F447570

General Info

Members Datasets Scaffolds Average Seq Length
455 255 910 100

Family's Representative Sequence

Representative Sequence 3300009979|Ga0105032_103276|Ga0105032_1032762
Length 122
Sequence MAVCSRRGRSVVDYDFVSWRNSEMQADIFRALGNEKRLQILEWLKDPRAHFPPQVDGDLVEDGVCGLFIADKLGVSPSTLSEHMRILTATGLVRAARIKQWTFYRRDEARLAEVAEALRRAL

Samples

Sample ID Description Type Environment
1 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
103 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
104 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
105 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.91
Nodule 1.54
Rhizoplane 1.76
Rhizosphere 86.15
Stem 0
Stem Tuber 0
Unclassified 6.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105032_103276 3300009979 Bacteria 1411
2 JGI25406J46586_10014024 3300003203 Bacteria 3418
3 Ga0065707_10038602 3300005295 Bacteria 1197
4 Ga0070676_10286926 3300005328 Bacteria 1111
5 Ga0070690_100031315 3300005330 Bacteria 3312
6 Ga0068869_100104715 3300005334 Bacteria 2145
7 Ga0068869_100108915 3300005334 Bacteria 2105
8 Ga0068868_100120157 3300005338 Bacteria 2143
9 Ga0070689_100000723 3300005340 Bacteria 20133
10 Ga0070689_100959854 3300005340 Bacteria 759
11 Ga0070687_100024863 3300005343 Bacteria 2866
12 Ga0070661_101776179 3300005344 Bacteria 523
13 Ga0070692_10148176 3300005345 Bacteria 1334
14 Ga0070668_100070205 3300005347 Bacteria 2726
15 Ga0070669_100137694 3300005353 Bacteria 1879
16 Ga0070669_100152994 3300005353 Bacteria 1787
17 Ga0070675_100109179 3300005354 Bacteria 2338
18 Ga0070674_100132451 3300005356 Bacteria 1860
19 Ga0070673_100025534 3300005364 Bacteria 4351
20 Ga0070688_100022467 3300005365 Bacteria 3697
21 Ga0070667_100132967 3300005367 Bacteria 2173
22 Ga0070703_10557790 3300005406 Bacteria 523
23 Ga0070714_100276685 3300005435 Bacteria 1558
24 Ga0070714_100290640 3300005435 Bacteria 1521
25 Ga0070713_101083277 3300005436 Bacteria 774
26 Ga0070710_10721724 3300005437 Bacteria 705
27 Ga0070701_10045384 3300005438 Bacteria 2254
28 Ga0070711_101812996 3300005439 Bacteria 535
29 Ga0070700_100091950 3300005441 Bacteria 1982
30 Ga0070694_101112669 3300005444 Bacteria 659
31 Ga0070708_101463766 3300005445 Unclassified 637
32 Ga0070678_100297385 3300005456 Bacteria 1371
33 Ga0070662_100089979 3300005457 Bacteria 2303
34 Ga0070681_11721086 3300005458 Bacteria 553
35 Ga0068867_100101750 3300005459 Bacteria 2195
36 Ga0068867_100137873 3300005459 Bacteria 1904
37 Ga0070706_100324924 3300005467 Bacteria 1435
38 Ga0070706_101388301 3300005467 Bacteria 643
39 Ga0070707_100004351 3300005468 Bacteria 13272
40 Ga0070698_100279254 3300005471 Bacteria 1602
41 Ga0070698_100534846 3300005471 Bacteria 1111
42 Ga0070698_100548367 3300005471 Bacteria 1095
43 Ga0070699_101570715 3300005518 Unclassified 603
44 Ga0070679_101315902 3300005530 Bacteria 668
45 Ga0070697_100233364 3300005536 Bacteria 1570
46 Ga0070697_100684781 3300005536 Bacteria 904
47 Ga0070697_101176604 3300005536 Bacteria 683
48 Ga0070697_101543190 3300005536 Bacteria 594
49 Ga0070672_100000068 3300005543 Bacteria 46728
50 Ga0070672_100193382 3300005543 Bacteria 1699
51 Ga0070672_100270024 3300005543 Bacteria 1436
52 Ga0070686_100158481 3300005544 Bacteria 1592
53 Ga0070696_100282918 3300005546 Bacteria 1265
54 Ga0070693_100786543 3300005547 Bacteria 704
55 Ga0070665_100078373 3300005548 Bacteria 3311
56 Ga0070665_100366214 3300005548 Bacteria 1448
57 Ga0070704_100927132 3300005549 Bacteria 785
58 Ga0070704_101370962 3300005549 Bacteria 648
59 Ga0068855_100546663 3300005563 Bacteria 1254
60 Ga0068857_102530890 3300005577 Unclassified 504
61 Ga0068854_100552488 3300005578 Bacteria 977
62 Ga0068856_100119318 3300005614 Bacteria 2639
63 Ga0068859_100142591 3300005617 Bacteria 2470
64 Ga0068859_100664701 3300005617 Bacteria 1133
65 Ga0068864_100143357 3300005618 Bacteria 2157
66 Ga0068864_100168940 3300005618 Bacteria 1993
67 Ga0068861_100021789 3300005719 Bacteria 4608
68 Ga0068861_101442929 3300005719 Bacteria 673
69 Ga0068870_10511697 3300005840 Bacteria 802
70 Ga0068863_100042799 3300005841 Bacteria 4302
71 Ga0068863_100910721 3300005841 Bacteria 880
72 Ga0068858_100000381 3300005842 Bacteria 46473
73 Ga0068858_100025532 3300005842 Bacteria 5497
74 Ga0068858_101082026 3300005842 Bacteria 787
75 Ga0068860_100232040 3300005843 Bacteria 1793
76 Ga0068862_100055695 3300005844 Bacteria 3387
