F447541

General Info

Members Datasets Scaffolds Average Seq Length
455 232 455 307

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10148489|Ga0081455_101484892
Length 341
Sequence MLGRETQSSLPGRLAAVCAERRARRRELGVKCRLIAWRQAAPTQPADRGGRAGSSDPLANQAVARLARLWGTHHKLPVTAALVMPIVYGALMAAVLNAANNAVNQIYDLDIDRVNKPKRPLPSGRLTIAETWRFTVVTYLLSLVLAWLVAPGGRHECFWLVLIAVVCTFIYSVPPLRTKRLGIWANVTIAIPRGTLLKVAGWSSVKTIAGLEPWYIGAIFGLFLLGATTTKDFADMEGDRRGGCRTLPIQFGVRRAAWMISPSFVIPFTMIPIGAWLGILTGNFLLLQALGLVMTAYGIYVCYLMLRRPEDLAVEENHVSWAHMYRMMFVAQIGFALAYLL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 0
Rhizoplane 4.84
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10133515 3300005290 Unclassified 1522
2 Ga0065715_10026638 3300005293 Unclassified 1422
3 Ga0065715_10090460 3300005293 Bacteria 6926
4 Ga0065715_10107914 3300005293 Bacteria 2746
5 Ga0065715_10129340 3300005293 Unclassified 2047
6 Ga0065715_10140628 3300005293 Bacteria 1859
7 Ga0065715_10173109 3300005293 Bacteria 1532
8 Ga0065707_10002000 3300005295 Bacteria 8686
9 Ga0070658_10021120 3300005327 Bacteria 5215
10 Ga0070676_10025692 3300005328 Bacteria 3330
11 Ga0070683_100007389 3300005329 Bacteria 9282
12 Ga0070683_100116124 3300005329 Bacteria 2527
13 Ga0070670_100031830 3300005331 Bacteria 4543
14 Ga0070666_10013126 3300005335 Bacteria 5248
15 Ga0070666_10094283 3300005335 Unclassified 2059
16 Ga0068868_100046365 3300005338 Bacteria 3402
17 Ga0070660_100002351 3300005339 Bacteria 12990
18 Ga0070660_100102845 3300005339 Bacteria 2265
19 Ga0070689_100019727 3300005340 Bacteria 4988
20 Ga0070691_10159010 3300005341 Unclassified 1163
21 Ga0070687_100020385 3300005343 Bacteria 3099
22 Ga0070668_100349160 3300005347 Unclassified 1251
23 Ga0070669_100038905 3300005353 Unclassified 3454
24 Ga0070669_100040437 3300005353 Bacteria 3389
25 Ga0070669_100113739 3300005353 Bacteria 2057
26 Ga0070675_100000253 3300005354 Bacteria 34898
27 Ga0070675_100038274 3300005354 Unclassified 3908
28 Ga0070675_100062460 3300005354 Bacteria 3077
29 Ga0070675_100115865 3300005354 Unclassified 2272
30 Ga0070674_100069111 3300005356 Bacteria 2491
31 Ga0070673_100004339 3300005364 Bacteria 8957
32 Ga0070688_100088828 3300005365 Bacteria 2016
33 Ga0070667_100100320 3300005367 Bacteria 2500
34 Ga0070667_100306725 3300005367 Bacteria 1430
35 Ga0070714_100002662 3300005435 Bacteria 13161
36 Ga0070713_100010796 3300005436 Bacteria 6617
37 Ga0070713_100029301 3300005436 Bacteria 4358
38 Ga0070711_100188610 3300005439 Bacteria 1583
39 Ga0070705_100066016 3300005440 Bacteria 2168
40 Ga0070700_100216455 3300005441 Bacteria 1355
41 Ga0070708_100089671 3300005445 Bacteria 2798
42 Ga0070678_100236632 3300005456 Bacteria 1525
43 Ga0070662_100014136 3300005457 Bacteria 5326
44 Ga0070662_100207387 3300005457 Unclassified 1558
45 Ga0070662_100471473 3300005457 Bacteria 1044
46 Ga0070681_10044735 3300005458 Bacteria 4432
47 Ga0070681_10094421 3300005458 Bacteria 2940
48 Ga0070698_100178075 3300005471 Bacteria 2065
49 Ga0070699_100003877 3300005518 Bacteria 13221
50 Ga0070699_100057867 3300005518 Unclassified 3357
51 Ga0070699_100077769 3300005518 Bacteria 2889
52 Ga0070699_100267658 3300005518 Bacteria 1529
53 Ga0070679_100011985 3300005530 Bacteria 8276
54 Ga0070684_100000213 3300005535 Bacteria 40774
55 Ga0070697_100038479 3300005536 Bacteria 3865
56 Ga0070672_100017764 3300005543 Bacteria 5126
57 Ga0070672_100106574 3300005543 Unclassified 2280
58 Ga0070686_100000402 3300005544 Bacteria 27116
59 Ga0070686_100060265 3300005544 Bacteria 2448
60 Ga0070693_100031362 3300005547 Bacteria 2912
61 Ga0070665_100002142 3300005548 Bacteria 22040
62 Ga0070665_100114156 3300005548 Bacteria 2704
63 Ga0070704_100010966 3300005549 Bacteria 5528
64 Ga0070704_100121913 3300005549 Bacteria 2005
65 Ga0068855_100004159 3300005563 Bacteria 17656
66 Ga0070664_100000156 3300005564 Bacteria 47186
67 Ga0070664_100127077 3300005564 Bacteria 2237
68 Ga0068857_100014787 3300005577 Bacteria 6809
69 Ga0068854_100066303 3300005578 Bacteria 2627
70 Ga0068854_100078399 3300005578 Bacteria 2433
71 Ga0070702_100002245 3300005615 Bacteria 8255
72 Ga0068859_100127183 3300005617 Unclassified 2618
73 Ga0068864_100041848 3300005618 Bacteria 3919
74 Ga0068864_100104220 3300005618 Bacteria 2519
75 Ga0068864_100255785 3300005618 Bacteria 1627
76 Ga0068864_100260787 3300005618 Bacteria 1612
77 Ga0068866_10242314 3300005718 Bacteria 1099
78 Ga0068861_100000990 3300005719 Bacteria 17354
79 Ga0068861_100013307 3300005719 Bacteria 5756
80 Ga0068861_100080501 3300005719 Bacteria 2548
81 Ga0068861_100280118 3300005719 Bacteria 1435
82 Ga0068861_100337980 3300005719 Bacteria 1317
83 Ga0068870_10129885 3300005840 Bacteria 1462
84 Ga0068863_100060836 3300005841 Unclassified 3571
85 Ga0068863_100067820 3300005841 Bacteria 3374
86 Ga0068863_100151221 3300005841 Bacteria 2221
87 Ga0068858_100011512 3300005842 Bacteria 8347
88 Ga0068858_100027466 3300005842 Bacteria 5287
89 Ga0068858_100231893 3300005842 Bacteria 1750
90 Ga0068860_100046416 3300005843 Bacteria 4141
91 Ga0068862_100015306 3300005844 Bacteria 6371
92 Ga0068862_100020513 3300005844 Bacteria 5521
93 Ga0068862_100059529 3300005844 Bacteria 3280
94 Ga0081455_10148489 3300005937 Bacteria 1810
95 Ga0070717_10265957 3300006028 Unclassified 1518
96 Ga0075368_10025116 3300006042 Bacteria 2285
97 Ga0075368_10040122 3300006042 Bacteria 1837
98 Ga0075364_10052328 3300006051 Bacteria 2668
99 Ga0075364_10210592 3300006051 Bacteria 1318
100 Ga0075367_10002285 3300006178 Bacteria 8691
101 Ga0075367_10058983 3300006178 Bacteria 2284
102 Ga0075367_10107242 3300006178 Unclassified 1712
103 Ga0075366_10010625 3300006195 Bacteria 5171
104 Ga0075366_10017597 3300006195 Bacteria 4115
105 Ga0075366_10156114 3300006195 Unclassified 1382
106 Ga0097621_100023501 3300006237 Bacteria 4800
107 Ga0097621_100329435 3300006237 Bacteria 1354
108 Ga0075370_10008919 3300006353 Bacteria 5182
109 Ga0068871_100052120 3300006358 Unclassified 3313
110 Ga0068871_100090121 3300006358 Bacteria 2554
111 Ga0068871_100341020 3300006358 Bacteria 1323
112 Ga0075428_100003044 3300006844 Bacteria 18300
113 Ga0075428_100059531 3300006844 Bacteria 4182
114 Ga0075428_100393813 3300006844 Unclassified 1485
115 Ga0075431_100041775 3300006847 Bacteria 4729
116 Ga0075431_100076020 3300006847 Bacteria 3466
117 Ga0075433_10002677 3300006852 Bacteria 13598
118 Ga0075433_10021430 3300006852 Bacteria 5419
119 Ga0075433_10043515 3300006852 Bacteria 3898
120 Ga0075433_10200391 3300006852 Bacteria 1775
121 Ga0075434_100000086 3300006871 Bacteria 50533
122 Ga0075434_100006665 3300006871 Bacteria 10602
