F447541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 455 | 232 | 455 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10148489|Ga0081455_101484892 |
| Length | 341 |
| Sequence | MLGRETQSSLPGRLAAVCAERRARRRELGVKCRLIAWRQAAPTQPADRGGRAGSSDPLANQAVARLARLWGTHHKLPVTAALVMPIVYGALMAAVLNAANNAVNQIYDLDIDRVNKPKRPLPSGRLTIAETWRFTVVTYLLSLVLAWLVAPGGRHECFWLVLIAVVCTFIYSVPPLRTKRLGIWANVTIAIPRGTLLKVAGWSSVKTIAGLEPWYIGAIFGLFLLGATTTKDFADMEGDRRGGCRTLPIQFGVRRAAWMISPSFVIPFTMIPIGAWLGILTGNFLLLQALGLVMTAYGIYVCYLMLRRPEDLAVEENHVSWAHMYRMMFVAQIGFALAYLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 151 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 152 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 153 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 154 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 178 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 179 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 215 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 216 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 217 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 229 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 230 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 231 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 232 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.62 |
| Nodule | 0 |
| Rhizoplane | 4.84 |
| Rhizosphere | 90.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10133515 | 3300005290 | Unclassified | 1522 |
| 2 | Ga0065715_10026638 | 3300005293 | Unclassified | 1422 |
| 3 | Ga0065715_10090460 | 3300005293 | Bacteria | 6926 |
| 4 | Ga0065715_10107914 | 3300005293 | Bacteria | 2746 |
| 5 | Ga0065715_10129340 | 3300005293 | Unclassified | 2047 |
| 6 | Ga0065715_10140628 | 3300005293 | Bacteria | 1859 |
| 7 | Ga0065715_10173109 | 3300005293 | Bacteria | 1532 |
| 8 | Ga0065707_10002000 | 3300005295 | Bacteria | 8686 |
| 9 | Ga0070658_10021120 | 3300005327 | Bacteria | 5215 |
| 10 | Ga0070676_10025692 | 3300005328 | Bacteria | 3330 |
| 11 | Ga0070683_100007389 | 3300005329 | Bacteria | 9282 |
| 12 | Ga0070683_100116124 | 3300005329 | Bacteria | 2527 |
| 13 | Ga0070670_100031830 | 3300005331 | Bacteria | 4543 |
| 14 | Ga0070666_10013126 | 3300005335 | Bacteria | 5248 |
| 15 | Ga0070666_10094283 | 3300005335 | Unclassified | 2059 |
| 16 | Ga0068868_100046365 | 3300005338 | Bacteria | 3402 |
| 17 | Ga0070660_100002351 | 3300005339 | Bacteria | 12990 |
| 18 | Ga0070660_100102845 | 3300005339 | Bacteria | 2265 |
| 19 | Ga0070689_100019727 | 3300005340 | Bacteria | 4988 |
| 20 | Ga0070691_10159010 | 3300005341 | Unclassified | 1163 |
| 21 | Ga0070687_100020385 | 3300005343 | Bacteria | 3099 |
| 22 | Ga0070668_100349160 | 3300005347 | Unclassified | 1251 |
| 23 | Ga0070669_100038905 | 3300005353 | Unclassified | 3454 |
| 24 | Ga0070669_100040437 | 3300005353 | Bacteria | 3389 |
| 25 | Ga0070669_100113739 | 3300005353 | Bacteria | 2057 |
| 26 | Ga0070675_100000253 | 3300005354 | Bacteria | 34898 |
| 27 | Ga0070675_100038274 | 3300005354 | Unclassified | 3908 |
| 28 | Ga0070675_100062460 | 3300005354 | Bacteria | 3077 |
| 29 | Ga0070675_100115865 | 3300005354 | Unclassified | 2272 |
| 30 | Ga0070674_100069111 | 3300005356 | Bacteria | 2491 |
| 31 | Ga0070673_100004339 | 3300005364 | Bacteria | 8957 |
| 32 | Ga0070688_100088828 | 3300005365 | Bacteria | 2016 |
| 33 | Ga0070667_100100320 | 3300005367 | Bacteria | 2500 |
| 34 | Ga0070667_100306725 | 3300005367 | Bacteria | 1430 |
| 35 | Ga0070714_100002662 | 3300005435 | Bacteria | 13161 |
| 36 | Ga0070713_100010796 | 3300005436 | Bacteria | 6617 |
| 37 | Ga0070713_100029301 | 3300005436 | Bacteria | 4358 |
| 38 | Ga0070711_100188610 | 3300005439 | Bacteria | 1583 |
| 39 | Ga0070705_100066016 | 3300005440 | Bacteria | 2168 |
| 40 | Ga0070700_100216455 | 3300005441 | Bacteria | 1355 |
| 41 | Ga0070708_100089671 | 3300005445 | Bacteria | 2798 |
| 42 | Ga0070678_100236632 | 3300005456 | Bacteria | 1525 |
| 43 | Ga0070662_100014136 | 3300005457 | Bacteria | 5326 |
| 44 | Ga0070662_100207387 | 3300005457 | Unclassified | 1558 |
| 45 | Ga0070662_100471473 | 3300005457 | Bacteria | 1044 |
| 46 | Ga0070681_10044735 | 3300005458 | Bacteria | 4432 |
| 47 | Ga0070681_10094421 | 3300005458 | Bacteria | 2940 |
| 48 | Ga0070698_100178075 | 3300005471 | Bacteria | 2065 |
| 49 | Ga0070699_100003877 | 3300005518 | Bacteria | 13221 |
| 50 | Ga0070699_100057867 | 3300005518 | Unclassified | 3357 |
| 51 | Ga0070699_100077769 | 3300005518 | Bacteria | 2889 |