77 Ga0068862_100806582 3300005844 Bacteria 917
78 Ga0068862_101050786 3300005844 Bacteria 807
79 Ga0081455_10000509 3300005937 Bacteria 50414
80 Ga0081455_10013983 3300005937 Bacteria 7889
81 Ga0081455_10389941 3300005937 Unclassified 970
82 Ga0081455_10544202 3300005937 Bacteria 769
83 Ga0081455_10649783 3300005937 Unclassified 679
84 Ga0081538_10043253 3300005981 Bacteria 2831
85 Ga0081539_10005556 3300005985 Bacteria 12775
86 Ga0081539_10023308 3300005985 Bacteria 4059
87 Ga0070717_10132853 3300006028 Bacteria 2142
88 Ga0075365_10882440 3300006038 Bacteria 631
89 Ga0075368_10016526 3300006042 Bacteria 2751
90 Ga0075364_10005897 3300006051 Bacteria 7157
91 Ga0075364_10208286 3300006051 Bacteria 1326
92 Ga0075432_10226896 3300006058 Bacteria 749
93 Ga0070716_100581159 3300006173 Bacteria 840
94 Ga0075362_10097462 3300006177 Bacteria 1371
95 Ga0075362_10317474 3300006177 Bacteria 775
96 Ga0075367_10001096 3300006178 Bacteria 11190
97 Ga0075367_10556682 3300006178 Bacteria 728
98 Ga0075366_10003558 3300006195 Bacteria 8239
99 Ga0075366_10412330 3300006195 Bacteria 832
100 Ga0097621_100427366 3300006237 Bacteria 1190
101 Ga0075370_10025304 3300006353 Bacteria 3282
102 Ga0075370_10025502 3300006353 Bacteria 3272
103 Ga0068871_100205728 3300006358 Bacteria 1701
104 Ga0075428_100048012 3300006844 Bacteria 4687
105 Ga0075428_100051761 3300006844 Bacteria 4503
106 Ga0075428_100149055 3300006844 Bacteria 2541
107 Ga0075428_100202246 3300006844 Bacteria 2147
108 Ga0075428_100387052 3300006844 Bacteria 1499
109 Ga0075428_100711500 3300006844 Bacteria 1070
110 Ga0075428_101034981 3300006844 Bacteria 868
111 Ga0075428_101297563 3300006844 Bacteria 766
112 Ga0075428_101963196 3300006844 Bacteria 607
113 Ga0075430_100106863 3300006846 Bacteria 2334
114 Ga0075430_100185911 3300006846 Unclassified 1728
115 Ga0075430_100220457 3300006846 Bacteria 1574
116 Ga0075430_101726868 3300006846 Bacteria 513
117 Ga0075431_100024741 3300006847 Bacteria 6156
118 Ga0075431_100037649 3300006847 Bacteria 4981
119 Ga0075431_100042422 3300006847 Bacteria 4692
120 Ga0075431_100068262 3300006847 Bacteria 3669
121 Ga0075431_100085923 3300006847 Bacteria 3247
122 Ga0075431_100169544 3300006847 Bacteria 2243
123 Ga0075431_100258492 3300006847 Bacteria 1768
124 Ga0075431_100289605 3300006847 Bacteria 1657
125 Ga0075431_100603937 3300006847 Bacteria 1081
126 Ga0075431_100664653 3300006847 Bacteria 1021
127 Ga0075433_10158118 3300006852 Bacteria 2016
128 Ga0075433_10205593 3300006852 Bacteria 1750
129 Ga0075433_10318679 3300006852 Bacteria 1376
130 Ga0075433_10385294 3300006852 Bacteria 1237
131 Ga0075433_10840460 3300006852 Bacteria 801
132 Ga0075433_10914475 3300006852 Unclassified 765
133 Ga0075433_11640243 3300006852 Bacteria 554
134 Ga0075434_100149227 3300006871 Bacteria 2358
135 Ga0075434_100191104 3300006871 Bacteria 2068
136 Ga0075434_100813728 3300006871 Bacteria 950
137 Ga0075434_100868093 3300006871 Bacteria 917
138 Ga0075434_100981901 3300006871 Bacteria 859
139 Ga0075434_101010136 3300006871 Bacteria 846
140 Ga0075429_100047403 3300006880 Bacteria 3738
141 Ga0075429_100049748 3300006880 Bacteria 3645
142 Ga0075429_100083906 3300006880 Bacteria 2777
143 Ga0075429_100564350 3300006880 Bacteria 997
144 Ga0075429_101528052 3300006880 Unclassified 581
145 Ga0068865_100033519 3300006881 Bacteria 3439
146 Ga0068865_100641682 3300006881 Bacteria 902
147 Ga0075436_100710833 3300006914 Bacteria 745
148 Ga0097620_100142591 3300006931 Bacteria 2470
149 Ga0097620_100664693 3300006931 Bacteria 1133
150 Ga0075435_100001849 3300007076 Bacteria 13741
151 Ga0075435_100039111 3300007076 Bacteria 3785
152 Ga0075435_100069461 3300007076 Bacteria 2873
153 Ga0099794_10261866 3300007265 Unclassified 893
154 Ga0099794_10269790 3300007265 Unclassified 879
155 Ga0099794_10318482 3300007265 Unclassified 807
156 Ga0105240_10450953 3300009093 Bacteria 1439
157 Ga0105240_12493170 3300009093 Unclassified 535
158 Ga0111539_10009648 3300009094 Bacteria 12185
159 Ga0111539_10014279 3300009094 Bacteria 9920
160 Ga0111539_10119575 3300009094 Bacteria 3087
161 Ga0111539_10532071 3300009094 Bacteria 1369
162 Ga0111539_13340790 3300009094 Bacteria 516
163 Ga0105245_10010282 3300009098 Bacteria 8146
164 Ga0105245_10655738 3300009098 Bacteria 1080
165 Ga0105245_11042641 3300009098 Bacteria 863
166 Ga0105245_12226749 3300009098 Bacteria 602