123 Ga0075434_100024007 3300006871 Bacteria 5954
124 Ga0075434_100283664 3300006871 Bacteria 1676
125 Ga0075434_100288209 3300006871 Unclassified 1662
126 Ga0075429_100061982 3300006880 Bacteria 3258
127 Ga0075429_100069273 3300006880 Bacteria 3072
128 Ga0068865_100147229 3300006881 Unclassified 1783
129 Ga0075436_100001792 3300006914 Bacteria 14716
130 Ga0075436_100060988 3300006914 Bacteria 2605
131 Ga0075436_100073876 3300006914 Bacteria 2360
132 Ga0097620_100127189 3300006931 Unclassified 2618
133 Ga0075435_100000174 3300007076 Bacteria 37839
134 Ga0075435_100001493 3300007076 Bacteria 15022
135 Ga0075435_100002632 3300007076 Bacteria 11957
136 Ga0075435_100033938 3300007076 Bacteria 4039
137 Ga0075435_100043426 3300007076 Unclassified 3598
138 Ga0075435_100056887 3300007076 Bacteria 3162
139 Ga0075435_100071298 3300007076 Bacteria 2837
140 Ga0075435_100155676 3300007076 Bacteria 1923
141 Ga0075435_100172400 3300007076 Bacteria 1826
142 Ga0099794_10102433 3300007265 Unclassified 1430
143 Ga0105251_10156132 3300009011 Bacteria 1029
144 Ga0105240_10009534 3300009093 Bacteria 13747
145 Ga0111539_10007381 3300009094 Bacteria 14081
146 Ga0111539_10016121 3300009094 Bacteria 9273
147 Ga0111539_10016736 3300009094 Bacteria 9087
148 Ga0111539_10052843 3300009094 Bacteria 4836
149 Ga0111539_10113768 3300009094 Bacteria 3174
150 Ga0105245_10012513 3300009098 Bacteria 7384
151 Ga0105245_10026518 3300009098 Bacteria 5101
152 Ga0114129_10000939 3300009147 Bacteria 38096
153 Ga0114129_10001723 3300009147 Bacteria 29834
154 Ga0114129_10006311 3300009147 Bacteria 16813
155 Ga0114129_10008615 3300009147 Bacteria 14545
156 Ga0114129_10015611 3300009147 Bacteria 10799
157 Ga0114129_10018568 3300009147 Bacteria 9901
158 Ga0114129_10042726 3300009147 Bacteria 6380
159 Ga0114129_10065095 3300009147 Bacteria 5088
160 Ga0114129_10080128 3300009147 Unclassified 4539
161 Ga0114129_10086345 3300009147 Unclassified 4352
162 Ga0114129_10305331 3300009147 Unclassified 2120
163 Ga0114129_10320654 3300009147 Bacteria 2060
164 Ga0105243_10012471 3300009148 Bacteria 6425
165 Ga0105243_10028881 3300009148 Bacteria 4261
166 Ga0105241_10016171 3300009174 Bacteria 5468
167 Ga0105241_10109601 3300009174 Bacteria 2208
168 Ga0105241_10305966 3300009174 Bacteria 1366
169 Ga0105242_10002057 3300009176 Bacteria 15863
170 Ga0105242_10030978 3300009176 Bacteria 4272
171 Ga0105242_10080547 3300009176 Bacteria 2722
172 Ga0105242_10246176 3300009176 Bacteria 1609
173 Ga0105248_10002829 3300009177 Bacteria 19252
174 Ga0105248_10026779 3300009177 Bacteria 6412
175 Ga0105248_10041443 3300009177 Bacteria 5162
176 Ga0105248_10199687 3300009177 Bacteria 2253
177 Ga0105248_10418052 3300009177 Bacteria 1510
178 Ga0105248_10481620 3300009177 Bacteria 1399
179 Ga0105249_10029112 3300009553 Bacteria 4988
180 Ga0105249_10031781 3300009553 Unclassified 4775
181 Ga0105249_10106574 3300009553 Bacteria 2644
182 Ga0105249_10567811 3300009553 Bacteria 1187
183 Ga0105239_10302767 3300010375 Bacteria 1800
184 Ga0105239_10367782 3300010375 Bacteria 1625
185 Ga0157369_10278067 3300013105 Unclassified 1744
186 Ga0157374_10150854 3300013296 Bacteria 2260
187 Ga0163162_10207193 3300013306 Bacteria 2090
188 Ga0157375_10433137 3300013308 Bacteria 1481
189 Ga0163163_10000155 3300014325 Bacteria 71598
190 Ga0163163_10003623 3300014325 Bacteria 13133
191 Ga0163163_10018017 3300014325 Bacteria 6597
192 Ga0163163_10051170 3300014325 Bacteria 4072
193 Ga0163163_10138042 3300014325 Bacteria 2479
194 Ga0157380_10037139 3300014326 Bacteria 3773
195 Ga0157380_10041387 3300014326 Bacteria 3595
196 Ga0157380_10271834 3300014326 Bacteria 1545
197 Ga0157380_10516825 3300014326 Bacteria 1164
198 Ga0157379_10006235 3300014968 Bacteria 10269
199 Ga0157379_10330774 3300014968 Bacteria 1392
200 Ga0157376_10016212 3300014969 Bacteria 5650
201 Ga0157376_10036156 3300014969 Bacteria 3999
202 Ga0157376_10100247 3300014969 Bacteria 2529
203 Ga0207666_1011258 3300025271 Bacteria 1235
204 Ga0207697_10012847 3300025315 Bacteria 3502
205 Ga0207697_10036825 3300025315 Bacteria 2004
206 Ga0207710_10012841 3300025900 Unclassified 3528
207 Ga0207688_10012499 3300025901 Bacteria 4621
208 Ga0207680_10143172 3300025903 Bacteria 1586
209 Ga0207699_10092667 3300025906 Bacteria 1900
210 Ga0207645_10001954 3300025907 Bacteria 16599
211 Ga0207645_10138402 3300025907 Bacteria 1586
212 Ga0207645_10146583 3300025907 Bacteria 1539
213 Ga0207643_10172469 3300025908 Bacteria 1306
214 Ga0207705_10207200 3300025909 Unclassified 1487
215 Ga0207707_10114988 3300025912 Bacteria 2351
216 Ga0207707_10267022 3300025912 Bacteria 1484
217 Ga0207662_10033527 3300025918 Bacteria 2994
218 Ga0207657_10007660 3300025919 Bacteria 11046
219 Ga0207657_10227754 3300025919 Unclassified 1491
220 Ga0207646_10354495 3300025922 Unclassified 1326
221 Ga0207681_10063924 3300025923 Bacteria 2539
222 Ga0207681_10108208 3300025923 Bacteria 2017
223 Ga0207650_10141917 3300025925 Bacteria 1889
224 Ga0207659_10000790 3300025926 Bacteria 18724
225 Ga0207687_10011884 3300025927 Bacteria 5695
226 Ga0207687_10037673 3300025927 Bacteria 3301
227 Ga0207700_10097795 3300025928 Unclassified 2333
228 Ga0207700_10314319 3300025928 Unclassified 1356
229 Ga0207644_10173539 3300025931 Bacteria 1685
230 Ga0207690_10039984 3300025932 Bacteria 3063
231 Ga0207690_10385508 3300025932 Bacteria 1115
232 Ga0207706_10102125 3300025933 Bacteria 2523
233 Ga0207706_10138325 3300025933 Bacteria 2142
234 Ga0207706_10183516 3300025933 Bacteria 1838
235 Ga0207706_10211167 3300025933 Bacteria 1701
236 Ga0207706_10238013 3300025933 Bacteria 1592
237 Ga0207686_10012436 3300025934 Bacteria 4682
238 Ga0207686_10104105 3300025934 Bacteria 1900
239 Ga0207686_10136918 3300025934 Bacteria 1687
240 Ga0207709_10076972 3300025935 Bacteria 2137
241 Ga0207709_10161044 3300025935 Unclassified 1565
242 Ga0207670_10069597 3300025936 Bacteria 2428
243 Ga0207669_10198343 3300025937 Bacteria 1455
244 Ga0207704_10041898 3300025938 Bacteria 2690
245 Ga0207704_10074914 3300025938 Unclassified 2162
246 Ga0207665_10120177 3300025939 Bacteria 1855
247 Ga0207711_10038082 3300025941 Unclassified 4088
248 Ga0207711_10170812 3300025941 Unclassified 1973
249 Ga0207711_10347471 3300025941 Unclassified 1373
250 Ga0207689_10032000 3300025942 Bacteria 4375
251 Ga0207661_10003873 3300025944 Bacteria 10433
252 Ga0207661_10459845 3300025944 Unclassified 1160
253 Ga0207679_10009221 3300025945 Bacteria 6308
254 Ga0207679_10324232 3300025945 Bacteria 1335
255 Ga0207651_10001688 3300025960 Bacteria 10167
256 Ga0207712_10022696 3300025961 Bacteria 4136