| 52 | Ga0070699_100267658 | 3300005518 | Bacteria | 1529 |
| 53 | Ga0070679_100011985 | 3300005530 | Bacteria | 8276 |
| 54 | Ga0070684_100000213 | 3300005535 | Bacteria | 40774 |
| 55 | Ga0070697_100038479 | 3300005536 | Bacteria | 3865 |
| 56 | Ga0070672_100017764 | 3300005543 | Bacteria | 5126 |
| 57 | Ga0070672_100106574 | 3300005543 | Unclassified | 2280 |
| 58 | Ga0070686_100000402 | 3300005544 | Bacteria | 27116 |
| 59 | Ga0070686_100060265 | 3300005544 | Bacteria | 2448 |
| 60 | Ga0070693_100031362 | 3300005547 | Bacteria | 2912 |
| 61 | Ga0070665_100002142 | 3300005548 | Bacteria | 22040 |
| 62 | Ga0070665_100114156 | 3300005548 | Bacteria | 2704 |
| 63 | Ga0070704_100010966 | 3300005549 | Bacteria | 5528 |
| 64 | Ga0070704_100121913 | 3300005549 | Bacteria | 2005 |
| 65 | Ga0068855_100004159 | 3300005563 | Bacteria | 17656 |
| 66 | Ga0070664_100000156 | 3300005564 | Bacteria | 47186 |
| 67 | Ga0070664_100127077 | 3300005564 | Bacteria | 2237 |
| 68 | Ga0068857_100014787 | 3300005577 | Bacteria | 6809 |
| 69 | Ga0068854_100066303 | 3300005578 | Bacteria | 2627 |
| 70 | Ga0068854_100078399 | 3300005578 | Bacteria | 2433 |
| 71 | Ga0070702_100002245 | 3300005615 | Bacteria | 8255 |
| 72 | Ga0068859_100127183 | 3300005617 | Unclassified | 2618 |
| 73 | Ga0068864_100041848 | 3300005618 | Bacteria | 3919 |
| 74 | Ga0068864_100104220 | 3300005618 | Bacteria | 2519 |
| 75 | Ga0068864_100255785 | 3300005618 | Bacteria | 1627 |
| 76 | Ga0068864_100260787 | 3300005618 | Bacteria | 1612 |
| 77 | Ga0068866_10242314 | 3300005718 | Bacteria | 1099 |
| 78 | Ga0068861_100000990 | 3300005719 | Bacteria | 17354 |
| 79 | Ga0068861_100013307 | 3300005719 | Bacteria | 5756 |
| 80 | Ga0068861_100080501 | 3300005719 | Bacteria | 2548 |
| 81 | Ga0068861_100280118 | 3300005719 | Bacteria | 1435 |
| 82 | Ga0068861_100337980 | 3300005719 | Bacteria | 1317 |
| 83 | Ga0068870_10129885 | 3300005840 | Bacteria | 1462 |
| 84 | Ga0068863_100060836 | 3300005841 | Unclassified | 3571 |
| 85 | Ga0068863_100067820 | 3300005841 | Bacteria | 3374 |
| 86 | Ga0068863_100151221 | 3300005841 | Bacteria | 2221 |
| 87 | Ga0068858_100011512 | 3300005842 | Bacteria | 8347 |
| 88 | Ga0068858_100027466 | 3300005842 | Bacteria | 5287 |
| 89 | Ga0068858_100231893 | 3300005842 | Bacteria | 1750 |
| 90 | Ga0068860_100046416 | 3300005843 | Bacteria | 4141 |
| 91 | Ga0068862_100015306 | 3300005844 | Bacteria | 6371 |
| 92 | Ga0068862_100020513 | 3300005844 | Bacteria | 5521 |
| 93 | Ga0068862_100059529 | 3300005844 | Bacteria | 3280 |
| 94 | Ga0081455_10148489 | 3300005937 | Bacteria | 1810 |
| 95 | Ga0070717_10265957 | 3300006028 | Unclassified | 1518 |
| 96 | Ga0075368_10025116 | 3300006042 | Bacteria | 2285 |
| 97 | Ga0075368_10040122 | 3300006042 | Bacteria | 1837 |
| 98 | Ga0075364_10052328 | 3300006051 | Bacteria | 2668 |
| 99 | Ga0075364_10210592 | 3300006051 | Bacteria | 1318 |
| 100 | Ga0075367_10002285 | 3300006178 | Bacteria | 8691 |
| 101 | Ga0075367_10058983 | 3300006178 | Bacteria | 2284 |
| 102 | Ga0075367_10107242 | 3300006178 | Unclassified | 1712 |
| 103 | Ga0075366_10010625 | 3300006195 | Bacteria | 5171 |
| 104 | Ga0075366_10017597 | 3300006195 | Bacteria | 4115 |
| 105 | Ga0075366_10156114 | 3300006195 | Unclassified | 1382 |
| 106 | Ga0097621_100023501 | 3300006237 | Bacteria | 4800 |
| 107 | Ga0097621_100329435 | 3300006237 | Bacteria | 1354 |
| 108 | Ga0075370_10008919 | 3300006353 | Bacteria | 5182 |
| 109 | Ga0068871_100052120 | 3300006358 | Unclassified | 3313 |
| 110 | Ga0068871_100090121 | 3300006358 | Bacteria | 2554 |
| 111 | Ga0068871_100341020 | 3300006358 | Bacteria | 1323 |
| 112 | Ga0075428_100003044 | 3300006844 | Bacteria | 18300 |
| 113 | Ga0075428_100059531 | 3300006844 | Bacteria | 4182 |
| 114 | Ga0075428_100393813 | 3300006844 | Unclassified | 1485 |
| 115 | Ga0075431_100041775 | 3300006847 | Bacteria | 4729 |
| 116 | Ga0075431_100076020 | 3300006847 | Bacteria | 3466 |
| 117 | Ga0075433_10002677 | 3300006852 | Bacteria | 13598 |
| 118 | Ga0075433_10021430 | 3300006852 | Bacteria | 5419 |
| 119 | Ga0075433_10043515 | 3300006852 | Bacteria | 3898 |
| 120 | Ga0075433_10200391 | 3300006852 | Bacteria | 1775 |
| 121 | Ga0075434_100000086 | 3300006871 | Bacteria | 50533 |
| 122 | Ga0075434_100006665 | 3300006871 | Bacteria | 10602 |
| 123 | Ga0075434_100024007 | 3300006871 | Bacteria | 5954 |
| 124 | Ga0075434_100283664 | 3300006871 | Bacteria | 1676 |
| 125 | Ga0075434_100288209 | 3300006871 | Unclassified | 1662 |
| 126 | Ga0075429_100061982 | 3300006880 | Bacteria | 3258 |
