 Ga0496124_0196331 3300048927 Bacteria 1539
306 Ga0501317_054478 3300049533 Bacteria 643
307 Ga0501325_007542 3300049541 Bacteria 923
308 Ga0501031_0063343 3300049568 Bacteria 2409
309 Ga0501031_0087866 3300049568 Bacteria 2027
310 Ga0501031_0177073 3300049568 Bacteria 1393
311 Ga0501031_0631344 3300049568 Bacteria 689
312 Ga0501034_0017477 3300049571 Bacteria 7356
313 Ga0501034_0018380 3300049571 Bacteria 7168
314 Ga0501036_0199225 3300049572 Bacteria 1684
315 Ga0501036_0267488 3300049572 Bacteria 1432
316 Ga0501036_1164758 3300049572 Bacteria 629
317 Ga0501037_0118142 3300049573 Bacteria 1908
318 Ga0501037_0181388 3300049573 Bacteria 1494
319 Ga0501038_0054978 3300049574 Bacteria 3422
320 Ga0501038_0126369 3300049574 Bacteria 2104
321 Ga0501038_0177916 3300049574 Bacteria 1718
322 Ga0501039_0014400 3300049575 Bacteria 6058
323 Ga0501039_0066683 3300049575 Bacteria 2794
324 Ga0501039_0152443 3300049575 Bacteria 1816
325 Ga0501040_0102207 3300049576 Bacteria 2000
326 Ga0501040_0310254 3300049576 Bacteria 1128
327 Ga0501040_0331391 3300049576 Bacteria 1089
328 Ga0501040_0424816 3300049576 Bacteria 955
329 Ga0501041_0028345 3300049577 Bacteria 3378
330 Ga0501041_0073580 3300049577 Bacteria 2100
331 Ga0501041_0389013 3300049577 Bacteria 883
332 Ga0501042_0059221 3300049578 Bacteria 2735
333 Ga0501042_0129022 3300049578 Bacteria 1822
334 Ga0501042_0450166 3300049578 Bacteria 934
335 Ga0501046_0279247 3300049580 Bacteria 1224
336 Ga0501046_0761684 3300049580 Bacteria 680
337 Ga0501046_0937972 3300049580 Bacteria 603
338 Ga0501047_0157515 3300049581 Bacteria 2144
339 Ga0501048_0531886 3300049582 Bacteria 843
340 Ga0501048_0921711 3300049582 Bacteria 628
341 Ga0501067_0000467 3300049583 Bacteria 22014
342 Ga0501067_0000635 3300049583 Bacteria 18888
343 Ga0501067_0042974 3300049583 Bacteria 2510
344 Ga0501067_0140125 3300049583 Bacteria 1347
345 Ga0501068_0004682 3300049584 Bacteria 7451
346 Ga0501068_0107373 3300049584 Bacteria 1733
347 Ga0501069_0109422 3300049585 Bacteria 1573
348 Ga0501069_0130895 3300049585 Bacteria 1436
349 Ga0501069_0229285 3300049585 Bacteria 1081
350 Ga0501070_0007120 3300049586 Bacteria 9498
351 Ga0501070_0007425 3300049586 Bacteria 9308
352 Ga0501070_0178255 3300049586 Bacteria 1749
353 Ga0501070_0209658 3300049586 Bacteria 1599
354 Ga0501071_0058747 3300049587 Bacteria 2781
355 Ga0501071_0264013 3300049587 Bacteria 1301
356 Ga0501071_0351539 3300049587 Bacteria 1122
357 Ga0501071_0950461 3300049587 Bacteria 663
358 Ga0501072_0061113 3300049588 Bacteria 2970
359 Ga0501072_0078375 3300049588 Bacteria 2616
360 Ga0501072_0138902 3300049588 Bacteria 1937
361 Ga0501073_0003593 3300049589 Bacteria 11658
362 Ga0501073_0005531 3300049589 Bacteria 9460
363 Ga0501074_0008029 3300049590 Bacteria 7643
364 Ga0501074_0443248 3300049590 Bacteria 921
365 Ga0501074_0478002 3300049590 Bacteria 883
366 Ga0501075_0031091 3300049591 Bacteria 3961
367 Ga0501075_0166721 3300049591 Bacteria 1681
368 Ga0501075_0963150 3300049591 Bacteria 648
369 Ga0501076_0136401 3300049592 Bacteria 1992
370 Ga0501076_0222123 3300049592 Bacteria 1544
371 Ga0501076_0410103 3300049592 Bacteria 1114
372 Ga0501077_0008175 3300049593 Bacteria 6468