167 Ga0114129_10015907 3300009147 Bacteria 10702
168 Ga0114129_10028983 3300009147 Bacteria 7842
169 Ga0114129_10054143 3300009147 Bacteria 5626
170 Ga0114129_10071183 3300009147 Bacteria 4849
171 Ga0114129_10078211 3300009147 Bacteria 4601
172 Ga0114129_10151912 3300009147 Bacteria 3168
173 Ga0114129_10236705 3300009147 Bacteria 2456
174 Ga0114129_10452217 3300009147 Bacteria 1684
175 Ga0114129_10883351 3300009147 Bacteria 1134
176 Ga0114129_10997927 3300009147 Bacteria 1054
177 Ga0114129_11804570 3300009147 Unclassified 744
178 Ga0114129_12151562 3300009147 Bacteria 672
179 Ga0105243_10088153 3300009148 Bacteria 2549
180 Ga0105243_10931718 3300009148 Bacteria 866
181 Ga0105243_11975513 3300009148 Bacteria 617
182 Ga0105242_10345922 3300009176 Bacteria 1372
183 Ga0105242_13279748 3300009176 Bacteria 503
184 Ga0105248_10066263 3300009177 Bacteria 4055
185 Ga0105237_11063219 3300009545 Bacteria 816
186 Ga0105237_11561696 3300009545 Bacteria 667
187 Ga0105238_10250481 3300009551 Bacteria 1749
188 Ga0105249_10094044 3300009553 Bacteria 2809
189 Ga0105249_10703850 3300009553 Bacteria 1070
190 Ga0157374_11975675 3300013296 Bacteria 609
191 Ga0157378_11869244 3300013297 Bacteria 649
192 Ga0163162_10734096 3300013306 Bacteria 1108
193 Ga0163163_10814452 3300014325 Bacteria 997
194 Ga0157380_10003711 3300014326 Bacteria 10497
195 Ga0157380_10807903 3300014326 Bacteria 955
196 Ga0157377_10339754 3300014745 Bacteria 1004
197 Ga0157379_10125674 3300014968 Bacteria 2308
198 Ga0157379_11861233 3300014968 Bacteria 592
199 Ga0157379_12354407 3300014968 Bacteria 531
200 Ga0157379_12401685 3300014968 Bacteria 526
201 Ga0157376_10891964 3300014969 Bacteria 907
202 Ga0182006_1153351 3300015261 Bacteria 780
203 Ga0163161_10510306 3300017792 Bacteria 980
204 Ga0214544_1000011 3300021320 Bacteria 262952
205 Ga0214544_1025509 3300021320 Bacteria 2820
206 Ga0214542_1000009 3300021321 Bacteria 262861
207 Ga0214542_1030001 3300021321 Bacteria 2164
208 Ga0214545_1000007 3300021324 Bacteria 262984
209 Ga0214543_1000020 3300021327 Bacteria 262861
210 Ga0214543_1026316 3300021327 Bacteria 3154
211 Ga0213872_10045530 3300021361 Bacteria 1996
212 Ga0213874_10028872 3300021377 Bacteria 1588
213 Ga0213876_10001531 3300021384 Bacteria 14304
214 Ga0213876_10566012 3300021384 Bacteria 605
215 Ga0213875_10103769 3300021388 Bacteria 1327
216 Ga0213871_10024405 3300021441 Bacteria 1531
217 Ga0209564_1012825 3300025295 Bacteria 3615
218 Ga0209257_1041517 3300025304 Bacteria 1364
219 Ga0207645_10516756 3300025907 Bacteria 809
220 Ga0207645_10742321 3300025907 Bacteria 667
221 Ga0207643_10334515 3300025908 Bacteria 948
222 Ga0207643_10698737 3300025908 Bacteria 655
223 Ga0207684_10166987 3300025910 Bacteria 1897
224 Ga0207684_11494631 3300025910 Bacteria 550
225 Ga0207684_11534476 3300025910 Unclassified 541
226 Ga0207695_10198095 3300025913 Bacteria 1924
227 Ga0207695_10307793 3300025913 Bacteria 1475
228 Ga0207662_10003694 3300025918 Bacteria 7926
229 Ga0207652_11152096 3300025921 Bacteria 677
230 Ga0207646_10074889 3300025922 Bacteria 3024
231 Ga0207681_10299489 3300025923 Bacteria 1272
232 Ga0207681_10913131 3300025923 Bacteria 736
233 Ga0207659_10046117 3300025926 Bacteria 3076
234 Ga0207687_10003620 3300025927 Bacteria 10410
235 Ga0207687_10300702 3300025927 Bacteria 1292
236 Ga0207700_10879635 3300025928 Bacteria 802
237 Ga0207664_10034790 3300025929 Bacteria 3883
238 Ga0207664_10350372 3300025929 Bacteria 1307
239 Ga0207690_10850884 3300025932 Bacteria 755
240 Ga0207690_11537976 3300025932 Bacteria 556
241 Ga0207706_10028853 3300025933 Bacteria 4954
242 Ga0207686_10449907 3300025934 Unclassified 991
243 Ga0207709_10093667 3300025935 Bacteria 1970
244 Ga0207709_10679945 3300025935 Bacteria 822
245 Ga0207670_10000584 3300025936 Bacteria 20058
246 Ga0207670_10232539 3300025936 Bacteria 1416
247 Ga0207670_10425597 3300025936 Bacteria 1066
248 Ga0207669_10312853 3300025937 Bacteria 1198
249 Ga0207704_10048329 3300025938 Bacteria 2550
250 Ga0207704_10071870 3300025938 Bacteria 2197
251 Ga0207665_11246682 3300025939 Bacteria 593
252 Ga0207691_10000502 3300025940 Bacteria 38915
253 Ga0207691_10003878 3300025940 Bacteria 14517
254 Ga0207711_11479066 3300025941 Unclassified 622
255 Ga0207689_10124984 3300025942 Bacteria 2116
256 Ga0207689_10195661 3300025942 Bacteria 1668
257 Ga0207661_10756879 3300025944 Bacteria 894
258 Ga0207667_10484802 3300025949 Bacteria 1255