| 127 | Ga0075429_100069273 | 3300006880 | Bacteria | 3072 |
| 128 | Ga0068865_100147229 | 3300006881 | Unclassified | 1783 |
| 129 | Ga0075436_100001792 | 3300006914 | Bacteria | 14716 |
| 130 | Ga0075436_100060988 | 3300006914 | Bacteria | 2605 |
| 131 | Ga0075436_100073876 | 3300006914 | Bacteria | 2360 |
| 132 | Ga0097620_100127189 | 3300006931 | Unclassified | 2618 |
| 133 | Ga0075435_100000174 | 3300007076 | Bacteria | 37839 |
| 134 | Ga0075435_100001493 | 3300007076 | Bacteria | 15022 |
| 135 | Ga0075435_100002632 | 3300007076 | Bacteria | 11957 |
| 136 | Ga0075435_100033938 | 3300007076 | Bacteria | 4039 |
| 137 | Ga0075435_100043426 | 3300007076 | Unclassified | 3598 |
| 138 | Ga0075435_100056887 | 3300007076 | Bacteria | 3162 |
| 139 | Ga0075435_100071298 | 3300007076 | Bacteria | 2837 |
| 140 | Ga0075435_100155676 | 3300007076 | Bacteria | 1923 |
| 141 | Ga0075435_100172400 | 3300007076 | Bacteria | 1826 |
| 142 | Ga0099794_10102433 | 3300007265 | Unclassified | 1430 |
| 143 | Ga0105251_10156132 | 3300009011 | Bacteria | 1029 |
| 144 | Ga0105240_10009534 | 3300009093 | Bacteria | 13747 |
| 145 | Ga0111539_10007381 | 3300009094 | Bacteria | 14081 |
| 146 | Ga0111539_10016121 | 3300009094 | Bacteria | 9273 |
| 147 | Ga0111539_10016736 | 3300009094 | Bacteria | 9087 |
| 148 | Ga0111539_10052843 | 3300009094 | Bacteria | 4836 |
| 149 | Ga0111539_10113768 | 3300009094 | Bacteria | 3174 |
| 150 | Ga0105245_10012513 | 3300009098 | Bacteria | 7384 |
| 151 | Ga0105245_10026518 | 3300009098 | Bacteria | 5101 |
| 152 | Ga0114129_10000939 | 3300009147 | Bacteria | 38096 |
| 153 | Ga0114129_10001723 | 3300009147 | Bacteria | 29834 |
| 154 | Ga0114129_10006311 | 3300009147 | Bacteria | 16813 |
| 155 | Ga0114129_10008615 | 3300009147 | Bacteria | 14545 |
| 156 | Ga0114129_10015611 | 3300009147 | Bacteria | 10799 |
| 157 | Ga0114129_10018568 | 3300009147 | Bacteria | 9901 |
| 158 | Ga0114129_10042726 | 3300009147 | Bacteria | 6380 |
| 159 | Ga0114129_10065095 | 3300009147 | Bacteria | 5088 |
| 160 | Ga0114129_10080128 | 3300009147 | Unclassified | 4539 |
| 161 | Ga0114129_10086345 | 3300009147 | Unclassified | 4352 |
| 162 | Ga0114129_10305331 | 3300009147 | Unclassified | 2120 |
| 163 | Ga0114129_10320654 | 3300009147 | Bacteria | 2060 |
| 164 | Ga0105243_10012471 | 3300009148 | Bacteria | 6425 |
| 165 | Ga0105243_10028881 | 3300009148 | Bacteria | 4261 |
| 166 | Ga0105241_10016171 | 3300009174 | Bacteria | 5468 |
| 167 | Ga0105241_10109601 | 3300009174 | Bacteria | 2208 |
| 168 | Ga0105241_10305966 | 3300009174 | Bacteria | 1366 |
| 169 | Ga0105242_10002057 | 3300009176 | Bacteria | 15863 |
| 170 | Ga0105242_10030978 | 3300009176 | Bacteria | 4272 |
| 171 | Ga0105242_10080547 | 3300009176 | Bacteria | 2722 |
| 172 | Ga0105242_10246176 | 3300009176 | Bacteria | 1609 |
| 173 | Ga0105248_10002829 | 3300009177 | Bacteria | 19252 |
| 174 | Ga0105248_10026779 | 3300009177 | Bacteria | 6412 |
| 175 | Ga0105248_10041443 | 3300009177 | Bacteria | 5162 |
| 176 | Ga0105248_10199687 | 3300009177 | Bacteria | 2253 |
| 177 | Ga0105248_10418052 | 3300009177 | Bacteria | 1510 |
| 178 | Ga0105248_10481620 | 3300009177 | Bacteria | 1399 |
| 179 | Ga0105249_10029112 | 3300009553 | Bacteria | 4988 |
| 180 | Ga0105249_10031781 | 3300009553 | Unclassified | 4775 |
| 181 | Ga0105249_10106574 | 3300009553 | Bacteria | 2644 |
| 182 | Ga0105249_10567811 | 3300009553 | Bacteria | 1187 |
| 183 | Ga0105239_10302767 | 3300010375 | Bacteria | 1800 |
| 184 | Ga0105239_10367782 | 3300010375 | Bacteria | 1625 |
| 185 | Ga0157369_10278067 | 3300013105 | Unclassified | 1744 |
| 186 | Ga0157374_10150854 | 3300013296 | Bacteria | 2260 |
| 187 | Ga0163162_10207193 | 3300013306 | Bacteria | 2090 |
| 188 | Ga0157375_10433137 | 3300013308 | Bacteria | 1481 |
| 189 | Ga0163163_10000155 | 3300014325 | Bacteria | 71598 |
| 190 | Ga0163163_10003623 | 3300014325 | Bacteria | 13133 |
| 191 | Ga0163163_10018017 | 3300014325 | Bacteria | 6597 |
| 192 | Ga0163163_10051170 | 3300014325 | Bacteria | 4072 |
| 193 | Ga0163163_10138042 | 3300014325 | Bacteria | 2479 |
| 194 | Ga0157380_10037139 | 3300014326 | Bacteria | 3773 |
| 195 | Ga0157380_10041387 | 3300014326 | Bacteria | 3595 |
| 196 | Ga0157380_10271834 | 3300014326 | Bacteria | 1545 |
| 197 | Ga0157380_10516825 | 3300014326 | Bacteria | 1164 |
| 198 | Ga0157379_10006235 | 3300014968 | Bacteria | 10269 |
| 199 | Ga0157379_10330774 | 3300014968 | Bacteria | 1392 |
| 200 | Ga0157376_10016212 | 3300014969 | Bacteria | 5650 |