373 Ga0501077_0122930 3300049593 Bacteria 1645
374 Ga0501079_0018882 3300049741 Bacteria 5269
375 Ga0501079_0045291 3300049741 Bacteria 3395
376 Ga0501079_0181227 3300049741 Bacteria 1644
377 Ga0501079_0392936 3300049741 Bacteria 1088
378 Ga0501080_0006193 3300049742 Bacteria 10736
379 Ga0501080_0012953 3300049742 Bacteria 7656
380 Ga0501080_0275950 3300049742 Bacteria 1529
381 Ga0501081_0667468 3300049743 Bacteria 780
382 Ga0501083_0011647 3300049744 Bacteria 6170
383 Ga0501083_0023940 3300049744 Bacteria 4234
384 Ga0501035_0106297 3300049822 Bacteria 2461
385 Ga0501035_0320114 3300049822 Bacteria 1303
386 Ga0501035_1204896 3300049822 Bacteria 587
387 Ga0501044_0346509 3300049823 Bacteria 1406
388 Ga0501045_0084179 3300049824 Bacteria 2346
389 Ga0501045_0105702 3300049824 Bacteria 2086
390 Ga0501045_0380429 3300049824 Bacteria 1051
391 Ga0501045_0431668 3300049824 Bacteria 980
392 Ga0501045_0515835 3300049824 Bacteria 887
393 nmdc:mga03683_15461_c1 3300050489 Bacteria 2848
394 nmdc:mga03683_254488_c1 3300050489 Bacteria 816
395 nmdc:mga03n38_135589_c1 3300050490 Bacteria 1224
396 nmdc:mga03n38_24077_c1 3300050490 Bacteria 2486
397 nmdc:mga00v17_209185_c1 3300050491 Bacteria 1262
398 nmdc:mga00v17_25332_c1 3300050491 Bacteria 3448
399 nmdc:mga00v17_307779_c1 3300050491 Bacteria 1029
400 nmdc:mga00v17_46119_c1 3300050491 Bacteria 2636
401 nmdc:mga00v17_620485_c1 3300050491 Bacteria 696
402 nmdc:mga0yw44_106293_c1 3300050492 Bacteria 1794
403 nmdc:mga0yw44_308313_c1 3300050492 Bacteria 1062
404 nmdc:mga0yw44_465625_c1 3300050492 Bacteria 857
405 nmdc:mga0yw44_472842_c1 3300050492 Bacteria 850
406 nmdc:mga0yw44_74323_c1 3300050492 Bacteria 2117
407 nmdc:mga0yw44_76848_c1 3300050492 Bacteria 2085
408 nmdc:mga06z11_159571_c1 3300050494 Bacteria 1288
409 nmdc:mga06z11_160784_c1 3300050494 Bacteria 1284
410 nmdc:mga06z11_6598_c1 3300050494 Bacteria 4738
411 nmdc:mga04h51_22242_c1 3300050495 Bacteria 1917
412 nmdc:mga04h51_6076_c1 3300050495 Bacteria 3113
413 nmdc:mga05p37_155935_c1 3300050507 Bacteria 2790
414 nmdc:mga05p37_399_c1 3300050507 Bacteria 47170
415 nmdc:mga09592_4514_c1 3300050508 Bacteria 11263
416 nmdc:mga09592_958837_c1 3300050508 Bacteria 717
417 nmdc:mga0qj67_9192_c1 3300050509 Bacteria 7340
418 nmdc:mga06r32_350_c1 3300050510 Bacteria 38442
419 nmdc:mga06r32_4927_c1 3300050510 Bacteria 12032
420 nmdc:mga08y16_387405_c1 3300050511 Bacteria 1432
421 nmdc:mga08y16_6953_c1 3300050511 Bacteria 11860
422 Ga0495655_0000724 3300053083 Bacteria 5289
423 Ga0495619_0014336 3300053085 Bacteria 5007
424 Ga0500641_0005630 3300053096 Bacteria 4439
425 Ga0500556_0000823 3300053104 Bacteria 17936
426 Ga0500593_000350 3300053117 Bacteria 18674
427 Ga0500559_0183573 3300053136 Bacteria 985
428 Ga0500573_0011860 3300053140 Bacteria 4885
429 Ga0501084_0121885 3300054114 Bacteria 2192
430 Ga0501084_0137138 3300054114 Bacteria 2060
431 Ga0501084_0161642 3300054114 Bacteria 1889
432 Ga0501084_0261815 3300054114 Bacteria 1460
433 Ga0501084_0463760 3300054114 Bacteria 1071
434 Ga0587128_028434 3300059630 Bacteria 910
435 Ga0587069_079962 3300059642 Bacteria 636
436 Ga0501082_0023824 3300060353 Bacteria 5278
437 Ga0501082_0030721 3300060353 Bacteria 4630