259 Ga0207651_10006217 3300025960 Bacteria 6220
260 Ga0207668_10973202 3300025972 Bacteria 757
261 Ga0207640_10384624 3300025981 Bacteria 1138
262 Ga0207677_10000011 3300026023 Bacteria 199704
263 Ga0207703_10000268 3300026035 Bacteria 58186
264 Ga0207703_10711740 3300026035 Bacteria 955
265 Ga0207678_10039785 3300026067 Bacteria 4079
266 Ga0207708_10038468 3300026075 Bacteria 3644
267 Ga0207702_11254420 3300026078 Bacteria 735
268 Ga0207641_10157289 3300026088 Bacteria 2063
269 Ga0207641_10245764 3300026088 Bacteria 1669
270 Ga0207641_10975059 3300026088 Bacteria 844
271 Ga0207648_10003047 3300026089 Bacteria 17711
272 Ga0207648_10109968 3300026089 Bacteria 2419
273 Ga0207648_11339345 3300026089 Bacteria 673
274 Ga0207676_10145720 3300026095 Bacteria 2034
275 Ga0207676_10859280 3300026095 Unclassified 888
276 Ga0207674_12104324 3300026116 Bacteria 528
277 Ga0207675_100048612 3300026118 Bacteria 3960
278 Ga0207675_100568823 3300026118 Bacteria 1134
279 Ga0207683_10057580 3300026121 Bacteria 3411
280 Ga0207698_12568460 3300026142 Unclassified 519
281 Ga0209588_1115214 3300027671 Unclassified 862
282 Ga0209813_10038997 3300027866 Bacteria 1438
283 Ga0207428_10000325 3300027907 Bacteria 61954
284 Ga0207428_10002886 3300027907 Bacteria 17031
285 Ga0207428_10274967 3300027907 Unclassified 1251
286 Ga0268266_10043527 3300028379 Bacteria 3838
287 Ga0268265_10269309 3300028380 Bacteria 1518
288 Ga0268264_10387792 3300028381 Bacteria 1339
289 Ga0268264_10553611 3300028381 Bacteria 1128
290 Ga0307515_10069975 3300028794 Bacteria 4785
291 Ga0265338_10561732 3300028800 Bacteria 798
292 Ga0265327_10021956 3300031251 Bacteria 3834
293 Ga0265316_10193670 3300031344 Bacteria 1509
294 Ga0307513_10130087 3300031456 Bacteria 2465
295 Ga0307513_10323276 3300031456 Bacteria 1300
296 Ga0307408_101976806 3300031548 Bacteria 560
297 Ga0307408_102105076 3300031548 Bacteria 544
298 Ga0316575_10027267 3300031665 Bacteria 2223
299 Ga0307405_11570875 3300031731 Bacteria 580
300 Ga0307413_10405263 3300031824 Bacteria 1070
301 Ga0307412_10585193 3300031911 Bacteria 943
302 Ga0307414_11243991 3300032004 Bacteria 690
303 Ga0307411_10561727 3300032005 Bacteria 975
304 Ga0316583_10153334 3300032133 Bacteria 802
305 Ga0373932_0300584 3300035112 Bacteria 599
306 Ga0373936_0252446 3300035113 Bacteria 788
307 Ga0373927_0084767 3300035695 Bacteria 2056
308 Ga0373933_0498071 3300035724 Bacteria 798
309 Ga0373937_0776587 3300036401 Unclassified 906
310 Ga0395900_0169843 3300037418 Bacteria 2221
311 Ga0395898_0988212 3300037466 Bacteria 778
312 Ga0395905_0005147 3300037471 Bacteria 13418
313 Ga0395905_0035712 3300037471 Bacteria 4667
314 Ga0395905_0435941 3300037471 Bacteria 1207
315 Ga0436364_1500858 3300037853 Bacteria 9053
316 Ga0436365_1079016 3300039437 Bacteria 14304
317 Ga0436365_1436809 3300039437 Bacteria 1228
318 Ga0436360_0053452 3300039438 Bacteria 1168
319 Ga0436360_0679260 3300039438 Bacteria 1712
320 Ga0436360_0684385 3300039438 Bacteria 1624
321 Ga0436360_0981885 3300039438 Bacteria 584
322 Ga0436360_1235609 3300039438 Bacteria 2354
323 Ga0436360_1248043 3300039438 Bacteria 987
324 Ga0436361_0378646 3300039447 Bacteria 83086
325 Ga0436361_0739483 3300039447 Bacteria 935
326 Ga0436363_0436132 3300039450 Bacteria 1614
327 Ga0436363_1381196 3300039450 Bacteria 881
328 Ga0439453_0129585 3300041408 Bacteria 585
329 Ga0439465_0011866 3300041413 Bacteria 2730
330 Ga0439445_0137126 3300042004 Bacteria 708
331 Ga0439432_036834 3300042006 Bacteria 1564
332 Ga0439435_0039879 3300042436 Bacteria 1310
333 Ga0466972_0000100 3300044658 Bacteria 76018
334 Ga0466972_0217345 3300044658 Bacteria 894
335 Ga0466965_0101829 3300044683 Bacteria 1469
336 Ga0466963_0260875 3300044694 Bacteria 1217
337 Ga0466971_0387602 3300044719 Bacteria 680
338 Ga0466957_0067883 3300044842 Bacteria 2200
339 Ga0466957_0723162 3300044842 Unclassified 704
340 Ga0466958_0018131 3300045836 Bacteria 4079
341 Ga0466967_0000216 3300045976 Bacteria 24536
342 Ga0466967_0100625 3300045976 Bacteria 2641
343 Ga0495584_0147324 3300046491 Bacteria 1196
344 Ga0495640_0072494 3300046533 Bacteria 2308
345 Ga0495659_0324767 3300046664 Bacteria 654
346 Ga0495659_0368958 3300046664 Bacteria 616
347 Ga0495659_0531310 3300046664 Bacteria 518
348 Ga0495669_0152486 3300046684 Bacteria 1094
349 Ga0495660_0178705 3300046810 Bacteria 1028
350 Ga0495636_0272577 3300047318 Bacteria 786