| 201 | Ga0157376_10036156 | 3300014969 | Bacteria | 3999 |
| 202 | Ga0157376_10100247 | 3300014969 | Bacteria | 2529 |
| 203 | Ga0207666_1011258 | 3300025271 | Bacteria | 1235 |
| 204 | Ga0207697_10012847 | 3300025315 | Bacteria | 3502 |
| 205 | Ga0207697_10036825 | 3300025315 | Bacteria | 2004 |
| 206 | Ga0207710_10012841 | 3300025900 | Unclassified | 3528 |
| 207 | Ga0207688_10012499 | 3300025901 | Bacteria | 4621 |
| 208 | Ga0207680_10143172 | 3300025903 | Bacteria | 1586 |
| 209 | Ga0207699_10092667 | 3300025906 | Bacteria | 1900 |
| 210 | Ga0207645_10001954 | 3300025907 | Bacteria | 16599 |
| 211 | Ga0207645_10138402 | 3300025907 | Bacteria | 1586 |
| 212 | Ga0207645_10146583 | 3300025907 | Bacteria | 1539 |
| 213 | Ga0207643_10172469 | 3300025908 | Bacteria | 1306 |
| 214 | Ga0207705_10207200 | 3300025909 | Unclassified | 1487 |
| 215 | Ga0207707_10114988 | 3300025912 | Bacteria | 2351 |
| 216 | Ga0207707_10267022 | 3300025912 | Bacteria | 1484 |
| 217 | Ga0207662_10033527 | 3300025918 | Bacteria | 2994 |
| 218 | Ga0207657_10007660 | 3300025919 | Bacteria | 11046 |
| 219 | Ga0207657_10227754 | 3300025919 | Unclassified | 1491 |
| 220 | Ga0207646_10354495 | 3300025922 | Unclassified | 1326 |
| 221 | Ga0207681_10063924 | 3300025923 | Bacteria | 2539 |
| 222 | Ga0207681_10108208 | 3300025923 | Bacteria | 2017 |
| 223 | Ga0207650_10141917 | 3300025925 | Bacteria | 1889 |
| 224 | Ga0207659_10000790 | 3300025926 | Bacteria | 18724 |
| 225 | Ga0207687_10011884 | 3300025927 | Bacteria | 5695 |
| 226 | Ga0207687_10037673 | 3300025927 | Bacteria | 3301 |
| 227 | Ga0207700_10097795 | 3300025928 | Unclassified | 2333 |
| 228 | Ga0207700_10314319 | 3300025928 | Unclassified | 1356 |
| 229 | Ga0207644_10173539 | 3300025931 | Bacteria | 1685 |
| 230 | Ga0207690_10039984 | 3300025932 | Bacteria | 3063 |
| 231 | Ga0207690_10385508 | 3300025932 | Bacteria | 1115 |
| 232 | Ga0207706_10102125 | 3300025933 | Bacteria | 2523 |
| 233 | Ga0207706_10138325 | 3300025933 | Bacteria | 2142 |
| 234 | Ga0207706_10183516 | 3300025933 | Bacteria | 1838 |
| 235 | Ga0207706_10211167 | 3300025933 | Bacteria | 1701 |
| 236 | Ga0207706_10238013 | 3300025933 | Bacteria | 1592 |
| 237 | Ga0207686_10012436 | 3300025934 | Bacteria | 4682 |
| 238 | Ga0207686_10104105 | 3300025934 | Bacteria | 1900 |
| 239 | Ga0207686_10136918 | 3300025934 | Bacteria | 1687 |
| 240 | Ga0207709_10076972 | 3300025935 | Bacteria | 2137 |
| 241 | Ga0207709_10161044 | 3300025935 | Unclassified | 1565 |
| 242 | Ga0207670_10069597 | 3300025936 | Bacteria | 2428 |
| 243 | Ga0207669_10198343 | 3300025937 | Bacteria | 1455 |
| 244 | Ga0207704_10041898 | 3300025938 | Bacteria | 2690 |
| 245 | Ga0207704_10074914 | 3300025938 | Unclassified | 2162 |
| 246 | Ga0207665_10120177 | 3300025939 | Bacteria | 1855 |
| 247 | Ga0207711_10038082 | 3300025941 | Unclassified | 4088 |
| 248 | Ga0207711_10170812 | 3300025941 | Unclassified | 1973 |
| 249 | Ga0207711_10347471 | 3300025941 | Unclassified | 1373 |
| 250 | Ga0207689_10032000 | 3300025942 | Bacteria | 4375 |
| 251 | Ga0207661_10003873 | 3300025944 | Bacteria | 10433 |
| 252 | Ga0207661_10459845 | 3300025944 | Unclassified | 1160 |
| 253 | Ga0207679_10009221 | 3300025945 | Bacteria | 6308 |
| 254 | Ga0207679_10324232 | 3300025945 | Bacteria | 1335 |
| 255 | Ga0207651_10001688 | 3300025960 | Bacteria | 10167 |
| 256 | Ga0207712_10022696 | 3300025961 | Bacteria | 4136 |
| 257 | Ga0207712_10025077 | 3300025961 | Bacteria | 3958 |
| 258 | Ga0207668_10125297 | 3300025972 | Unclassified | 1952 |
| 259 | Ga0207668_10156727 | 3300025972 | Bacteria | 1770 |
| 260 | Ga0207640_10051567 | 3300025981 | Bacteria | 2675 |
| 261 | Ga0207658_10087895 | 3300025986 | Bacteria | 2401 |
| 262 | Ga0207658_10247209 | 3300025986 | Bacteria | 1514 |
| 263 | Ga0207677_10074971 | 3300026023 | Bacteria | 2403 |
| 264 | Ga0207703_10131545 | 3300026035 | Bacteria | 2161 |
| 265 | Ga0207703_10464061 | 3300026035 | Bacteria | 1185 |
| 266 | Ga0207708_10004859 | 3300026075 | Bacteria | 9906 |
| 267 | Ga0207708_10009610 | 3300026075 | Bacteria | 7170 |
| 268 | Ga0207702_10159566 | 3300026078 | Unclassified | 2058 |
| 269 | Ga0207641_10074593 | 3300026088 | Bacteria | 2927 |
| 270 | Ga0207641_10243233 | 3300026088 | Unclassified | 1678 |
| 271 | Ga0207648_10000959 | 3300026089 | Bacteria | 32621 |
| 272 | Ga0207648_10076154 | 3300026089 | Bacteria | 2924 |
| 273 | Ga0207648_10198205 | 3300026089 | Bacteria | 1780 |
| 274 | Ga0207676_10028215 | 3300026095 | Bacteria | 4191 |
| 275 | Ga0207676_10209816 | 3300026095 | Bacteria | 1727 |