438 Ga0501082_0066871 3300060353 Bacteria 3095
439 Ga0466962_0016215 3300061719 Bacteria 3594
440 Ga0466962_0311118 3300061719 Bacteria 780
441 Ga0530510_0068010 3300061734 Bacteria 2585
442 Ga0530510_0127571 3300061734 Bacteria 1870
443 Ga0530510_0726858 3300061734 Bacteria 757
444 2644230299 2643221641 Bacteria 4490190
445 2644089439 2643221615 Bacteria 5487866
446 2644319284 2643221657 Bacteria 5490246
447 2689962752 2687453737 Bacteria 11203906
448 2740169030 2739367898 Bacteria 4367674
449 2855387924 2855386786 Bacteria 4752232
450 2855686068 2855683550 Bacteria 7134265
451 2868088681 2868088558 Bacteria 7609351
452 2887446422 2887443736 Bacteria 4426037
453 2919051581 2919051321 Bacteria 4210889
454 8054611140 8054609563 Bacteria 5170090
455 8056064857 8056060235 Bacteria 7259403
456 LJQas_1001443
457 LJQas_1022335
458 JGI25406J46586_10002944
459 Ga0070658_10050484
460 Ga0070683_100910868
461 Ga0068869_100191661
462 Ga0070666_10368600
463 Ga0070680_100083989
464 Ga0070680_100369031
465 Ga0070682_100145659
466 Ga0070660_100157641
467 Ga0070668_100370279
468 Ga0070674_100037832
469 Ga0070688_100714949
470 Ga0070659_100570507
471 Ga0070667_100067477
472 Ga0070667_100167213
473 Ga0070708_100455238
474 Ga0070663_100416622
475 Ga0070678_100053658
476 Ga0070681_10051800
477 Ga0070685_10038241
478 Ga0070698_100010433
479 Ga0070679_100013115
480 Ga0070684_100196260
481 Ga0070684_100752783
482 Ga0070684_100986205
483 Ga0070684_101475258
484 Ga0070702_100609091
485 Ga0070702_100829102
486 Ga0068866_10304824
487 Ga0068860_100000560
488 Ga0068862_100939827
489 Ga0081455_10000427
490 Ga0081455_10029881
491 Ga0081538_10023373
492 Ga0081539_10002050
493 Ga0075365_10005743
494 Ga0075365_10009542
495 Ga0075365_10071951
496 Ga0075365_10101194
497 Ga0075365_10224105
498 Ga0075365_10515227
499 Ga0075365_10555922
500 Ga0075368_10007197
501 Ga0075368_10045427
502 Ga0075363_100012711
503 Ga0075363_100017891
504 Ga0075363_100104342
505 Ga0075363_100202980
506 Ga0075363_100401062
507 Ga0075364_10011060
508 Ga0075364_10130539
509 Ga0075364_10264302
510 Ga0075364_10412737
511 Ga0075362_10003023
512 Ga0075367_10050833
513 Ga0075367_10211151
514 Ga0097621_100323583
515 Ga0097621_101403292
516 Ga0075370_10009077
517 Ga0068871_100697698
518 Ga0075428_100019842
519 Ga0075430_100134817
520 Ga0075431_100000141
521 Ga0075431_100005558
522 Ga0075429_100002915
523 Ga0075429_100396186
524 Ga0068865_100121496
525 Ga0105244_10184726
526 Ga0111539_10009204
527 Ga0111539_10055055
528 Ga0111539_10426567
529 Ga0105245_10004822
530 Ga0105245_10013771
531 Ga0105245_10447238
532 Ga0105245_10514225
533 Ga0114129_10013785
534 Ga0105243_10002326
535 Ga0105243_10032091
536 Ga0105243_10178206
537 Ga0105243_10656290
538 Ga0105243_10663457
539 Ga0105242_10059599
540 Ga0105242_10069057
541 Ga0105242_10389409
542 Ga0105242_10398804
543 Ga0105248_10000876
544 Ga0105248_10046619
545 Ga0105237_10023116
546 Ga0105238_10089410
547 Ga0105249_10025236
548 Ga0105249_10177988
549 Ga0105249_12437828
550 Ga0105246_10002456
551 Ga0105246_10020334
552 Ga0105246_10372200
553 Ga0105246_10688962
554 Ga0105246_11289134
555 Ga0105246_12580505
556 Ga0157369_10020131
557 Ga0157369_10532189
558 Ga0157369_11659858
559 Ga0157369_12181753