257 Ga0207712_10025077 3300025961 Bacteria 3958
258 Ga0207668_10125297 3300025972 Unclassified 1952
259 Ga0207668_10156727 3300025972 Bacteria 1770
260 Ga0207640_10051567 3300025981 Bacteria 2675
261 Ga0207658_10087895 3300025986 Bacteria 2401
262 Ga0207658_10247209 3300025986 Bacteria 1514
263 Ga0207677_10074971 3300026023 Bacteria 2403
264 Ga0207703_10131545 3300026035 Bacteria 2161
265 Ga0207703_10464061 3300026035 Bacteria 1185
266 Ga0207708_10004859 3300026075 Bacteria 9906
267 Ga0207708_10009610 3300026075 Bacteria 7170
268 Ga0207702_10159566 3300026078 Unclassified 2058
269 Ga0207641_10074593 3300026088 Bacteria 2927
270 Ga0207641_10243233 3300026088 Unclassified 1678
271 Ga0207648_10000959 3300026089 Bacteria 32621
272 Ga0207648_10076154 3300026089 Bacteria 2924
273 Ga0207648_10198205 3300026089 Bacteria 1780
274 Ga0207676_10028215 3300026095 Bacteria 4191
275 Ga0207676_10209816 3300026095 Bacteria 1727
276 Ga0207674_10154297 3300026116 Bacteria 2252
277 Ga0207675_100002719 3300026118 Bacteria 17427
278 Ga0207675_100060920 3300026118 Bacteria 3523
279 Ga0207675_100095148 3300026118 Unclassified 2802
280 Ga0207675_100155917 3300026118 Bacteria 2176
281 Ga0207675_100665399 3300026118 Bacteria 1048
282 Ga0207683_10046286 3300026121 Bacteria 3807
283 Ga0207698_10262632 3300026142 Bacteria 1587
284 Ga0207428_10042798 3300027907 Unclassified 3661
285 Ga0207428_10276115 3300027907 Bacteria 1248
286 Ga0268265_10025016 3300028380 Bacteria 4231
287 Ga0268265_10519034 3300028380 Bacteria 1126
288 Ga0268264_10087723 3300028381 Bacteria 2676
289 Ga0268264_10340566 3300028381 Unclassified 1424
290 Ga0307405_10250213 3300031731 Unclassified 1318
291 Ga0307413_10135571 3300031824 Bacteria 1692
292 Ga0307410_10072890 3300031852 Bacteria 2386
293 Ga0307410_10118113 3300031852 Bacteria 1929
294 Ga0307406_10029089 3300031901 Bacteria 3343
295 Ga0307406_10096283 3300031901 Bacteria 2005
296 Ga0307407_10007621 3300031903 Bacteria 4911
297 Ga0307407_10008186 3300031903 Bacteria 4783
298 Ga0307409_100003418 3300031995 Bacteria 8626
299 Ga0307409_100161244 3300031995 Bacteria 1961
300 Ga0307409_100257579 3300031995 Unclassified 1599
301 Ga0307409_100677999 3300031995 Unclassified 1028
302 Ga0307414_10302959 3300032004 Bacteria 1353
303 Ga0307415_100008970 3300032126 Bacteria 5577
304 Ga0307415_100100428 3300032126 Bacteria 2120
305 Ga0373948_0000421 3300034817 Bacteria 5232
306 Ga0373950_0018983 3300034818 Bacteria 1197
307 Ga0373958_0000502 3300034819 Bacteria 4846
308 Ga0373938_0000158 3300034957 Bacteria 9791
309 Ga0373928_0006280 3300035084 Bacteria 2284
310 Ga0373934_0003609 3300035086 Bacteria 5692
311 Ga0373940_0000578 3300035088 Bacteria 5806
312 Ga0373949_0005298 3300035090 Bacteria 2883
313 Ga0373951_0002991 3300035091 Bacteria 4189
314 Ga0373932_0002107 3300035112 Bacteria 5169
315 Ga0373939_0000700 3300035114 Bacteria 8299
316 Ga0373941_0000754 3300035115 Bacteria 6619
317 Ga0373953_0018120 3300035117 Bacteria 2600
318 Ga0373954_0040967 3300035118 Bacteria 2159
319 Ga0373960_0000212 3300035121 Bacteria 10655
320 Ga0373942_0000280 3300035207 Bacteria 13821
321 Ga0373961_0001969 3300035241 Bacteria 5549
322 Ga0373962_0000486 3300035242 Bacteria 8804
323 Ga0373931_0006376 3300035691 Bacteria 5508
324 Ga0373935_0268600 3300035692 Unclassified 1198
325 Ga0373933_0013370 3300035724 Bacteria 4548
326 Ga0373947_0074550 3300035725 Bacteria 2088
327 Ga0373937_0000284 3300036401 Bacteria 48546
328 Ga0373937_0001393 3300036401 Bacteria 20204
329 Ga0373937_0100622 3300036401 Unclassified 2682
330 Ga0373925_0014489 3300037068 Bacteria 5698
331 Ga0395905_0153751 3300037471 Unclassified 2164
332 Ga0439462_0051874 3300042015 Bacteria 1103
333 Ga0439434_0021418 3300042435 Bacteria 1942
334 Ga0439460_0011321 3300042461 Bacteria 2299
335 Ga0451577_0067468 3300042876 Bacteria 3190
336 Ga0453684_0048126 3300044712 Bacteria 5644
337 Ga0453684_0654009 3300044712 Bacteria 1147
338 Ga0451576_0013147 3300045051 Bacteria 9264
339 Ga0451576_0015218 3300045051 Bacteria 8532
340 Ga0451576_0154972 3300045051 Bacteria 2389
341 Ga0466967_0081041 3300045976 Bacteria 2931
342 Ga0495664_0098006 3300046477 Viruses 1765
343 Ga0495645_0001236 3300046543 Bacteria 17435
344 Ga0495633_0135787 3300046558 Bacteria 1138
345 Ga0495635_0201182 3300046663 Bacteria 1351
346 Ga0495658_0140913 3300046683 Unclassified 1474
347 Ga0495674_0096435 3300047319 Unclassified 2521
348 Ga0495674_0140203 3300047319 Unclassified 2033
349 Ga0495674_0196172 3300047319 Unclassified 1676
350 Ga0496102_0010458 3300048905 Bacteria 7985
351 Ga0496103_0048553 3300048906 Bacteria 2623
352 Ga0496104_0004973 3300048907 Bacteria 11608
353 Ga0496104_0229205 3300048907 Bacteria 1770
354 Ga0496105_0023814 3300048908 Bacteria 4971
355 Ga0496108_0002727 3300048911 Bacteria 14118
356 Ga0496108_0135396 3300048911 Unclassified 2119
357 Ga0496108_0249357 3300048911 Unclassified 1544
358 Ga0496109_0003877 3300048912 Bacteria 12492
359 Ga0496109_0029415 3300048912 Bacteria 4920
360 Ga0496109_0195359 3300048912 Unclassified 1902
361 Ga0496109_0258042 3300048912 Bacteria 1642
362 Ga0496109_0299195 3300048912 Unclassified 1517
363 Ga0496110_0000648 3300048913 Bacteria 23803
364 Ga0496110_0613159 3300048913 Bacteria 987
365 Ga0496112_0007676 3300048915 Bacteria 9598
366 Ga0496112_0022323 3300048915 Bacteria 6031
367 Ga0496112_0047081 3300048915 Bacteria 4230
368 Ga0496112_0541610 3300048915 Bacteria 1098
369 Ga0496113_0059021 3300048916 Unclassified 2889
370 Ga0496114_0043715 3300048917 Bacteria 3715
371 Ga0496114_0419836 3300048917 Bacteria 1185
372 Ga0501034_0287938 3300049571 Bacteria 1581
373 Ga0501034_0350428 3300049571 Unclassified 1405
374 Ga0501040_0179405 3300049576 Unclassified 1501
375 Ga0501046_0255375 3300049580 Bacteria 1289
376 Ga0501047_0065724 3300049581 Bacteria 3496
377 Ga0501048_0256786 3300049582 Bacteria 1241
378 Ga0501069_0189830 3300049585 Bacteria 1189
379 Ga0501070_0252087 3300049586 Unclassified 1444
380 Ga0501071_0017869 3300049587 Bacteria 4901
381 Ga0501071_0162761 3300049587 Bacteria 1668
382 Ga0501072_0011160 3300049588 Bacteria 6858
383 Ga0501075_0058067 3300049591 Bacteria 2914
384 Ga0501075_0111312 3300049591 Unclassified 2082
385 Ga0501076_0023486 3300049592 Bacteria 4754
386 Ga0501076_0101600 3300049592 Bacteria 2318
387 Ga0501077_0016739 3300049593 Bacteria 4623
388 Ga0501079_0094502 3300049741 Bacteria 2317
389 Ga0501045_0375433 3300049824 Unclassified 1058
390 nmdc:mga03683_105481_c1 3300050489 Unclassified 1242
391 nmdc:mga00v17_71932_c1 3300050491 Bacteria 2145
392 nmdc:mga00v17_8494_c1 3300050491 Bacteria 5527