| 276 | Ga0207674_10154297 | 3300026116 | Bacteria | 2252 |
| 277 | Ga0207675_100002719 | 3300026118 | Bacteria | 17427 |
| 278 | Ga0207675_100060920 | 3300026118 | Bacteria | 3523 |
| 279 | Ga0207675_100095148 | 3300026118 | Unclassified | 2802 |
| 280 | Ga0207675_100155917 | 3300026118 | Bacteria | 2176 |
| 281 | Ga0207675_100665399 | 3300026118 | Bacteria | 1048 |
| 282 | Ga0207683_10046286 | 3300026121 | Bacteria | 3807 |
| 283 | Ga0207698_10262632 | 3300026142 | Bacteria | 1587 |
| 284 | Ga0207428_10042798 | 3300027907 | Unclassified | 3661 |
| 285 | Ga0207428_10276115 | 3300027907 | Bacteria | 1248 |
| 286 | Ga0268265_10025016 | 3300028380 | Bacteria | 4231 |
| 287 | Ga0268265_10519034 | 3300028380 | Bacteria | 1126 |
| 288 | Ga0268264_10087723 | 3300028381 | Bacteria | 2676 |
| 289 | Ga0268264_10340566 | 3300028381 | Unclassified | 1424 |
| 290 | Ga0307405_10250213 | 3300031731 | Unclassified | 1318 |
| 291 | Ga0307413_10135571 | 3300031824 | Bacteria | 1692 |
| 292 | Ga0307410_10072890 | 3300031852 | Bacteria | 2386 |
| 293 | Ga0307410_10118113 | 3300031852 | Bacteria | 1929 |
| 294 | Ga0307406_10029089 | 3300031901 | Bacteria | 3343 |
| 295 | Ga0307406_10096283 | 3300031901 | Bacteria | 2005 |
| 296 | Ga0307407_10007621 | 3300031903 | Bacteria | 4911 |
| 297 | Ga0307407_10008186 | 3300031903 | Bacteria | 4783 |
| 298 | Ga0307409_100003418 | 3300031995 | Bacteria | 8626 |
| 299 | Ga0307409_100161244 | 3300031995 | Bacteria | 1961 |
| 300 | Ga0307409_100257579 | 3300031995 | Unclassified | 1599 |
| 301 | Ga0307409_100677999 | 3300031995 | Unclassified | 1028 |
| 302 | Ga0307414_10302959 | 3300032004 | Bacteria | 1353 |
| 303 | Ga0307415_100008970 | 3300032126 | Bacteria | 5577 |
| 304 | Ga0307415_100100428 | 3300032126 | Bacteria | 2120 |
| 305 | Ga0373948_0000421 | 3300034817 | Bacteria | 5232 |
| 306 | Ga0373950_0018983 | 3300034818 | Bacteria | 1197 |
| 307 | Ga0373958_0000502 | 3300034819 | Bacteria | 4846 |
| 308 | Ga0373938_0000158 | 3300034957 | Bacteria | 9791 |
| 309 | Ga0373928_0006280 | 3300035084 | Bacteria | 2284 |
| 310 | Ga0373934_0003609 | 3300035086 | Bacteria | 5692 |
| 311 | Ga0373940_0000578 | 3300035088 | Bacteria | 5806 |
| 312 | Ga0373949_0005298 | 3300035090 | Bacteria | 2883 |
| 313 | Ga0373951_0002991 | 3300035091 | Bacteria | 4189 |
| 314 | Ga0373932_0002107 | 3300035112 | Bacteria | 5169 |
| 315 | Ga0373939_0000700 | 3300035114 | Bacteria | 8299 |
| 316 | Ga0373941_0000754 | 3300035115 | Bacteria | 6619 |
| 317 | Ga0373953_0018120 | 3300035117 | Bacteria | 2600 |
| 318 | Ga0373954_0040967 | 3300035118 | Bacteria | 2159 |
| 319 | Ga0373960_0000212 | 3300035121 | Bacteria | 10655 |
| 320 | Ga0373942_0000280 | 3300035207 | Bacteria | 13821 |
| 321 | Ga0373961_0001969 | 3300035241 | Bacteria | 5549 |
| 322 | Ga0373962_0000486 | 3300035242 | Bacteria | 8804 |
| 323 | Ga0373931_0006376 | 3300035691 | Bacteria | 5508 |
| 324 | Ga0373935_0268600 | 3300035692 | Unclassified | 1198 |
| 325 | Ga0373933_0013370 | 3300035724 | Bacteria | 4548 |
| 326 | Ga0373947_0074550 | 3300035725 | Bacteria | 2088 |
| 327 | Ga0373937_0000284 | 3300036401 | Bacteria | 48546 |
| 328 | Ga0373937_0001393 | 3300036401 | Bacteria | 20204 |
| 329 | Ga0373937_0100622 | 3300036401 | Unclassified | 2682 |
| 330 | Ga0373925_0014489 | 3300037068 | Bacteria | 5698 |
| 331 | Ga0395905_0153751 | 3300037471 | Unclassified | 2164 |
| 332 | Ga0439462_0051874 | 3300042015 | Bacteria | 1103 |
| 333 | Ga0439434_0021418 | 3300042435 | Bacteria | 1942 |
| 334 | Ga0439460_0011321 | 3300042461 | Bacteria | 2299 |
| 335 | Ga0451577_0067468 | 3300042876 | Bacteria | 3190 |
| 336 | Ga0453684_0048126 | 3300044712 | Bacteria | 5644 |
| 337 | Ga0453684_0654009 | 3300044712 | Bacteria | 1147 |
| 338 | Ga0451576_0013147 | 3300045051 | Bacteria | 9264 |
| 339 | Ga0451576_0015218 | 3300045051 | Bacteria | 8532 |
| 340 | Ga0451576_0154972 | 3300045051 | Bacteria | 2389 |
| 341 | Ga0466967_0081041 | 3300045976 | Bacteria | 2931 |
| 342 | Ga0495664_0098006 | 3300046477 | Viruses | 1765 |
| 343 | Ga0495645_0001236 | 3300046543 | Bacteria | 17435 |
| 344 | Ga0495633_0135787 | 3300046558 | Bacteria | 1138 |
| 345 | Ga0495635_0201182 | 3300046663 | Bacteria | 1351 |
| 346 | Ga0495658_0140913 | 3300046683 | Unclassified | 1474 |
| 347 | Ga0495674_0096435 | 3300047319 | Unclassified | 2521 |
| 348 | Ga0495674_0140203 | 3300047319 | Unclassified | 2033 |
| 349 | Ga0495674_0196172 | 3300047319 | Unclassified | 1676 |
| 350 | Ga0496102_0010458 | 3300048905 | Bacteria | 7985 |