351 Ga0495675_0160236 3300047444 Bacteria 1386
352 Ga0495684_0877745 3300047471 Unclassified 580
353 Ga0496101_1278374 3300048904 Bacteria 574
354 Ga0496102_1673945 3300048905 Bacteria 554
355 Ga0496106_0303029 3300048909 Unclassified 1282
356 Ga0496108_1081344 3300048911 Bacteria 682
357 Ga0496109_0000170 3300048912 Bacteria 64299
358 Ga0496109_0062011 3300048912 Bacteria 3419
359 Ga0496114_1269018 3300048917 Unclassified 623
360 Ga0496115_0357552 3300048918 Bacteria 1190
361 Ga0501031_0430286 3300049568 Bacteria 853
362 Ga0501032_0082832 3300049569 Bacteria 2134
363 Ga0501036_0083437 3300049572 Bacteria 2701
364 Ga0501036_1226491 3300049572 Bacteria 611
365 Ga0501037_0026568 3300049573 Bacteria 4279
366 Ga0501038_0959007 3300049574 Bacteria 629
367 Ga0501040_0631655 3300049576 Bacteria 774
368 Ga0501043_0085980 3300049579 Bacteria 2471
369 Ga0501047_0198107 3300049581 Bacteria 1870
370 Ga0501067_0029030 3300049583 Bacteria 3066
371 Ga0501068_0459331 3300049584 Bacteria 824
372 Ga0501073_0204926 3300049589 Bacteria 1363
373 Ga0501076_1649347 3300049592 Bacteria 526
374 Ga0501080_0171274 3300049742 Bacteria 2002
375 Ga0501081_0339055 3300049743 Bacteria 1107
376 Ga0501083_0000238 3300049744 Bacteria 35376
377 Ga0501035_0158418 3300049822 Bacteria 1961
378 Ga0501044_0274259 3300049823 Bacteria 1621
379 Ga0501044_1066272 3300049823 Bacteria 678
380 Ga0501045_0485632 3300049824 Bacteria 918
381 nmdc:mga03683_155932_c1 3300050489 Bacteria 1032
382 nmdc:mga03683_98857_c1 3300050489 Bacteria 1281
383 nmdc:mga03n38_355179_c1 3300050490 Bacteria 798
384 nmdc:mga00v17_208577_c1 3300050491 Bacteria 1264
385 nmdc:mga00v17_870291_c1 3300050491 Unclassified 572
386 nmdc:mga0yw44_246137_c1 3300050492 Bacteria 1189
387 nmdc:mga0k408_146096_c1 3300050493 Bacteria 1408
388 nmdc:mga0k408_660875_c1 3300050493 Bacteria 614
389 nmdc:mga0k408_841_c1 3300050493 Bacteria 16934
390 nmdc:mga06z11_3624_c1 3300050494 Bacteria 5989
391 nmdc:mga06z11_512883_c1 3300050494 Bacteria 727
392 nmdc:mga04h51_11306_c1 3300050495 Bacteria 2474
393 nmdc:mga07m45_50202_c1 3300050496 Bacteria 2350
394 nmdc:mga07m45_9055_c2 3300050496 Bacteria 3287
395 nmdc:mga05p37_111722_c1 3300050507 Bacteria 3360
396 nmdc:mga05p37_123756_c1 3300050507 Bacteria 3177
397 nmdc:mga05p37_1370752_c1 3300050507 Bacteria 715
398 nmdc:mga05p37_17682_c1 3300050507 Bacteria 8601
399 nmdc:mga05p37_1873121_c1 3300050507 Unclassified 574
400 nmdc:mga05p37_202606_c1 3300050507 Unclassified 2402
401 nmdc:mga05p37_322520_c1 3300050507 Bacteria 1828
402 nmdc:mga05p37_506828_c1 3300050507 Bacteria 1384
403 nmdc:mga05p37_62340_c1 3300050507 Bacteria 4589
404 nmdc:mga05p37_661547_c1 3300050507 Bacteria 1168
405 nmdc:mga05p37_93363_c1 3300050507 Bacteria 3708
406 nmdc:mga09592_177571_c1 3300050508 Bacteria 1842
407 nmdc:mga09592_178939_c1 3300050508 Bacteria 1834
408 nmdc:mga09592_343668_c1 3300050508 Bacteria 1292
409 nmdc:mga09592_49179_c1 3300050508 Bacteria 3555
410 nmdc:mga09592_74034_c1 3300050508 Bacteria 2894
411 nmdc:mga09592_788656_c1 3300050508 Unclassified 804
412 nmdc:mga0qj67_286603_c1 3300050509 Bacteria 1335
413 nmdc:mga0qj67_326880_c1 3300050509 Bacteria 1241
414 nmdc:mga0qj67_924401_c1 3300050509 Unclassified 687
415 nmdc:mga06r32_1027037_c1 3300050510 Bacteria 776
416 nmdc:mga06r32_1208680_c1 3300050510 Bacteria 702
417 nmdc:mga06r32_1503771_c1 3300050510 Bacteria 613
418 nmdc:mga06r32_166753_c1 3300050510 Bacteria 2186
419 nmdc:mga06r32_202570_c1 3300050510 Unclassified 1972
420 nmdc:mga06r32_235045_c1 3300050510 Bacteria 1820
421 nmdc:mga06r32_46781_c1 3300050510 Bacteria 4129
422 nmdc:mga06r32_550467_c1 3300050510 Bacteria 1128
423 nmdc:mga06r32_662883_c1 3300050510 Bacteria 1011
424 nmdc:mga06r32_913687_c1 3300050510 Bacteria 834
425 nmdc:mga06r32_919040_c1 3300050510 Bacteria 831
426 nmdc:mga06r32_99488_c1 3300050510 Bacteria 2852
427 nmdc:mga08y16_183572_c1 3300050511 Bacteria 2171
428 nmdc:mga08y16_224891_c1 3300050511 Bacteria 1942
429 nmdc:mga08y16_27250_c1 3300050511 Bacteria 6021
430 nmdc:mga08y16_486040_c1 3300050511 Bacteria 1256
431 nmdc:mga08y16_7128_c1 3300050511 Bacteria 11730
432 nmdc:mga0n895_192854_c1 3300050512 Bacteria 2068
433 nmdc:mga0n895_70755_c1 3300050512 Bacteria 3458
434 nmdc:mga0n895_78926_c1 3300050512 Bacteria 3277
435 nmdc:mga0rr50_192122_c1 3300050513 Bacteria 1674
436 nmdc:mga0rr50_51330_c1 3300050513 Bacteria 3059