393 nmdc:mga0yw44_106660_c1 3300050492 Bacteria 1791
394 nmdc:mga0k408_141684_c1 3300050493 Unclassified 1430
395 nmdc:mga0k408_25477_c1 3300050493 Unclassified 3350
396 nmdc:mga0k408_3316_c1 3300050493 Bacteria 8519
397 nmdc:mga0k408_3854_c1 3300050493 Bacteria 7950
398 nmdc:mga06z11_2986_c1 3300050494 Bacteria 6506
399 nmdc:mga07m45_76245_c1 3300050496 Bacteria 1912
400 nmdc:mga05p37_13761_c1 3300050507 Bacteria 9694
401 nmdc:mga05p37_16330_c1 3300050507 Bacteria 8938
402 nmdc:mga05p37_166585_c1 3300050507 Unclassified 2689
403 nmdc:mga05p37_212429_c1 3300050507 Bacteria 2338
404 nmdc:mga05p37_245550_c1 3300050507 Unclassified 2149
405 nmdc:mga05p37_26012_c1 3300050507 Bacteria 7115
406 nmdc:mga05p37_27520_c1 3300050507 Bacteria 6922
407 nmdc:mga05p37_275_c1 3300050507 Bacteria 53593
408 nmdc:mga05p37_340099_c1 3300050507 Unclassified 1770
409 nmdc:mga05p37_7337_c1 3300050507 Bacteria 13002
410 nmdc:mga09592_362446_c1 3300050508 Bacteria 1254
411 nmdc:mga09592_62116_c1 3300050508 Bacteria 3160
412 nmdc:mga0qj67_101669_c1 3300050509 Bacteria 2318
413 nmdc:mga06r32_100237_c1 3300050510 Bacteria 2841
414 nmdc:mga06r32_149712_c1 3300050510 Bacteria 2312
415 nmdc:mga06r32_175482_c1 3300050510 Bacteria 2127
416 nmdc:mga06r32_21066_c1 3300050510 Bacteria 6014
417 nmdc:mga06r32_69246_c1 3300050510 Unclassified 3410
418 nmdc:mga08y16_4189_c1 3300050511 Bacteria 15070
419 nmdc:mga08y16_6653_c1 3300050511 Bacteria 12126
420 nmdc:mga08y16_67296_c1 3300050511 Unclassified 3736
421 nmdc:mga0n895_124250_c1 3300050512 Bacteria 2603
422 nmdc:mga0n895_165847_c1 3300050512 Unclassified 2240
423 nmdc:mga0n895_29626_c1 3300050512 Bacteria 5224
424 nmdc:mga0n895_62162_c1 3300050512 Unclassified 3690
425 nmdc:mga0n895_751956_c1 3300050512 Bacteria 968
426 nmdc:mga0n895_8_c1 3300050512 Bacteria 121439
427 nmdc:mga0n895_91912_c1 3300050512 Bacteria 3037
428 nmdc:mga0rr50_12518_c1 3300050513 Bacteria 5489
429 nmdc:mga0rr50_135477_c1 3300050513 Bacteria 1976
430 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
431 nmdc:mga0rr50_2711_c1 3300050513 Bacteria 10045
432 nmdc:mga0rr50_35161_c1 3300050513 Bacteria 3596
433 nmdc:mga0rr50_39108_c1 3300050513 Bacteria 2716
434 nmdc:mga0rr50_9166_c1 3300050513 Bacteria 6204
435 nmdc:mga08x19_101208_c1 3300050514 Bacteria 1912
436 nmdc:mga08x19_1304_c1 3300050514 Bacteria 15487
437 nmdc:mga08x19_16723_c1 3300050514 Bacteria 4478
438 nmdc:mga08x19_195096_c1 3300050514 Unclassified 1387
439 nmdc:mga08x19_206942_c1 3300050514 Unclassified 1346
440 nmdc:mga08x19_34777_c1 3300050514 Bacteria 3186
441 nmdc:mga0a205_12794_c1 3300050515 Bacteria 7782
442 nmdc:mga0a205_155988_c1 3300050515 Unclassified 2181
443 nmdc:mga0a205_17480_c1 3300050515 Bacteria 6724
444 Ga0501084_0069151 3300054114 Bacteria 2956
445 Ga0590071_000288 3300059421 Bacteria 14684
446 Ga0590071_011180 3300059421 Bacteria 2101
447 Ga0590074_000185 3300059423 Bacteria 7856
448 Ga0590074_000356 3300059423 Bacteria 6409
449 Ga0590075_000756 3300059424 Bacteria 8574
450 Ga0590075_003127 3300059424 Unclassified 3932
451 Ga0590077_000154 3300059426 Bacteria 19232
452 Ga0590077_000988 3300059426 Bacteria 7225
453 Ga0590077_001839 3300059426 Unclassified 4717
454 Ga0501082_0110974 3300060353 Bacteria 2374
455 Ga0501082_0271846 3300060353 Bacteria 1475

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10173539 Ga0207644_101735392 273
2 3300049588 Ga0501072_0011160 Ga0501072_0011160_5862_6779 276
3 3300005327 Ga0070658_10021120 Ga0070658_100211206 279
4 3300005339 Ga0070660_100002351 Ga0070660_1000023514 279
5 3300006871 Ga0075434_100000086 Ga0075434_1000000869 281
6 3300006914 Ga0075436_100001792 Ga0075436_10000179210 281
7 3300007076 Ga0075435_100000174 Ga0075435_10000017425 281
8 3300050512 nmdc:mga0n895_8_c1 nmdc:mga0n895_8_c1_38537_39481 281
9 3300050513 nmdc:mga0rr50_23_c1 nmdc:mga0rr50_23_c1_105471_106415 281
10 3300050514 nmdc:mga08x19_1304_c1 nmdc:mga08x19_1304_c1_4173_5117 281
11 3300045976 Ga0466967_0081041 Ga0466967_0081041_1046_1981 282
12 3300005518 Ga0070699_100267658 Ga0070699_1002676581 284
13 3300005435 Ga0070714_100002662 Ga0070714_1000026628 285
14 3300005536 Ga0070697_100038479 Ga0070697_1000384796 285
15 3300049587 Ga0501071_0162761 Ga0501071_0162761_104_1012 285
16 3300005719 Ga0068861_100013307 Ga0068861_1000133074 286
17 3300005844 Ga0068862_100059529 Ga0068862_1000595292 286
18 3300006914 Ga0075436_100060988 Ga0075436_1000609882 286
19 3300025923 Ga0207681_10108208 Ga0207681_101082082 286
20 3300026118 Ga0207675_100155917 Ga0207675_1001559172 286
21 3300028380 Ga0268265_10025016 Ga0268265_100250163 286
22 3300009147 Ga0114129_10001723 Ga0114129_1000172312 287
23 3300042461 Ga0439460_0011321 Ga0439460_0011321_735_1643 287
24 3300009147 Ga0114129_10065095 Ga0114129_100650953 288
25 3300005518 Ga0070699_100077769 Ga0070699_1000777692 289
26 3300005548 Ga0070665_100114156 Ga0070665_1001141563 289
27 3300025939 Ga0207665_10120177 Ga0207665_101201773 289
28 3300046663 Ga0495635_0201182 Ga0495635_0201182_325_1317 290
29 3300050512 nmdc:mga0n895_124250_c1 nmdc:mga0n895_124250_c1_755_1648 290
30 3300050515 nmdc:mga0a205_155988_c1 nmdc:mga0a205_155988_c1_1047_1940 290
31 3300049580 Ga0501046_0255375 Ga0501046_0255375_195_1106 294
32 3300049582 Ga0501048_0256786 Ga0501048_0256786_171_1082 294
33 3300049585 Ga0501069_0189830 Ga0501069_0189830_19_930 294
34 3300049587 Ga0501071_0017869 Ga0501071_0017869_2517_3428 294
35 3300049591 Ga0501075_0058067 Ga0501075_0058067_1897_2808 294
36 3300049592 Ga0501076_0023486 Ga0501076_0023486_1712_2623 294
37 3300049741 Ga0501079_0094502 Ga0501079_0094502_102_1013 294
38 3300054114 Ga0501084_0069151 Ga0501084_0069151_2009_2920 294
39 3300009177 Ga0105248_10041443 Ga0105248_100414434 295
40 3300014325 Ga0163163_10138042 Ga0163163_101380422 295
41 3300035692 Ga0373935_0268600 Ga0373935_0268600_28_915 295
42 3300037068 Ga0373925_0014489 Ga0373925_0014489_181_1068 295
43 3300048915 Ga0496112_0541610 Ga0496112_0541610_15_902 295
44 3300050512 nmdc:mga0n895_91912_c1 nmdc:mga0n895_91912_c1_622_1509 295
45 3300050513 nmdc:mga0rr50_35161_c1 nmdc:mga0rr50_35161_c1_2663_3550 295
46 3300009094 Ga0111539_10007381 Ga0111539_100073819 297
47 3300009094 Ga0111539_10052843 Ga0111539_100528434 297
48 3300009147 Ga0114129_10042726 Ga0114129_100427263 297
49 3300009553 Ga0105249_10031781 Ga0105249_100317813 297
50 3300014326 Ga0157380_10271834 Ga0157380_102718342 297
51 3300047319 Ga0495674_0096435 Ga0495674_0096435_1123_2016 297
52 3300050507 nmdc:mga05p37_340099_c1 nmdc:mga05p37_340099_c1_139_1032 297