560 Ga0157374_10057327
561 Ga0157374_11522058
562 Ga0163162_10245358
563 Ga0163162_10740660
564 Ga0157372_10002563
565 Ga0157372_10595885
566 Ga0157372_12006860
567 Ga0157375_10007927
568 Ga0157375_10021292
569 Ga0157375_10033031
570 Ga0157375_10571990
571 Ga0157375_11173710
572 Ga0163163_10025600
573 Ga0163163_10090943
574 Ga0163163_10092074
575 Ga0163163_10126900
576 Ga0157380_10011577
577 Ga0157380_10198069
578 Ga0157380_11286423
579 Ga0157377_10005040
580 Ga0157377_10384669
581 Ga0157379_10009270
582 Ga0157376_10409993
583 Ga0163161_10573456
584 Ga0197907_10096826
585 Ga0213874_10233119
586 Ga0224712_10014536
587 Ga0207642_10203101
588 Ga0207710_10029475
589 Ga0207688_10198432
590 Ga0207680_10131431
591 Ga0207647_10021359
592 Ga0207705_10083401
593 Ga0207707_10410590
594 Ga0207671_10058142
595 Ga0207660_10196693
596 Ga0207660_10294229
597 Ga0207662_10158078
598 Ga0207657_10136853
599 Ga0207649_10086677
600 Ga0207659_10062605
601 Ga0207687_10682332
602 Ga0207709_10184872
603 Ga0207709_10423915
604 Ga0207709_11208786
605 Ga0207669_10668780
606 Ga0207704_10090873
607 Ga0207691_10069627
608 Ga0207711_10003792
609 Ga0207661_10002795
610 Ga0207661_10166492
611 Ga0207679_11065375
612 Ga0207658_10080775
613 Ga0207658_10178730
614 Ga0207703_10012091
615 Ga0207703_10191051
616 Ga0207678_10168480
617 Ga0207708_10121409
618 Ga0207702_10936331
619 Ga0207641_11036302
620 Ga0207648_10364430
621 Ga0207675_100073901
622 Ga0207675_100301079
623 Ga0207683_10011272
624 Ga0207683_10069571
625 Ga0207683_10127723
626 Ga0207683_10602332
627 Ga0209813_10001195
628 Ga0209813_10019127
629 Ga0207428_10003709
630 Ga0268265_10524718
631 Ga0265340_10000226
632 Ga0307513_10018418
633 Ga0307408_100959418
634 Ga0307508_10012015
635 Ga0316575_10228448
636 Ga0307405_10094031
637 Ga0307405_10124155
638 Ga0307405_10228477
639 Ga0307405_10478771
640 Ga0307413_10597140
641 Ga0307410_10041983
642 Ga0307410_10420258
643 Ga0307410_10613375
644 Ga0307410_10714449
645 Ga0307407_10044931
646 Ga0307412_10120668
647 Ga0307412_10988620
648 Ga0307409_100072320
649 Ga0307409_100258171
650 Ga0307409_100284453
651 Ga0307409_100464713
652 Ga0307409_100675445
653 Ga0307416_100035130
654 Ga0307416_100042511
655 Ga0307416_100062307
656 Ga0307416_100469621
657 Ga0307414_10397708
658 Ga0307411_10601940
659 Ga0307415_100081846
660 Ga0307415_100104160
661 Ga0307415_100168249
662 Ga0307415_100356487
663 Ga0307415_100724799
664 Ga0373933_0487266
665 Ga0373925_0173198
666 Ga0395900_0036034
667 Ga0395898_0081104
668 Ga0395905_0046636
669 Ga0395901_0445484
670 Ga0436363_1116670
671 Ga0439465_0316911
672 Ga0451791_0429948
673 Ga0451791_0512520
674 Ga0451797_0065225
675 Ga0451795_0523373
676 Ga0451833_0635419
677 Ga0451837_0142596
678 Ga0451841_0069239
679 Ga0451845_0481619
680 Ga0451851_0308672
681 Ga0451843_0574821
682 Ga0451853_1544006
683 Ga0451853_1801265
684 Ga0439435_0317748
685 Ga0466972_0320998
686 Ga0466965_0052082
687 Ga0466966_0262567
688 Ga0466961_0054963
689 Ga0466961_0649114
690 Ga0466963_0123229
691 Ga0466963_0190645
692 Ga0466964_0117199
693 Ga0466964_0465508
694 Ga0466964_0621107
695 Ga0466971_0399628
696 Ga0466970_0715466
697 Ga0466957_0035019
698 Ga0466957_1262059
699 Ga0466960_0035189