437 nmdc:mga0rr50_545034_c1 3300050513 Bacteria 988
438 nmdc:mga08x19_949690_c1 3300050514 Bacteria 611
439 nmdc:mga0a205_151972_c1 3300050515 Bacteria 2214
440 nmdc:mga0a205_17321_c1 3300050515 Bacteria 6751
441 nmdc:mga0a205_201067_c1 3300050515 Bacteria 1883
442 nmdc:mga0a205_241602_c1 3300050515 Bacteria 1687
443 nmdc:mga0a205_29280_c1 3300050515 Bacteria 5269
444 nmdc:mga0a205_347600_c1 3300050515 Bacteria 1351
445 nmdc:mga0a205_375817_c1 3300050515 Bacteria 1287
446 nmdc:mga0a205_585708_c1 3300050515 Bacteria 969
447 nmdc:mga0sz30_345965_c1 3300050516 Bacteria 664
448 Ga0500641_0154642 3300053096 Bacteria 989
449 Ga0500555_008243 3300053103 Bacteria 2969
450 Ga0500562_165859 3300053108 Bacteria 601
451 Ga0500627_0405025 3300053158 Bacteria 581
452 Ga0500637_0062291 3300053178 Bacteria 2137
453 Ga0500611_139163 3300053727 Bacteria 660
454 Ga0501084_0466536 3300054114 Bacteria 1067
455 Ga0501082_0262102 3300060353 Bacteria 1504
456 Ga0105032_103276
457 JGI25406J46586_10014024
458 Ga0065707_10038602
459 Ga0070676_10286926
460 Ga0070690_100031315
461 Ga0068869_100104715
462 Ga0068869_100108915
463 Ga0068868_100120157
464 Ga0070689_100000723
465 Ga0070689_100959854
466 Ga0070687_100024863
467 Ga0070661_101776179
468 Ga0070692_10148176
469 Ga0070668_100070205
470 Ga0070669_100137694
471 Ga0070669_100152994
472 Ga0070675_100109179
473 Ga0070674_100132451
474 Ga0070673_100025534
475 Ga0070688_100022467
476 Ga0070667_100132967
477 Ga0070703_10557790
478 Ga0070714_100276685
479 Ga0070714_100290640
480 Ga0070713_101083277
481 Ga0070710_10721724
482 Ga0070701_10045384
483 Ga0070711_101812996
484 Ga0070700_100091950
485 Ga0070694_101112669
486 Ga0070708_101463766
487 Ga0070678_100297385
488 Ga0070662_100089979
489 Ga0070681_11721086
490 Ga0068867_100101750
491 Ga0068867_100137873
492 Ga0070706_100324924
493 Ga0070706_101388301
494 Ga0070707_100004351
495 Ga0070698_100279254
496 Ga0070698_100534846
497 Ga0070698_100548367
498 Ga0070699_101570715
499 Ga0070679_101315902
500 Ga0070697_100233364
501 Ga0070697_100684781
502 Ga0070697_101176604
503 Ga0070697_101543190
504 Ga0070672_100000068
505 Ga0070672_100193382
506 Ga0070672_100270024
507 Ga0070686_100158481
508 Ga0070696_100282918
509 Ga0070693_100786543
510 Ga0070665_100078373
511 Ga0070665_100366214
512 Ga0070704_100927132
513 Ga0070704_101370962
514 Ga0068855_100546663
515 Ga0068857_102530890
516 Ga0068854_100552488
517 Ga0068856_100119318
518 Ga0068859_100142591
519 Ga0068859_100664701
520 Ga0068864_100143357
521 Ga0068864_100168940
522 Ga0068861_100021789
523 Ga0068861_101442929
524 Ga0068870_10511697
525 Ga0068863_100042799
526 Ga0068863_100910721
527 Ga0068858_100000381
528 Ga0068858_100025532
529 Ga0068858_101082026
530 Ga0068860_100232040
531 Ga0068862_100055695
532 Ga0068862_100806582
533 Ga0068862_101050786
534 Ga0081455_10000509
535 Ga0081455_10013983
536 Ga0081455_10389941
537 Ga0081455_10544202
538 Ga0081455_10649783
539 Ga0081538_10043253
540 Ga0081539_10005556
541 Ga0081539_10023308
542 Ga0070717_10132853
543 Ga0075365_10882440
544 Ga0075368_10016526
545 Ga0075364_10005897
546 Ga0075364_10208286
547 Ga0075432_10226896
548 Ga0070716_100581159
549 Ga0075362_10097462
550 Ga0075362_10317474
551 Ga0075367_10001096
552 Ga0075367_10556682
553 Ga0075366_10003558
554 Ga0075366_10412330
555 Ga0097621_100427366
556 Ga0075370_10025304
557 Ga0075370_10025502
558 Ga0068871_100205728
559 Ga0075428_100048012
560 Ga0075428_100051761
561 Ga0075428_100149055
562 Ga0075428_100202246
563 Ga0075428_100387052
564 Ga0075428_100711500
565 Ga0075428_101034981
566 Ga0075428_101297563
567 Ga0075428_101963196
568 Ga0075430_100106863
569 Ga0075430_100185911
570 Ga0075430_100220457
571 Ga0075430_101726868
572 Ga0075431_100024741
573 Ga0075431_100037649
574 Ga0075431_100042422
575 Ga0075431_100068262
576 Ga0075431_100085923
577 Ga0075431_100169544
578 Ga0075431_100258492
579 Ga0075431_100289605
580 Ga0075431_100603937
581 Ga0075431_100664653
582 Ga0075433_10158118
583 Ga0075433_10205593
584 Ga0075433_10318679
585 Ga0075433_10385294
586 Ga0075433_10840460
587 Ga0075433_10914475
588 Ga0075433_11640243
589 Ga0075434_100149227
590 Ga0075434_100191104
591 Ga0075434_100813728
592 Ga0075434_100868093
593 Ga0075434_100981901
594 Ga0075434_101010136
595 Ga0075429_100047403
596 Ga0075429_100049748
597 Ga0075429_100083906
598 Ga0075429_100564350