53 3300050510 nmdc:mga06r32_21066_c1 nmdc:mga06r32_21066_c1_11_904 297
54 3300005445 Ga0070708_100089671 Ga0070708_1000896712 298
55 3300005471 Ga0070698_100178075 Ga0070698_1001780752 298
56 3300006852 Ga0075433_10043515 Ga0075433_100435154 298
57 3300006871 Ga0075434_100024007 Ga0075434_1000240074 298
58 3300007076 Ga0075435_100002632 Ga0075435_10000263210 298
59 3300050507 nmdc:mga05p37_16330_c1 nmdc:mga05p37_16330_c1_4318_5238 298
60 3300050513 nmdc:mga0rr50_9166_c1 nmdc:mga0rr50_9166_c1_3083_3988 298
61 3300050514 nmdc:mga08x19_16723_c1 nmdc:mga08x19_16723_c1_2693_3598 298
62 3300050515 nmdc:mga0a205_17480_c1 nmdc:mga0a205_17480_c1_2301_3206 298
63 3300005354 Ga0070675_100000253 Ga0070675_10000025323 299
64 3300005618 Ga0068864_100260787 Ga0068864_1002607872 299
65 3300005718 Ga0068866_10242314 Ga0068866_102423141 299
66 3300006237 Ga0097621_100023501 Ga0097621_1000235016 299
67 3300006358 Ga0068871_100341020 Ga0068871_1003410202 299
68 3300006844 Ga0075428_100059531 Ga0075428_1000595314 299
69 3300009011 Ga0105251_10156132 Ga0105251_101561321 299
70 3300009094 Ga0111539_10016121 Ga0111539_100161218 299
71 3300009094 Ga0111539_10113768 Ga0111539_101137682 299
72 3300009147 Ga0114129_10000939 Ga0114129_1000093919 299
73 3300009176 Ga0105242_10030978 Ga0105242_100309782 299
74 3300009177 Ga0105248_10481620 Ga0105248_104816203 299
75 3300013296 Ga0157374_10150854 Ga0157374_101508542 299
76 3300025925 Ga0207650_10141917 Ga0207650_101419172 299
77 3300025926 Ga0207659_10000790 Ga0207659_100007908 299
78 3300025934 Ga0207686_10104105 Ga0207686_101041052 299
79 3300026095 Ga0207676_10028215 Ga0207676_100282155 299
80 3300028380 Ga0268265_10519034 Ga0268265_105190341 299
81 3300031824 Ga0307413_10135571 Ga0307413_101355711 299
82 3300031852 Ga0307410_10072890 Ga0307410_100728902 299
83 3300031852 Ga0307410_10118113 Ga0307410_101181132 299
84 3300031901 Ga0307406_10029089 Ga0307406_100290893 299
85 3300031903 Ga0307407_10007621 Ga0307407_100076215 299
86 3300031903 Ga0307407_10008186 Ga0307407_100081865 299
87 3300031995 Ga0307409_100003418 Ga0307409_1000034188 299
88 3300031995 Ga0307409_100161244 Ga0307409_1001612442 299
89 3300032004 Ga0307414_10302959 Ga0307414_103029592 299
90 3300032126 Ga0307415_100008970 Ga0307415_1000089704 299
91 3300035725 Ga0373947_0074550 Ga0373947_0074550_391_1344 299
92 3300046558 Ga0495633_0135787 Ga0495633_0135787_107_1006 299
93 3300050507 nmdc:mga05p37_275_c1 nmdc:mga05p37_275_c1_23468_24367 299
94 3300050514 nmdc:mga08x19_34777_c1 nmdc:mga08x19_34777_c1_1554_2495 299
95 3300059421 Ga0590071_000288 Ga0590071_000288_217_1116 299
96 3300059423 Ga0590074_000356 Ga0590074_000356_1525_2424 299
97 3300059424 Ga0590075_003127 Ga0590075_003127_1078_1977 299
98 3300059426 Ga0590077_000154 Ga0590077_000154_12041_12940 299
99 3300005548 Ga0070665_100002142 Ga0070665_1000021428 300
100 3300005618 Ga0068864_100255785 Ga0068864_1002557852 300
101 3300005841 Ga0068863_100060836 Ga0068863_1000608362 300
102 3300005842 Ga0068858_100011512 Ga0068858_1000115127 300
103 3300009177 Ga0105248_10002829 Ga0105248_100028298 300
104 3300009177 Ga0105248_10418052 Ga0105248_104180522 300
105 3300014325 Ga0163163_10003623 Ga0163163_100036235 300
106 3300025900 Ga0207710_10012841 Ga0207710_100128412 300
107 3300025941 Ga0207711_10038082 Ga0207711_100380826 300
108 3300026035 Ga0207703_10464061 Ga0207703_104640611 300
109 3300036401 Ga0373937_0100622 Ga0373937_0100622_339_1289 300
110 3300046477 Ga0495664_0098006 Ga0495664_0098006_337_1287 300
111 3300046543 Ga0495645_0001236 Ga0495645_0001236_10242_11192 300
112 3300046683 Ga0495658_0140913 Ga0495658_0140913_207_1157 300
113 3300047319 Ga0495674_0140203 Ga0495674_0140203_933_1883 300
114 3300048911 Ga0496108_0249357 Ga0496108_0249357_377_1327 300
115 3300048912 Ga0496109_0195359 Ga0496109_0195359_737_1687 300
116 3300048915 Ga0496112_0047081 Ga0496112_0047081_365_1315 300
117 3300005328 Ga0070676_10025692 Ga0070676_100256922 301
118 3300005341 Ga0070691_10159010 Ga0070691_101590101 301
119 3300005347 Ga0070668_100349160 Ga0070668_1003491601 301
120 3300005353 Ga0070669_100040437 Ga0070669_1000404374 301
121 3300005354 Ga0070675_100062460 Ga0070675_1000624602 301
122 3300005436 Ga0070713_100010796 Ga0070713_1000107964 301
123 3300005436 Ga0070713_100029301 Ga0070713_1000293013 301
124 3300005440 Ga0070705_100066016 Ga0070705_1000660162 301
125 3300005549 Ga0070704_100010966 Ga0070704_1000109665 301
126 3300005549 Ga0070704_100121913 Ga0070704_1001219132 301
127 3300005615 Ga0070702_100002245 Ga0070702_1000022455 301
128 3300005719 Ga0068861_100000990 Ga0068861_10000099010 301
129 3300005719 Ga0068861_100280118 Ga0068861_1002801182 301
130 3300005841 Ga0068863_100151221 Ga0068863_1001512212 301
131 3300005844 Ga0068862_100020513 Ga0068862_1000205136 301
132 3300005937 Ga0081455_10148489 Ga0081455_101484892 301
133 3300006028 Ga0070717_10265957 Ga0070717_102659572 301
134 3300006237 Ga0097621_100329435 Ga0097621_1003294352 301
135 3300006852 Ga0075433_10021430 Ga0075433_100214302 301
136 3300006871 Ga0075434_100006665 Ga0075434_1000066658 301
137 3300007076 Ga0075435_100043426 Ga0075435_1000434264 301
138 3300007076 Ga0075435_100071298 Ga0075435_1000712982 301
139 3300007076 Ga0075435_100172400 Ga0075435_1001724002 301
140 3300009093 Ga0105240_10009534 Ga0105240_100095345 301
141 3300009094 Ga0111539_10016736 Ga0111539_100167362 301
142 3300009147 Ga0114129_10015611 Ga0114129_100156117 301
143 3300009147 Ga0114129_10018568 Ga0114129_100185686 301
144 3300009148 Ga0105243_10012471 Ga0105243_100124716 301
145 3300009148 Ga0105243_10028881 Ga0105243_100288812 301
146 3300009176 Ga0105242_10080547 Ga0105242_100805473 301
147 3300009553 Ga0105249_10106574 Ga0105249_101065743 301
148 3300009553 Ga0105249_10567811 Ga0105249_105678111 301
149 3300013105 Ga0157369_10278067 Ga0157369_102780673 301
150 3300014326 Ga0157380_10037139 Ga0157380_100371394 301
151 3300025906 Ga0207699_10092667 Ga0207699_100926672 301
152 3300025907 Ga0207645_10001954 Ga0207645_100019548 301
153 3300025907 Ga0207645_10138402 Ga0207645_101384022 301
154 3300025912 Ga0207707_10267022 Ga0207707_102670222 301
155 3300025922 Ga0207646_10354495 Ga0207646_103544952 301
156 3300025923 Ga0207681_10063924 Ga0207681_100639244 301
157 3300025928 Ga0207700_10097795 Ga0207700_100977953 301
158 3300025932 Ga0207690_10385508 Ga0207690_103855082 301
159 3300025933 Ga0207706_10138325 Ga0207706_101383253 301
160 3300025933 Ga0207706_10211167 Ga0207706_102111672 301
161 3300025934 Ga0207686_10136918 Ga0207686_101369182 301
162 3300025935 Ga0207709_10161044 Ga0207709_101610443 301