700 Ga0466960_0040925
701 Ga0466960_0237517
702 Ga0466960_0620813
703 Ga0466960_0685984
704 Ga0466958_0045629
705 Ga0466967_0063930
706 Ga0466967_0385094
707 Ga0466967_2487856
708 Ga0495641_0417243
709 Ga0495586_0413208
710 Ga0495658_0307203
711 Ga0495658_0436807
712 Ga0495670_0566672
713 Ga0495680_0384418
714 Ga0496100_0062555
715 Ga0496100_0672077
716 Ga0496101_0134631
717 Ga0496101_0451094
718 Ga0496102_0007593
719 Ga0496102_0015032
720 Ga0496102_0077273
721 Ga0496102_0240099
722 Ga0496102_0875663
723 Ga0496103_0862014
724 Ga0496104_0004379
725 Ga0496105_0002817
726 Ga0496105_0044193
727 Ga0496106_0909779
728 Ga0496107_0017345
729 Ga0496107_0282786
730 Ga0496108_0086138
731 Ga0496108_0111405
732 Ga0496108_0254048
733 Ga0496108_0343680
734 Ga0496109_0011043
735 Ga0496109_0020808
736 Ga0496109_0037023
737 Ga0496109_0253832
738 Ga0496109_0695212
739 Ga0496109_0906569
740 Ga0496110_0003350
741 Ga0496110_0156680
742 Ga0496110_0307924
743 Ga0496111_0000864
744 Ga0496111_0074146
745 Ga0496111_0181025
746 Ga0496111_0393692
747 Ga0496111_0615502
748 Ga0496112_0373811
749 Ga0496112_1024547
750 Ga0496113_0219419
751 Ga0496114_0003096
752 Ga0496114_0054224
753 Ga0496114_0103104
754 Ga0496114_0286406
755 Ga0496114_0337022
756 Ga0496118_0034158
757 Ga0496118_0094034
758 Ga0496118_0436639
759 Ga0496124_0076167
760 Ga0496124_0196331
761 Ga0501317_054478
762 Ga0501325_007542
763 Ga0501031_0063343
764 Ga0501031_0087866
765 Ga0501031_0177073
766 Ga0501031_0631344
767 Ga0501034_0017477
768 Ga0501034_0018380
769 Ga0501036_0199225
770 Ga0501036_0267488
771 Ga0501036_1164758
772 Ga0501037_0118142
773 Ga0501037_0181388
774 Ga0501038_0054978
775 Ga0501038_0126369
776 Ga0501038_0177916
777 Ga0501039_0014400
778 Ga0501039_0066683
779 Ga0501039_0152443
780 Ga0501040_0102207
781 Ga0501040_0310254
782 Ga0501040_0331391
783 Ga0501040_0424816
784 Ga0501041_0028345
785 Ga0501041_0073580
786 Ga0501041_0389013
787 Ga0501042_0059221
788 Ga0501042_0129022
789 Ga0501042_0450166
790 Ga0501046_0279247
791 Ga0501046_0761684
792 Ga0501046_0937972
793 Ga0501047_0157515
794 Ga0501048_0531886
795 Ga0501048_0921711
796 Ga0501067_0000467
797 Ga0501067_0000635
798 Ga0501067_0042974
799 Ga0501067_0140125
800 Ga0501068_0004682
801 Ga0501068_0107373
802 Ga0501069_0109422
803 Ga0501069_0130895
804 Ga0501069_0229285
805 Ga0501070_0007120
806 Ga0501070_0007425
807 Ga0501070_0178255
808 Ga0501070_0209658
809 Ga0501071_0058747
810 Ga0501071_0264013
811 Ga0501071_0351539
812 Ga0501071_0950461
813 Ga0501072_0061113
814 Ga0501072_0078375
815 Ga0501072_0138902
816 Ga0501073_0003593
817 Ga0501073_0005531
818 Ga0501074_0008029
819 Ga0501074_0443248
820 Ga0501074_0478002
821 Ga0501075_0031091
822 Ga0501075_0166721
823 Ga0501075_0963150
824 Ga0501076_0136401
825 Ga0501076_0222123
826 Ga0501076_0410103
827 Ga0501077_0008175
828 Ga0501077_0122930
829 Ga0501079_0018882
830 Ga0501079_0045291
831 Ga0501079_0181227
832 Ga0501079_0392936
833 Ga0501080_0006193
834 Ga0501080_0012953
835 Ga0501080_0275950
836 Ga0501081_0667468
837 Ga0501083_0011647
838 Ga0501083_0023940
839 Ga0501035_0106297
840 Ga0501035_0320114
841 Ga0501035_1204896
842 Ga0501044_0346509
843 Ga0501045_0084179
844 Ga0501045_0105702