599 Ga0075429_101528052
600 Ga0068865_100033519
601 Ga0068865_100641682
602 Ga0075436_100710833
603 Ga0097620_100142591
604 Ga0097620_100664693
605 Ga0075435_100001849
606 Ga0075435_100039111
607 Ga0075435_100069461
608 Ga0099794_10261866
609 Ga0099794_10269790
610 Ga0099794_10318482
611 Ga0105240_10450953
612 Ga0105240_12493170
613 Ga0111539_10009648
614 Ga0111539_10014279
615 Ga0111539_10119575
616 Ga0111539_10532071
617 Ga0111539_13340790
618 Ga0105245_10010282
619 Ga0105245_10655738
620 Ga0105245_11042641
621 Ga0105245_12226749
622 Ga0114129_10015907
623 Ga0114129_10028983
624 Ga0114129_10054143
625 Ga0114129_10071183
626 Ga0114129_10078211
627 Ga0114129_10151912
628 Ga0114129_10236705
629 Ga0114129_10452217
630 Ga0114129_10883351
631 Ga0114129_10997927
632 Ga0114129_11804570
633 Ga0114129_12151562
634 Ga0105243_10088153
635 Ga0105243_10931718
636 Ga0105243_11975513
637 Ga0105242_10345922
638 Ga0105242_13279748
639 Ga0105248_10066263
640 Ga0105237_11063219
641 Ga0105237_11561696
642 Ga0105238_10250481
643 Ga0105249_10094044
644 Ga0105249_10703850
645 Ga0157374_11975675
646 Ga0157378_11869244
647 Ga0163162_10734096
648 Ga0163163_10814452
649 Ga0157380_10003711
650 Ga0157380_10807903
651 Ga0157377_10339754
652 Ga0157379_10125674
653 Ga0157379_11861233
654 Ga0157379_12354407
655 Ga0157379_12401685
656 Ga0157376_10891964
657 Ga0182006_1153351
658 Ga0163161_10510306
659 Ga0214544_1000011
660 Ga0214544_1025509
661 Ga0214542_1000009
662 Ga0214542_1030001
663 Ga0214545_1000007
664 Ga0214543_1000020
665 Ga0214543_1026316
666 Ga0213872_10045530
667 Ga0213874_10028872
668 Ga0213876_10001531
669 Ga0213876_10566012
670 Ga0213875_10103769
671 Ga0213871_10024405
672 Ga0209564_1012825
673 Ga0209257_1041517
674 Ga0207645_10516756
675 Ga0207645_10742321
676 Ga0207643_10334515
677 Ga0207643_10698737
678 Ga0207684_10166987
679 Ga0207684_11494631
680 Ga0207684_11534476
681 Ga0207695_10198095
682 Ga0207695_10307793
683 Ga0207662_10003694
684 Ga0207652_11152096
685 Ga0207646_10074889
686 Ga0207681_10299489
687 Ga0207681_10913131
688 Ga0207659_10046117
689 Ga0207687_10003620
690 Ga0207687_10300702
691 Ga0207700_10879635
692 Ga0207664_10034790
693 Ga0207664_10350372
694 Ga0207690_10850884
695 Ga0207690_11537976
696 Ga0207706_10028853
697 Ga0207686_10449907
698 Ga0207709_10093667
699 Ga0207709_10679945
700 Ga0207670_10000584
701 Ga0207670_10232539
702 Ga0207670_10425597
703 Ga0207669_10312853
704 Ga0207704_10048329
705 Ga0207704_10071870
706 Ga0207665_11246682
707 Ga0207691_10000502
708 Ga0207691_10003878
709 Ga0207711_11479066
710 Ga0207689_10124984
711 Ga0207689_10195661
712 Ga0207661_10756879
713 Ga0207667_10484802
714 Ga0207651_10006217
715 Ga0207668_10973202
716 Ga0207640_10384624
717 Ga0207677_10000011
718 Ga0207703_10000268
719 Ga0207703_10711740
720 Ga0207678_10039785
721 Ga0207708_10038468
722 Ga0207702_11254420
723 Ga0207641_10157289
724 Ga0207641_10245764
725 Ga0207641_10975059
726 Ga0207648_10003047
727 Ga0207648_10109968
728 Ga0207648_11339345
729 Ga0207676_10145720
730 Ga0207676_10859280
731 Ga0207674_12104324
732 Ga0207675_100048612
733 Ga0207675_100568823
734 Ga0207683_10057580
735 Ga0207698_12568460
736 Ga0209588_1115214
737 Ga0209813_10038997
738 Ga0207428_10000325
739 Ga0207428_10002886
740 Ga0207428_10274967
741 Ga0268266_10043527
742 Ga0268265_10269309
743 Ga0268264_10387792
744 Ga0268264_10553611
745 Ga0307515_10069975
746 Ga0265338_10561732
747 Ga0265327_10021956
748 Ga0265316_10193670
749 Ga0307513_10130087
750 Ga0307513_10323276
751 Ga0307408_101976806
752 Ga0307408_102105076
753 Ga0316575_10027267
754 Ga0307405_11570875
755 Ga0307413_10405263
756 Ga0307412_10585193
757 Ga0307414_11243991
758 Ga0307411_10561727
759 Ga0316583_10153334
760 Ga0373932_0300584
761 Ga0373936_0252446
762 Ga0373927_0084767
763 Ga0373933_0498071
764 Ga0373937_0776587
765 Ga0395900_0169843
766 Ga0395898_0988212
767 Ga0395905_0005147
768 Ga0395905_0035712
769 Ga0395905_0435941
770 Ga0436364_1500858
771 Ga0436365_1079016
772 Ga0436365_1436809
773 Ga0436360_0053452
774 Ga0436360_0679260
775 Ga0436360_0684385
776 Ga0436360_0981885
777 Ga0436360_1235609
778 Ga0436360_1248043
779 Ga0436361_0378646
780 Ga0436361_0739483
781 Ga0436363_0436132
782 Ga0436363_1381196
783 Ga0439453_0129585
784 Ga0439465_0011866
785 Ga0439445_0137126
786 Ga0439432_036834
787 Ga0439435_0039879
788 Ga0466972_0000100
789 Ga0466972_0217345