163 3300025944 Ga0207661_10459845 Ga0207661_104598451 301
164 3300025961 Ga0207712_10022696 Ga0207712_100226964 301
165 3300025972 Ga0207668_10125297 Ga0207668_101252972 301
166 3300026075 Ga0207708_10004859 Ga0207708_100048593 301
167 3300026089 Ga0207648_10076154 Ga0207648_100761541 301
168 3300026118 Ga0207675_100002719 Ga0207675_1000027197 301
169 3300036401 Ga0373937_0001393 Ga0373937_0001393_11759_12664 301
170 3300042876 Ga0451577_0067468 Ga0451577_0067468_122_1039 301
171 3300044712 Ga0453684_0048126 Ga0453684_0048126_1702_2619 301
172 3300047319 Ga0495674_0196172 Ga0495674_0196172_585_1490 301
173 3300048915 Ga0496112_0022323 Ga0496112_0022323_2327_3232 301
174 3300048917 Ga0496114_0419836 Ga0496114_0419836_153_1088 301
175 3300050507 nmdc:mga05p37_7337_c1 nmdc:mga05p37_7337_c1_5814_6746 301
176 3300050511 nmdc:mga08y16_6653_c1 nmdc:mga08y16_6653_c1_3196_4119 301
177 3300050512 nmdc:mga0n895_29626_c1 nmdc:mga0n895_29626_c1_910_1854 301
178 3300050512 nmdc:mga0n895_62162_c1 nmdc:mga0n895_62162_c1_432_1337 301
179 3300050513 nmdc:mga0rr50_12518_c1 nmdc:mga0rr50_12518_c1_4030_4935 301
180 3300050514 nmdc:mga08x19_195096_c1 nmdc:mga08x19_195096_c1_375_1319 301
181 3300050515 nmdc:mga0a205_12794_c1 nmdc:mga0a205_12794_c1_892_1824 301
182 3300005290 Ga0065712_10133515 Ga0065712_101335152 302
183 3300005293 Ga0065715_10026638 Ga0065715_100266382 302
184 3300005293 Ga0065715_10090460 Ga0065715_100904602 302
185 3300005293 Ga0065715_10107914 Ga0065715_101079142 302
186 3300005293 Ga0065715_10129340 Ga0065715_101293402 302
187 3300005293 Ga0065715_10140628 Ga0065715_101406282 302
188 3300005293 Ga0065715_10173109 Ga0065715_101731092 302
189 3300005295 Ga0065707_10002000 Ga0065707_100020005 302
190 3300005329 Ga0070683_100007389 Ga0070683_1000073893 302
191 3300005329 Ga0070683_100116124 Ga0070683_1001161241 302
192 3300005331 Ga0070670_100031830 Ga0070670_1000318303 302
193 3300005335 Ga0070666_10013126 Ga0070666_100131263 302
194 3300005335 Ga0070666_10094283 Ga0070666_100942832 302
195 3300005338 Ga0068868_100046365 Ga0068868_1000463652 302
196 3300005339 Ga0070660_100102845 Ga0070660_1001028451 302
197 3300005340 Ga0070689_100019727 Ga0070689_1000197273 302
198 3300005343 Ga0070687_100020385 Ga0070687_1000203853 302
199 3300005353 Ga0070669_100038905 Ga0070669_1000389053 302
200 3300005353 Ga0070669_100113739 Ga0070669_1001137392 302
201 3300005354 Ga0070675_100038274 Ga0070675_1000382744 302
202 3300005354 Ga0070675_100115865 Ga0070675_1001158652 302
203 3300005356 Ga0070674_100069111 Ga0070674_1000691112 302
204 3300005364 Ga0070673_100004339 Ga0070673_1000043391 302
205 3300005365 Ga0070688_100088828 Ga0070688_1000888282 302
206 3300005367 Ga0070667_100100320 Ga0070667_1001003202 302
207 3300005367 Ga0070667_100306725 Ga0070667_1003067251 302
208 3300005439 Ga0070711_100188610 Ga0070711_1001886102 302
209 3300005441 Ga0070700_100216455 Ga0070700_1002164552 302
210 3300005456 Ga0070678_100236632 Ga0070678_1002366322 302
211 3300005457 Ga0070662_100014136 Ga0070662_1000141363 302
212 3300005457 Ga0070662_100207387 Ga0070662_1002073872 302
213 3300005457 Ga0070662_100471473 Ga0070662_1004714731 302
214 3300005458 Ga0070681_10044735 Ga0070681_100447354 302
215 3300005458 Ga0070681_10094421 Ga0070681_100944212 302
216 3300005518 Ga0070699_100003877 Ga0070699_1000038774 302
217 3300005518 Ga0070699_100057867 Ga0070699_1000578674 302
218 3300005530 Ga0070679_100011985 Ga0070679_1000119857 302
219 3300005535 Ga0070684_100000213 Ga0070684_10000021321 302
220 3300005543 Ga0070672_100017764 Ga0070672_1000177644 302
221 3300005543 Ga0070672_100106574 Ga0070672_1001065741 302
222 3300005544 Ga0070686_100000402 Ga0070686_10000040214 302
223 3300005544 Ga0070686_100060265 Ga0070686_1000602652 302
224 3300005547 Ga0070693_100031362 Ga0070693_1000313622 302
225 3300005563 Ga0068855_100004159 Ga0068855_10000415913 302
226 3300005564 Ga0070664_100000156 Ga0070664_10000015636 302
227 3300005564 Ga0070664_100127077 Ga0070664_1001270772 302
228 3300005577 Ga0068857_100014787 Ga0068857_1000147875 302
229 3300005578 Ga0068854_100066303 Ga0068854_1000663035 302
230 3300005578 Ga0068854_100078399 Ga0068854_1000783993 302
231 3300005617 Ga0068859_100127183 Ga0068859_1001271833 302
232 3300005618 Ga0068864_100041848 Ga0068864_1000418482 302
233 3300005618 Ga0068864_100104220 Ga0068864_1001042202 302
234 3300005719 Ga0068861_100080501 Ga0068861_1000805015 302
235 3300005719 Ga0068861_100337980 Ga0068861_1003379801 302
236 3300005840 Ga0068870_10129885 Ga0068870_101298852 302
237 3300005841 Ga0068863_100067820 Ga0068863_1000678203 302
238 3300005842 Ga0068858_100027466 Ga0068858_1000274662 302
239 3300005842 Ga0068858_100231893 Ga0068858_1002318932 302
240 3300005843 Ga0068860_100046416 Ga0068860_1000464163 302
241 3300005844 Ga0068862_100015306 Ga0068862_1000153064 302
242 3300006042 Ga0075368_10025116 Ga0075368_100251162 302
243 3300006042 Ga0075368_10040122 Ga0075368_100401222 302
244 3300006051 Ga0075364_10052328 Ga0075364_100523282 302
245 3300006051 Ga0075364_10210592 Ga0075364_102105922 302
246 3300006178 Ga0075367_10002285 Ga0075367_100022854 302
247 3300006178 Ga0075367_10058983 Ga0075367_100589832 302
248 3300006178 Ga0075367_10107242 Ga0075367_101072422 302
249 3300006195 Ga0075366_10010625 Ga0075366_100106252 302
250 3300006195 Ga0075366_10017597 Ga0075366_100175973 302
251 3300006195 Ga0075366_10156114 Ga0075366_101561142 302
252 3300006353 Ga0075370_10008919 Ga0075370_100089194 302
253 3300006358 Ga0068871_100052120 Ga0068871_1000521202 302
254 3300006358 Ga0068871_100090121 Ga0068871_1000901212 302
255 3300006844 Ga0075428_100003044 Ga0075428_1000030447 302
256 3300006844 Ga0075428_100393813 Ga0075428_1003938132 302
257 3300006847 Ga0075431_100041775 Ga0075431_1000417753 302
258 3300006847 Ga0075431_100076020 Ga0075431_1000760203 302
259 3300006852 Ga0075433_10002677 Ga0075433_100026778 302
260 3300006852 Ga0075433_10200391 Ga0075433_102003912 302
261 3300006871 Ga0075434_100283664 Ga0075434_1002836642 302
262 3300006871 Ga0075434_100288209 Ga0075434_1002882092 302
263 3300006880 Ga0075429_100061982 Ga0075429_1000619823 302
264 3300006880 Ga0075429_100069273 Ga0075429_1000692733 302
265 3300006881 Ga0068865_100147229 Ga0068865_1001472291 302
266 3300006914 Ga0075436_100073876 Ga0075436_1000738763 302
267 3300006931 Ga0097620_100127189 Ga0097620_1001271893 302
268 3300007076 Ga0075435_100001493 Ga0075435_10000149311 302
269 3300007076 Ga0075435_100033938 Ga0075435_1000339382 302
270 3300007076 Ga0075435_100056887 Ga0075435_1000568872 302