| 351 | Ga0496103_0048553 | 3300048906 | Bacteria | 2623 |
| 352 | Ga0496104_0004973 | 3300048907 | Bacteria | 11608 |
| 353 | Ga0496104_0229205 | 3300048907 | Bacteria | 1770 |
| 354 | Ga0496105_0023814 | 3300048908 | Bacteria | 4971 |
| 355 | Ga0496108_0002727 | 3300048911 | Bacteria | 14118 |
| 356 | Ga0496108_0135396 | 3300048911 | Unclassified | 2119 |
| 357 | Ga0496108_0249357 | 3300048911 | Unclassified | 1544 |
| 358 | Ga0496109_0003877 | 3300048912 | Bacteria | 12492 |
| 359 | Ga0496109_0029415 | 3300048912 | Bacteria | 4920 |
| 360 | Ga0496109_0195359 | 3300048912 | Unclassified | 1902 |
| 361 | Ga0496109_0258042 | 3300048912 | Bacteria | 1642 |
| 362 | Ga0496109_0299195 | 3300048912 | Unclassified | 1517 |
| 363 | Ga0496110_0000648 | 3300048913 | Bacteria | 23803 |
| 364 | Ga0496110_0613159 | 3300048913 | Bacteria | 987 |
| 365 | Ga0496112_0007676 | 3300048915 | Bacteria | 9598 |
| 366 | Ga0496112_0022323 | 3300048915 | Bacteria | 6031 |
| 367 | Ga0496112_0047081 | 3300048915 | Bacteria | 4230 |
| 368 | Ga0496112_0541610 | 3300048915 | Bacteria | 1098 |
| 369 | Ga0496113_0059021 | 3300048916 | Unclassified | 2889 |
| 370 | Ga0496114_0043715 | 3300048917 | Bacteria | 3715 |
| 371 | Ga0496114_0419836 | 3300048917 | Bacteria | 1185 |
| 372 | Ga0501034_0287938 | 3300049571 | Bacteria | 1581 |
| 373 | Ga0501034_0350428 | 3300049571 | Unclassified | 1405 |
| 374 | Ga0501040_0179405 | 3300049576 | Unclassified | 1501 |
| 375 | Ga0501046_0255375 | 3300049580 | Bacteria | 1289 |
| 376 | Ga0501047_0065724 | 3300049581 | Bacteria | 3496 |
| 377 | Ga0501048_0256786 | 3300049582 | Bacteria | 1241 |
| 378 | Ga0501069_0189830 | 3300049585 | Bacteria | 1189 |
| 379 | Ga0501070_0252087 | 3300049586 | Unclassified | 1444 |
| 380 | Ga0501071_0017869 | 3300049587 | Bacteria | 4901 |
| 381 | Ga0501071_0162761 | 3300049587 | Bacteria | 1668 |
| 382 | Ga0501072_0011160 | 3300049588 | Bacteria | 6858 |
| 383 | Ga0501075_0058067 | 3300049591 | Bacteria | 2914 |
| 384 | Ga0501075_0111312 | 3300049591 | Unclassified | 2082 |
| 385 | Ga0501076_0023486 | 3300049592 | Bacteria | 4754 |
| 386 | Ga0501076_0101600 | 3300049592 | Bacteria | 2318 |
| 387 | Ga0501077_0016739 | 3300049593 | Bacteria | 4623 |
| 388 | Ga0501079_0094502 | 3300049741 | Bacteria | 2317 |
| 389 | Ga0501045_0375433 | 3300049824 | Unclassified | 1058 |
| 390 | nmdc:mga03683_105481_c1 | 3300050489 | Unclassified | 1242 |
| 391 | nmdc:mga00v17_71932_c1 | 3300050491 | Bacteria | 2145 |
| 392 | nmdc:mga00v17_8494_c1 | 3300050491 | Bacteria | 5527 |
| 393 | nmdc:mga0yw44_106660_c1 | 3300050492 | Bacteria | 1791 |
| 394 | nmdc:mga0k408_141684_c1 | 3300050493 | Unclassified | 1430 |
| 395 | nmdc:mga0k408_25477_c1 | 3300050493 | Unclassified | 3350 |
| 396 | nmdc:mga0k408_3316_c1 | 3300050493 | Bacteria | 8519 |
| 397 | nmdc:mga0k408_3854_c1 | 3300050493 | Bacteria | 7950 |
| 398 | nmdc:mga06z11_2986_c1 | 3300050494 | Bacteria | 6506 |
| 399 | nmdc:mga07m45_76245_c1 | 3300050496 | Bacteria | 1912 |
| 400 | nmdc:mga05p37_13761_c1 | 3300050507 | Bacteria | 9694 |
| 401 | nmdc:mga05p37_16330_c1 | 3300050507 | Bacteria | 8938 |
| 402 | nmdc:mga05p37_166585_c1 | 3300050507 | Unclassified | 2689 |
| 403 | nmdc:mga05p37_212429_c1 | 3300050507 | Bacteria | 2338 |
| 404 | nmdc:mga05p37_245550_c1 | 3300050507 | Unclassified | 2149 |
| 405 | nmdc:mga05p37_26012_c1 | 3300050507 | Bacteria | 7115 |
| 406 | nmdc:mga05p37_27520_c1 | 3300050507 | Bacteria | 6922 |
| 407 | nmdc:mga05p37_275_c1 | 3300050507 | Bacteria | 53593 |
| 408 | nmdc:mga05p37_340099_c1 | 3300050507 | Unclassified | 1770 |
| 409 | nmdc:mga05p37_7337_c1 | 3300050507 | Bacteria | 13002 |
| 410 | nmdc:mga09592_362446_c1 | 3300050508 | Bacteria | 1254 |
| 411 | nmdc:mga09592_62116_c1 | 3300050508 | Bacteria | 3160 |
| 412 | nmdc:mga0qj67_101669_c1 | 3300050509 | Bacteria | 2318 |
| 413 | nmdc:mga06r32_100237_c1 | 3300050510 | Bacteria | 2841 |
| 414 | nmdc:mga06r32_149712_c1 | 3300050510 | Bacteria | 2312 |
| 415 | nmdc:mga06r32_175482_c1 | 3300050510 | Bacteria | 2127 |
| 416 | nmdc:mga06r32_21066_c1 | 3300050510 | Bacteria | 6014 |
| 417 | nmdc:mga06r32_69246_c1 | 3300050510 | Unclassified | 3410 |
| 418 | nmdc:mga08y16_4189_c1 | 3300050511 | Bacteria | 15070 |
| 419 | nmdc:mga08y16_6653_c1 | 3300050511 | Bacteria | 12126 |
| 420 | nmdc:mga08y16_67296_c1 | 3300050511 | Unclassified | 3736 |
| 421 | nmdc:mga0n895_124250_c1 | 3300050512 | Bacteria | 2603 |
| 422 | nmdc:mga0n895_165847_c1 | 3300050512 | Unclassified | 2240 |