790 Ga0466965_0101829
791 Ga0466963_0260875
792 Ga0466971_0387602
793 Ga0466957_0067883
794 Ga0466957_0723162
795 Ga0466958_0018131
796 Ga0466967_0000216
797 Ga0466967_0100625
798 Ga0495584_0147324
799 Ga0495640_0072494
800 Ga0495659_0324767
801 Ga0495659_0368958
802 Ga0495659_0531310
803 Ga0495669_0152486
804 Ga0495660_0178705
805 Ga0495636_0272577
806 Ga0495675_0160236
807 Ga0495684_0877745
808 Ga0496101_1278374
809 Ga0496102_1673945
810 Ga0496106_0303029
811 Ga0496108_1081344
812 Ga0496109_0000170
813 Ga0496109_0062011
814 Ga0496114_1269018
815 Ga0496115_0357552
816 Ga0501031_0430286
817 Ga0501032_0082832
818 Ga0501036_0083437
819 Ga0501036_1226491
820 Ga0501037_0026568
821 Ga0501038_0959007
822 Ga0501040_0631655
823 Ga0501043_0085980
824 Ga0501047_0198107
825 Ga0501067_0029030
826 Ga0501068_0459331
827 Ga0501073_0204926
828 Ga0501076_1649347
829 Ga0501080_0171274
830 Ga0501081_0339055
831 Ga0501083_0000238
832 Ga0501035_0158418
833 Ga0501044_0274259
834 Ga0501044_1066272
835 Ga0501045_0485632
836 nmdc:mga03683_155932_c1
837 nmdc:mga03683_98857_c1
838 nmdc:mga03n38_355179_c1
839 nmdc:mga00v17_208577_c1
840 nmdc:mga00v17_870291_c1
841 nmdc:mga0yw44_246137_c1
842 nmdc:mga0k408_146096_c1
843 nmdc:mga0k408_660875_c1
844 nmdc:mga0k408_841_c1
845 nmdc:mga06z11_3624_c1
846 nmdc:mga06z11_512883_c1
847 nmdc:mga04h51_11306_c1
848 nmdc:mga07m45_50202_c1
849 nmdc:mga07m45_9055_c2
850 nmdc:mga05p37_111722_c1
851 nmdc:mga05p37_123756_c1
852 nmdc:mga05p37_1370752_c1
853 nmdc:mga05p37_17682_c1
854 nmdc:mga05p37_1873121_c1
855 nmdc:mga05p37_202606_c1
856 nmdc:mga05p37_322520_c1
857 nmdc:mga05p37_506828_c1
858 nmdc:mga05p37_62340_c1
859 nmdc:mga05p37_661547_c1
860 nmdc:mga05p37_93363_c1
861 nmdc:mga09592_177571_c1
862 nmdc:mga09592_178939_c1
863 nmdc:mga09592_343668_c1
864 nmdc:mga09592_49179_c1
865 nmdc:mga09592_74034_c1
866 nmdc:mga09592_788656_c1
867 nmdc:mga0qj67_286603_c1
868 nmdc:mga0qj67_326880_c1
869 nmdc:mga0qj67_924401_c1
870 nmdc:mga06r32_1027037_c1
871 nmdc:mga06r32_1208680_c1
872 nmdc:mga06r32_1503771_c1
873 nmdc:mga06r32_166753_c1
874 nmdc:mga06r32_202570_c1
875 nmdc:mga06r32_235045_c1
876 nmdc:mga06r32_46781_c1
877 nmdc:mga06r32_550467_c1
878 nmdc:mga06r32_662883_c1
879 nmdc:mga06r32_913687_c1
880 nmdc:mga06r32_919040_c1
881 nmdc:mga06r32_99488_c1
882 nmdc:mga08y16_183572_c1
883 nmdc:mga08y16_224891_c1
884 nmdc:mga08y16_27250_c1
885 nmdc:mga08y16_486040_c1
886 nmdc:mga08y16_7128_c1
887 nmdc:mga0n895_192854_c1
888 nmdc:mga0n895_70755_c1
889 nmdc:mga0n895_78926_c1
890 nmdc:mga0rr50_192122_c1
891 nmdc:mga0rr50_51330_c1
892 nmdc:mga0rr50_545034_c1
893 nmdc:mga08x19_949690_c1
894 nmdc:mga0a205_151972_c1
895 nmdc:mga0a205_17321_c1
896 nmdc:mga0a205_201067_c1
897 nmdc:mga0a205_241602_c1
898 nmdc:mga0a205_29280_c1
899 nmdc:mga0a205_347600_c1
900 nmdc:mga0a205_375817_c1
901 nmdc:mga0a205_585708_c1
902 nmdc:mga0sz30_345965_c1
903 Ga0500641_0154642
904 Ga0500555_008243
905 Ga0500562_165859
906 Ga0500627_0405025
907 Ga0500637_0062291
908 Ga0500611_139163
909 Ga0501084_0466536
910 Ga0501082_0262102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

65

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9415 42 72
5h3r-assembly1.cif.gz_B crystal structure of mutant marr c80s from e.coli complexed with operator dna 0.9366 42 85
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9238 3 86
3vb2-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9221 42 86
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.899 12 84
ID Description Score Start End Superfamily
2v9vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9675 42 83 1.10.10.10
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9479 42 85 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9472 42 74 1.10.10.10
af_A0A1D6GVA1_621_768_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9323 42 85 3.30.230.130
2g7uD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9302 44 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A401ZYN4-F1-model_v4 HTH arsR-type domain-containing protein 0.9888 4 96 GO:0003700
AF-A0A2D6T7E6-F1-model_v4 Transcriptional regulator 0.9885 1 100 GO:0003700
AF-A0A3N5HAB9-F1-model_v4 ArsR family transcriptional regulator 0.9882 4 98 GO:0003700
AF-A0A4P6JIX9-F1-model_v4 ArsR family transcriptional regulator 0.986 3 96 GO:0003700
AF-A0A839AEV0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9859 4 100 GO:0003700

Map