271 3300007076 Ga0075435_100155676 Ga0075435_1001556762 302
272 3300007265 Ga0099794_10102433 Ga0099794_101024332 302
273 3300009098 Ga0105245_10012513 Ga0105245_100125135 302
274 3300009098 Ga0105245_10026518 Ga0105245_100265187 302
275 3300009147 Ga0114129_10006311 Ga0114129_100063117 302
276 3300009147 Ga0114129_10008615 Ga0114129_100086153 302
277 3300009147 Ga0114129_10080128 Ga0114129_100801283 302
278 3300009147 Ga0114129_10086345 Ga0114129_100863453 302
279 3300009147 Ga0114129_10305331 Ga0114129_103053312 302
280 3300009147 Ga0114129_10320654 Ga0114129_103206542 302
281 3300009174 Ga0105241_10016171 Ga0105241_100161716 302
282 3300009174 Ga0105241_10109601 Ga0105241_101096012 302
283 3300009174 Ga0105241_10305966 Ga0105241_103059662 302
284 3300009176 Ga0105242_10002057 Ga0105242_100020574 302
285 3300009176 Ga0105242_10246176 Ga0105242_102461761 302
286 3300009177 Ga0105248_10026779 Ga0105248_100267794 302
287 3300009177 Ga0105248_10199687 Ga0105248_101996871 302
288 3300009553 Ga0105249_10029112 Ga0105249_100291123 302
289 3300010375 Ga0105239_10302767 Ga0105239_103027672 302
290 3300010375 Ga0105239_10367782 Ga0105239_103677822 302
291 3300013306 Ga0163162_10207193 Ga0163162_102071932 302
292 3300013308 Ga0157375_10433137 Ga0157375_104331372 302
293 3300014325 Ga0163163_10000155 Ga0163163_1000015540 302
294 3300014325 Ga0163163_10018017 Ga0163163_100180173 302
295 3300014325 Ga0163163_10051170 Ga0163163_100511703 302
296 3300014326 Ga0157380_10041387 Ga0157380_100413872 302
297 3300014326 Ga0157380_10516825 Ga0157380_105168252 302
298 3300014968 Ga0157379_10006235 Ga0157379_100062353 302
299 3300014968 Ga0157379_10330774 Ga0157379_103307742 302
300 3300014969 Ga0157376_10016212 Ga0157376_100162122 302
301 3300014969 Ga0157376_10036156 Ga0157376_100361562 302
302 3300014969 Ga0157376_10100247 Ga0157376_101002472 302
303 3300025271 Ga0207666_1011258 Ga0207666_10112582 302
304 3300025315 Ga0207697_10012847 Ga0207697_100128472 302
305 3300025315 Ga0207697_10036825 Ga0207697_100368252 302
306 3300025901 Ga0207688_10012499 Ga0207688_100124993 302
307 3300025903 Ga0207680_10143172 Ga0207680_101431723 302
308 3300025907 Ga0207645_10146583 Ga0207645_101465831 302
309 3300025908 Ga0207643_10172469 Ga0207643_101724692 302
310 3300025909 Ga0207705_10207200 Ga0207705_102072002 302
311 3300025912 Ga0207707_10114988 Ga0207707_101149882 302
312 3300025918 Ga0207662_10033527 Ga0207662_100335271 302
313 3300025919 Ga0207657_10007660 Ga0207657_1000766011 302
314 3300025919 Ga0207657_10227754 Ga0207657_102277542 302
315 3300025927 Ga0207687_10011884 Ga0207687_100118847 302
316 3300025927 Ga0207687_10037673 Ga0207687_100376733 302
317 3300025928 Ga0207700_10314319 Ga0207700_103143192 302
318 3300025932 Ga0207690_10039984 Ga0207690_100399842 302
319 3300025933 Ga0207706_10102125 Ga0207706_101021253 302
320 3300025933 Ga0207706_10183516 Ga0207706_101835162 302
321 3300025933 Ga0207706_10238013 Ga0207706_102380131 302
322 3300025934 Ga0207686_10012436 Ga0207686_100124364 302
323 3300025935 Ga0207709_10076972 Ga0207709_100769722 302
324 3300025936 Ga0207670_10069597 Ga0207670_100695973 302
325 3300025937 Ga0207669_10198343 Ga0207669_101983432 302
326 3300025938 Ga0207704_10041898 Ga0207704_100418981 302
327 3300025938 Ga0207704_10074914 Ga0207704_100749142 302
328 3300025941 Ga0207711_10170812 Ga0207711_101708122 302
329 3300025941 Ga0207711_10347471 Ga0207711_103474711 302
330 3300025942 Ga0207689_10032000 Ga0207689_100320002 302
331 3300025944 Ga0207661_10003873 Ga0207661_100038732 302
332 3300025945 Ga0207679_10009221 Ga0207679_100092216 302
333 3300025945 Ga0207679_10324232 Ga0207679_103242321 302
334 3300025960 Ga0207651_10001688 Ga0207651_100016887 302
335 3300025961 Ga0207712_10025077 Ga0207712_100250773 302
336 3300025972 Ga0207668_10156727 Ga0207668_101567272 302
337 3300025981 Ga0207640_10051567 Ga0207640_100515671 302
338 3300025986 Ga0207658_10087895 Ga0207658_100878953 302
339 3300025986 Ga0207658_10247209 Ga0207658_102472092 302
340 3300026023 Ga0207677_10074971 Ga0207677_100749712 302
341 3300026035 Ga0207703_10131545 Ga0207703_101315452 302
342 3300026075 Ga0207708_10009610 Ga0207708_100096103 302
343 3300026078 Ga0207702_10159566 Ga0207702_101595662 302
344 3300026088 Ga0207641_10074593 Ga0207641_100745933 302
345 3300026088 Ga0207641_10243233 Ga0207641_102432332 302
346 3300026089 Ga0207648_10000959 Ga0207648_1000095921 302
347 3300026089 Ga0207648_10198205 Ga0207648_101982052 302
348 3300026095 Ga0207676_10209816 Ga0207676_102098161 302
349 3300026116 Ga0207674_10154297 Ga0207674_101542972 302
350 3300026118 Ga0207675_100060920 Ga0207675_1000609205 302
351 3300026118 Ga0207675_100095148 Ga0207675_1000951482 302
352 3300026118 Ga0207675_100665399 Ga0207675_1006653991 302
353 3300026121 Ga0207683_10046286 Ga0207683_100462862 302
354 3300026142 Ga0207698_10262632 Ga0207698_102626322 302
355 3300027907 Ga0207428_10042798 Ga0207428_100427984 302
356 3300027907 Ga0207428_10276115 Ga0207428_102761152 302
357 3300028381 Ga0268264_10087723 Ga0268264_100877231 302
358 3300028381 Ga0268264_10340566 Ga0268264_103405662 302
359 3300031731 Ga0307405_10250213 Ga0307405_102502132 302
360 3300031901 Ga0307406_10096283 Ga0307406_100962832 302
361 3300031995 Ga0307409_100257579 Ga0307409_1002575791 302
362 3300031995 Ga0307409_100677999 Ga0307409_1006779992 302
363 3300032126 Ga0307415_100100428 Ga0307415_1001004282 302
364 3300034817 Ga0373948_0000421 Ga0373948_0000421_3132_4073 302
365 3300034818 Ga0373950_0018983 Ga0373950_0018983_107_1048 302
366 3300034819 Ga0373958_0000502 Ga0373958_0000502_3096_4037 302
367 3300034957 Ga0373938_0000158 Ga0373938_0000158_8420_9361 302
368 3300035084 Ga0373928_0006280 Ga0373928_0006280_1166_2107 302
369 3300035086 Ga0373934_0003609 Ga0373934_0003609_2830_3738 302
370 3300035088 Ga0373940_0000578 Ga0373940_0000578_3336_4277 302
371 3300035090 Ga0373949_0005298 Ga0373949_0005298_343_1284 302
372 3300035091 Ga0373951_0002991 Ga0373951_0002991_736_1677 302
373 3300035112 Ga0373932_0002107 Ga0373932_0002107_261_1202 302
374 3300035114 Ga0373939_0000700 Ga0373939_0000700_2750_3691 302
375 3300035115 Ga0373941_0000754 Ga0373941_0000754_2765_3706 302
376 3300035117 Ga0373953_0018120 Ga0373953_0018120_194_1102 302
377 3300035118 Ga0373954_0040967 Ga0373954_0040967_1083_1991 302
378 3300035121 Ga0373960_0000212 Ga0373960_0000212_5879_6820 302
379 3300035207 Ga0373942_0000280 Ga0373942_0000280_2513_3454 302
380 3300035241 Ga0373961_0001969 Ga0373961_0001969_2305_3246 302
381 3300035242 Ga0373962_0000486 Ga0373962_0000486_6358_7299 302