| 423 | nmdc:mga0n895_29626_c1 | 3300050512 | Bacteria | 5224 |
| 424 | nmdc:mga0n895_62162_c1 | 3300050512 | Unclassified | 3690 |
| 425 | nmdc:mga0n895_751956_c1 | 3300050512 | Bacteria | 968 |
| 426 | nmdc:mga0n895_8_c1 | 3300050512 | Bacteria | 121439 |
| 427 | nmdc:mga0n895_91912_c1 | 3300050512 | Bacteria | 3037 |
| 428 | nmdc:mga0rr50_12518_c1 | 3300050513 | Bacteria | 5489 |
| 429 | nmdc:mga0rr50_135477_c1 | 3300050513 | Bacteria | 1976 |
| 430 | nmdc:mga0rr50_23_c1 | 3300050513 | Bacteria | 116800 |
| 431 | nmdc:mga0rr50_2711_c1 | 3300050513 | Bacteria | 10045 |
| 432 | nmdc:mga0rr50_35161_c1 | 3300050513 | Bacteria | 3596 |
| 433 | nmdc:mga0rr50_39108_c1 | 3300050513 | Bacteria | 2716 |
| 434 | nmdc:mga0rr50_9166_c1 | 3300050513 | Bacteria | 6204 |
| 435 | nmdc:mga08x19_101208_c1 | 3300050514 | Bacteria | 1912 |
| 436 | nmdc:mga08x19_1304_c1 | 3300050514 | Bacteria | 15487 |
| 437 | nmdc:mga08x19_16723_c1 | 3300050514 | Bacteria | 4478 |
| 438 | nmdc:mga08x19_195096_c1 | 3300050514 | Unclassified | 1387 |
| 439 | nmdc:mga08x19_206942_c1 | 3300050514 | Unclassified | 1346 |
| 440 | nmdc:mga08x19_34777_c1 | 3300050514 | Bacteria | 3186 |
| 441 | nmdc:mga0a205_12794_c1 | 3300050515 | Bacteria | 7782 |
| 442 | nmdc:mga0a205_155988_c1 | 3300050515 | Unclassified | 2181 |
| 443 | nmdc:mga0a205_17480_c1 | 3300050515 | Bacteria | 6724 |
| 444 | Ga0501084_0069151 | 3300054114 | Bacteria | 2956 |
| 445 | Ga0590071_000288 | 3300059421 | Bacteria | 14684 |
| 446 | Ga0590071_011180 | 3300059421 | Bacteria | 2101 |
| 447 | Ga0590074_000185 | 3300059423 | Bacteria | 7856 |
| 448 | Ga0590074_000356 | 3300059423 | Bacteria | 6409 |
| 449 | Ga0590075_000756 | 3300059424 | Bacteria | 8574 |
| 450 | Ga0590075_003127 | 3300059424 | Unclassified | 3932 |
| 451 | Ga0590077_000154 | 3300059426 | Bacteria | 19232 |
| 452 | Ga0590077_000988 | 3300059426 | Bacteria | 7225 |
| 453 | Ga0590077_001839 | 3300059426 | Unclassified | 4717 |
| 454 | Ga0501082_0110974 | 3300060353 | Bacteria | 2374 |
| 455 | Ga0501082_0271846 | 3300060353 | Bacteria | 1475 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025931 | Ga0207644_10173539 | Ga0207644_101735392 | 273 |
| 2 | 3300049588 | Ga0501072_0011160 | Ga0501072_0011160_5862_6779 | 276 |
| 3 | 3300005327 | Ga0070658_10021120 | Ga0070658_100211206 | 279 |
| 4 | 3300005339 | Ga0070660_100002351 | Ga0070660_1000023514 | 279 |
| 5 | 3300006871 | Ga0075434_100000086 | Ga0075434_1000000869 | 281 |
| 6 | 3300006914 | Ga0075436_100001792 | Ga0075436_10000179210 | 281 |
| 7 | 3300007076 | Ga0075435_100000174 | Ga0075435_10000017425 | 281 |
| 8 | 3300050512 | nmdc:mga0n895_8_c1 | nmdc:mga0n895_8_c1_38537_39481 | 281 |
| 9 | 3300050513 | nmdc:mga0rr50_23_c1 | nmdc:mga0rr50_23_c1_105471_106415 | 281 |
| 10 | 3300050514 | nmdc:mga08x19_1304_c1 | nmdc:mga08x19_1304_c1_4173_5117 | 281 |
| 11 | 3300045976 | Ga0466967_0081041 | Ga0466967_0081041_1046_1981 | 282 |
| 12 | 3300005518 | Ga0070699_100267658 | Ga0070699_1002676581 | 284 |
| 13 | 3300005435 | Ga0070714_100002662 | Ga0070714_1000026628 | 285 |
| 14 | 3300005536 | Ga0070697_100038479 | Ga0070697_1000384796 | 285 |
| 15 | 3300049587 | Ga0501071_0162761 | Ga0501071_0162761_104_1012 | 285 |
| 16 | 3300005719 | Ga0068861_100013307 | Ga0068861_1000133074 | 286 |
| 17 | 3300005844 | Ga0068862_100059529 | Ga0068862_1000595292 | 286 |
| 18 | 3300006914 | Ga0075436_100060988 | Ga0075436_1000609882 | 286 |
| 19 | 3300025923 | Ga0207681_10108208 | Ga0207681_101082082 | 286 |
| 20 | 3300026118 | Ga0207675_100155917 | Ga0207675_1001559172 | 286 |
| 21 | 3300028380 | Ga0268265_10025016 | Ga0268265_100250163 | 286 |
| 22 | 3300009147 | Ga0114129_10001723 | Ga0114129_1000172312 | 287 |
| 23 | 3300042461 | Ga0439460_0011321 | Ga0439460_0011321_735_1643 | 287 |
| 24 | 3300009147 | Ga0114129_10065095 | Ga0114129_100650953 | 288 |
| 25 | 3300005518 | Ga0070699_100077769 | Ga0070699_1000777692 | 289 |
| 26 | 3300005548 | Ga0070665_100114156 | Ga0070665_1001141563 | 289 |
| 27 | 3300025939 | Ga0207665_10120177 | Ga0207665_101201773 | 289 |
| 28 | 3300046663 | Ga0495635_0201182 | Ga0495635_0201182_325_1317 | 290 |
| 29 | 3300050512 | nmdc:mga0n895_124250_c1 | nmdc:mga0n895_124250_c1_755_1648 | 290 |
| 30 | 3300050515 | nmdc:mga0a205_155988_c1 | nmdc:mga0a205_155988_c1_1047_1940 | 290 |
| 31 | 3300049580 | Ga0501046_0255375 | Ga0501046_0255375_195_1106 | 294 |
| 32 | 3300049582 | Ga0501048_0256786 | Ga0501048_0256786_171_1082 | 294 |
| 33 | 3300049585 | Ga0501069_0189830 | Ga0501069_0189830_19_930 | 294 |