845 Ga0501045_0380429
846 Ga0501045_0431668
847 Ga0501045_0515835
848 nmdc:mga03683_15461_c1
849 nmdc:mga03683_254488_c1
850 nmdc:mga03n38_135589_c1
851 nmdc:mga03n38_24077_c1
852 nmdc:mga00v17_209185_c1
853 nmdc:mga00v17_25332_c1
854 nmdc:mga00v17_307779_c1
855 nmdc:mga00v17_46119_c1
856 nmdc:mga00v17_620485_c1
857 nmdc:mga0yw44_106293_c1
858 nmdc:mga0yw44_308313_c1
859 nmdc:mga0yw44_465625_c1
860 nmdc:mga0yw44_472842_c1
861 nmdc:mga0yw44_74323_c1
862 nmdc:mga0yw44_76848_c1
863 nmdc:mga06z11_159571_c1
864 nmdc:mga06z11_160784_c1
865 nmdc:mga06z11_6598_c1
866 nmdc:mga04h51_22242_c1
867 nmdc:mga04h51_6076_c1
868 nmdc:mga05p37_155935_c1
869 nmdc:mga05p37_399_c1
870 nmdc:mga09592_4514_c1
871 nmdc:mga09592_958837_c1
872 nmdc:mga0qj67_9192_c1
873 nmdc:mga06r32_350_c1
874 nmdc:mga06r32_4927_c1
875 nmdc:mga08y16_387405_c1
876 nmdc:mga08y16_6953_c1
877 Ga0495655_0000724
878 Ga0495619_0014336
879 Ga0500641_0005630
880 Ga0500556_0000823
881 Ga0500593_000350
882 Ga0500559_0183573
883 Ga0500573_0011860
884 Ga0501084_0121885
885 Ga0501084_0137138
886 Ga0501084_0161642
887 Ga0501084_0261815
888 Ga0501084_0463760
889 Ga0587128_028434
890 Ga0587069_079962
891 Ga0501082_0023824
892 Ga0501082_0030721
893 Ga0501082_0066871
894 Ga0466962_0016215
895 Ga0466962_0311118
896 Ga0530510_0068010
897 Ga0530510_0127571
898 Ga0530510_0726858
899 2644230299
900 2644089439
901 2644319284
902 2689962752
903 2740169030
904 2855387924
905 2855686068
906 2868088681
907 2887446422
908 2919051581
909 8054611140
910 8056064857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

43

174

0.95

PF22769

DCD

dCTP deaminase-like

57

149

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.9537 13 140
1sm8-assembly1.cif.gz_C m. tuberculosis dutpase complexed with chromium and dutp 0.9494 13 141
1slh-assembly1.cif.gz_B mycobacterium tuberculosis dutpase complexed with magnesium and dudp 0.9459 14 140
1sm8-assembly1.cif.gz_C m. tuberculosis dutpase complexed with chromium and dutp 0.9423 13 141
1six-assembly1.cif.gz_A mycobacterium tuberculosis dutpase complexed with magnesium and alpha,beta-imido-dutp 0.9404 13 150
ID Description Score Start End Superfamily
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9473 13 141 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9402 13 141 2.70.40.10
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9327 13 151 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9152 15 142 2.70.40.10
5y5qC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9116 15 133 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A4Q4CWT9-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9711 13 121 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A3N5L877-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9677 14 124 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A0R2QXH6-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9674 13 141 GO:0000287
GO:0004170
GO:0006226
GO:0016020
GO:0046081
AF-X1TBK2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9655 13 133 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-X0ZBN9-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9645 13 132 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map