382 3300035691 Ga0373931_0006376 Ga0373931_0006376_3565_4506 302
383 3300035724 Ga0373933_0013370 Ga0373933_0013370_2672_3580 302
384 3300036401 Ga0373937_0000284 Ga0373937_0000284_14519_15427 302
385 3300037471 Ga0395905_0153751 Ga0395905_0153751_528_1436 302
386 3300042015 Ga0439462_0051874 Ga0439462_0051874_45_989 302
387 3300042435 Ga0439434_0021418 Ga0439434_0021418_446_1390 302
388 3300044712 Ga0453684_0654009 Ga0453684_0654009_28_984 302
389 3300045051 Ga0451576_0013147 Ga0451576_0013147_855_1763 302
390 3300045051 Ga0451576_0015218 Ga0451576_0015218_6803_7744 302
391 3300045051 Ga0451576_0154972 Ga0451576_0154972_119_1093 302
392 3300048905 Ga0496102_0010458 Ga0496102_0010458_3997_4908 302
393 3300048906 Ga0496103_0048553 Ga0496103_0048553_576_1487 302
394 3300048907 Ga0496104_0004973 Ga0496104_0004973_9497_10414 302
395 3300048907 Ga0496104_0229205 Ga0496104_0229205_669_1622 302
396 3300048908 Ga0496105_0023814 Ga0496105_0023814_412_1329 302
397 3300048911 Ga0496108_0002727 Ga0496108_0002727_5310_6227 302
398 3300048911 Ga0496108_0135396 Ga0496108_0135396_1045_2022 302
399 3300048912 Ga0496109_0003877 Ga0496109_0003877_8041_8958 302
400 3300048912 Ga0496109_0029415 Ga0496109_0029415_3004_3915 302
401 3300048912 Ga0496109_0258042 Ga0496109_0258042_596_1504 302
402 3300048912 Ga0496109_0299195 Ga0496109_0299195_10_957 302
403 3300048913 Ga0496110_0000648 Ga0496110_0000648_767_1684 302
404 3300048913 Ga0496110_0613159 Ga0496110_0613159_22_930 302
405 3300048915 Ga0496112_0007676 Ga0496112_0007676_7322_8239 302
406 3300048916 Ga0496113_0059021 Ga0496113_0059021_1932_2849 302
407 3300048917 Ga0496114_0043715 Ga0496114_0043715_226_1179 302
408 3300049571 Ga0501034_0287938 Ga0501034_0287938_56_964 302
409 3300049571 Ga0501034_0350428 Ga0501034_0350428_345_1253 302
410 3300049576 Ga0501040_0179405 Ga0501040_0179405_80_988 302
411 3300049581 Ga0501047_0065724 Ga0501047_0065724_344_1252 302
412 3300049586 Ga0501070_0252087 Ga0501070_0252087_307_1215 302
413 3300049591 Ga0501075_0111312 Ga0501075_0111312_1087_2007 302
414 3300049592 Ga0501076_0101600 Ga0501076_0101600_448_1356 302
415 3300049593 Ga0501077_0016739 Ga0501077_0016739_1827_2735 302
416 3300049824 Ga0501045_0375433 Ga0501045_0375433_78_986 302
417 3300050489 nmdc:mga03683_105481_c1 nmdc:mga03683_105481_c1_111_1055 302
418 3300050491 nmdc:mga00v17_71932_c1 nmdc:mga00v17_71932_c1_784_1728 302
419 3300050491 nmdc:mga00v17_8494_c1 nmdc:mga00v17_8494_c1_3750_4697 302
420 3300050492 nmdc:mga0yw44_106660_c1 nmdc:mga0yw44_106660_c1_17_964 302
421 3300050493 nmdc:mga0k408_141684_c1 nmdc:mga0k408_141684_c1_183_1094 302
422 3300050493 nmdc:mga0k408_25477_c1 nmdc:mga0k408_25477_c1_2219_3136 302
423 3300050493 nmdc:mga0k408_3316_c1 nmdc:mga0k408_3316_c1_7494_8441 302
424 3300050493 nmdc:mga0k408_3854_c1 nmdc:mga0k408_3854_c1_4848_5792 302
425 3300050494 nmdc:mga06z11_2986_c1 nmdc:mga06z11_2986_c1_3237_4181 302
426 3300050496 nmdc:mga07m45_76245_c1 nmdc:mga07m45_76245_c1_384_1331 302
427 3300050507 nmdc:mga05p37_13761_c1 nmdc:mga05p37_13761_c1_7405_8379 302
428 3300050507 nmdc:mga05p37_166585_c1 nmdc:mga05p37_166585_c1_516_1433 302
429 3300050507 nmdc:mga05p37_212429_c1 nmdc:mga05p37_212429_c1_21_947 302
430 3300050507 nmdc:mga05p37_245550_c1 nmdc:mga05p37_245550_c1_1155_2072 302
431 3300050507 nmdc:mga05p37_26012_c1 nmdc:mga05p37_26012_c1_1569_2480 302
432 3300050507 nmdc:mga05p37_27520_c1 nmdc:mga05p37_27520_c1_2010_2930 302
433 3300050508 nmdc:mga09592_362446_c1 nmdc:mga09592_362446_c1_17_925 302
434 3300050508 nmdc:mga09592_62116_c1 nmdc:mga09592_62116_c1_1813_2733 302
435 3300050509 nmdc:mga0qj67_101669_c1 nmdc:mga0qj67_101669_c1_249_1166 302
436 3300050510 nmdc:mga06r32_100237_c1 nmdc:mga06r32_100237_c1_454_1368 302
437 3300050510 nmdc:mga06r32_149712_c1 nmdc:mga06r32_149712_c1_1225_2142 302
438 3300050510 nmdc:mga06r32_175482_c1 nmdc:mga06r32_175482_c1_1186_2103 302
439 3300050510 nmdc:mga06r32_69246_c1 nmdc:mga06r32_69246_c1_719_1639 302
440 3300050511 nmdc:mga08y16_4189_c1 nmdc:mga08y16_4189_c1_6191_7099 302
441 3300050511 nmdc:mga08y16_67296_c1 nmdc:mga08y16_67296_c1_2421_3335 302
442 3300050512 nmdc:mga0n895_165847_c1 nmdc:mga0n895_165847_c1_407_1351 302
443 3300050512 nmdc:mga0n895_751956_c1 nmdc:mga0n895_751956_c1_34_945 302
444 3300050513 nmdc:mga0rr50_135477_c1 nmdc:mga0rr50_135477_c1_161_1105 302
445 3300050513 nmdc:mga0rr50_2711_c1 nmdc:mga0rr50_2711_c1_2181_3122 302
446 3300050513 nmdc:mga0rr50_39108_c1 nmdc:mga0rr50_39108_c1_1528_2436 302
447 3300050514 nmdc:mga08x19_101208_c1 nmdc:mga08x19_101208_c1_642_1583 302
448 3300050514 nmdc:mga08x19_206942_c1 nmdc:mga08x19_206942_c1_67_975 302
449 3300059421 Ga0590071_011180 Ga0590071_011180_987_1901 302
450 3300059423 Ga0590074_000185 Ga0590074_000185_5660_6574 302
451 3300059424 Ga0590075_000756 Ga0590075_000756_1163_2077 302
452 3300059426 Ga0590077_000988 Ga0590077_000988_411_1325 302
453 3300059426 Ga0590077_001839 Ga0590077_001839_2598_3512 302
454 3300060353 Ga0501082_0110974 Ga0501082_0110974_522_1451 302
455 3300060353 Ga0501082_0271846 Ga0501082_0271846_79_1038 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

69

326

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8015 12 298
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7994 6 301
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7989 7 302
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7894 6 301
4tq5-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus 0.7878 6 301
ID Description Score Start End Superfamily
af_Q57727_161_283_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8855 183 301 1.20.120.1780
af_Q57727_14_160_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8845 11 170 1.10.357.140
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8831 12 172 1.10.357.140
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8774 12 172 1.10.357.140
af_I1N2Z4_95_254_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8692 12 168 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A640XNQ0-F1-model_v4 Homogentisate phytyltransferase 0.9672 1 302 GO:0016020
GO:0016765
AF-A0A640XNQ0-F1-model_v4 Homogentisate phytyltransferase 0.964 1 302 GO:0016020
GO:0016765
AF-A0A2V8EKF6-F1-model_v4 Uncharacterized protein 0.9627 45 302 GO:0016020
GO:0016765
AF-A0A3N5X4C7-F1-model_v4 Uncharacterized protein 0.9618 1 220 GO:0016020
GO:0016765
AF-A0A7C0X498-F1-model_v4 UbiA family prenyltransferase 0.9592 151 302 GO:0016020
GO:0016765

Feature Viewer

pLDDT pTM Quality
87.19 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map