| 34 | 3300049587 | Ga0501071_0017869 | Ga0501071_0017869_2517_3428 | 294 |
| 35 | 3300049591 | Ga0501075_0058067 | Ga0501075_0058067_1897_2808 | 294 |
| 36 | 3300049592 | Ga0501076_0023486 | Ga0501076_0023486_1712_2623 | 294 |
| 37 | 3300049741 | Ga0501079_0094502 | Ga0501079_0094502_102_1013 | 294 |
| 38 | 3300054114 | Ga0501084_0069151 | Ga0501084_0069151_2009_2920 | 294 |
| 39 | 3300009177 | Ga0105248_10041443 | Ga0105248_100414434 | 295 |
| 40 | 3300014325 | Ga0163163_10138042 | Ga0163163_101380422 | 295 |
| 41 | 3300035692 | Ga0373935_0268600 | Ga0373935_0268600_28_915 | 295 |
| 42 | 3300037068 | Ga0373925_0014489 | Ga0373925_0014489_181_1068 | 295 |
| 43 | 3300048915 | Ga0496112_0541610 | Ga0496112_0541610_15_902 | 295 |
| 44 | 3300050512 | nmdc:mga0n895_91912_c1 | nmdc:mga0n895_91912_c1_622_1509 | 295 |
| 45 | 3300050513 | nmdc:mga0rr50_35161_c1 | nmdc:mga0rr50_35161_c1_2663_3550 | 295 |
| 46 | 3300009094 | Ga0111539_10007381 | Ga0111539_100073819 | 297 |
| 47 | 3300009094 | Ga0111539_10052843 | Ga0111539_100528434 | 297 |
| 48 | 3300009147 | Ga0114129_10042726 | Ga0114129_100427263 | 297 |
| 49 | 3300009553 | Ga0105249_10031781 | Ga0105249_100317813 | 297 |
| 50 | 3300014326 | Ga0157380_10271834 | Ga0157380_102718342 | 297 |
| 51 | 3300047319 | Ga0495674_0096435 | Ga0495674_0096435_1123_2016 | 297 |
| 52 | 3300050507 | nmdc:mga05p37_340099_c1 | nmdc:mga05p37_340099_c1_139_1032 | 297 |
| 53 | 3300050510 | nmdc:mga06r32_21066_c1 | nmdc:mga06r32_21066_c1_11_904 | 297 |
| 54 | 3300005445 | Ga0070708_100089671 | Ga0070708_1000896712 | 298 |
| 55 | 3300005471 | Ga0070698_100178075 | Ga0070698_1001780752 | 298 |
| 56 | 3300006852 | Ga0075433_10043515 | Ga0075433_100435154 | 298 |
| 57 | 3300006871 | Ga0075434_100024007 | Ga0075434_1000240074 | 298 |
| 58 | 3300007076 | Ga0075435_100002632 | Ga0075435_10000263210 | 298 |
| 59 | 3300050507 | nmdc:mga05p37_16330_c1 | nmdc:mga05p37_16330_c1_4318_5238 | 298 |
| 60 | 3300050513 | nmdc:mga0rr50_9166_c1 | nmdc:mga0rr50_9166_c1_3083_3988 | 298 |
| 61 | 3300050514 | nmdc:mga08x19_16723_c1 | nmdc:mga08x19_16723_c1_2693_3598 | 298 |
| 62 | 3300050515 | nmdc:mga0a205_17480_c1 | nmdc:mga0a205_17480_c1_2301_3206 | 298 |
| 63 | 3300005354 | Ga0070675_100000253 | Ga0070675_10000025323 | 299 |
| 64 | 3300005618 | Ga0068864_100260787 | Ga0068864_1002607872 | 299 |
| 65 | 3300005718 | Ga0068866_10242314 | Ga0068866_102423141 | 299 |
| 66 | 3300006237 | Ga0097621_100023501 | Ga0097621_1000235016 | 299 |
| 67 | 3300006358 | Ga0068871_100341020 | Ga0068871_1003410202 | 299 |
| 68 | 3300006844 | Ga0075428_100059531 | Ga0075428_1000595314 | 299 |
| 69 | 3300009011 | Ga0105251_10156132 | Ga0105251_101561321 | 299 |
| 70 | 3300009094 | Ga0111539_10016121 | Ga0111539_100161218 | 299 |
| 71 | 3300009094 | Ga0111539_10113768 | Ga0111539_101137682 | 299 |
| 72 | 3300009147 | Ga0114129_10000939 | Ga0114129_1000093919 | 299 |
| 73 | 3300009176 | Ga0105242_10030978 | Ga0105242_100309782 | 299 |
| 74 | 3300009177 | Ga0105248_10481620 | Ga0105248_104816203 | 299 |
| 75 | 3300013296 | Ga0157374_10150854 | Ga0157374_101508542 | 299 |
| 76 | 3300025925 | Ga0207650_10141917 | Ga0207650_101419172 | 299 |
| 77 | 3300025926 | Ga0207659_10000790 | Ga0207659_100007908 | 299 |
| 78 | 3300025934 | Ga0207686_10104105 | Ga0207686_101041052 | 299 |
| 79 | 3300026095 | Ga0207676_10028215 | Ga0207676_100282155 | 299 |
| 80 | 3300028380 | Ga0268265_10519034 | Ga0268265_105190341 | 299 |
| 81 | 3300031824 | Ga0307413_10135571 | Ga0307413_101355711 | 299 |
| 82 | 3300031852 | Ga0307410_10072890 | Ga0307410_100728902 | 299 |
| 83 | 3300031852 | Ga0307410_10118113 | Ga0307410_101181132 | 299 |
| 84 | 3300031901 | Ga0307406_10029089 | Ga0307406_100290893 | 299 |
| 85 | 3300031903 | Ga0307407_10007621 | Ga0307407_100076215 | 299 |
| 86 | 3300031903 | Ga0307407_10008186 | Ga0307407_100081865 | 299 |
| 87 | 3300031995 | Ga0307409_100003418 | Ga0307409_1000034188 | 299 |
| 88 | 3300031995 | Ga0307409_100161244 | Ga0307409_1001612442 | 299 |
| 89 | 3300032004 | Ga0307414_10302959 | Ga0307414_103029592 | 299 |
| 90 | 3300032126 | Ga0307415_100008970 | Ga0307415_1000089704 | 299 |
| 91 | 3300035725 | Ga0373947_0074550 | Ga0373947_0074550_391_1344 | 299 |
| 92 | 3300046558 | Ga0495633_0135787 | Ga0495633_0135787_107_1006 | 299 |
| 93 | 3300050507 | nmdc:mga05p37_275_c1 | nmdc:mga05p37_275_c1_23468_24367 | 299 |
| 94 | 3300050514 | nmdc:mga08x19_34777_c1 | nmdc:mga08x19_34777_c1_1554_2495 | 299 |
| 95 | 3300059421 | Ga0590071_000288 | Ga0590071_000288_217_1116 | 299 |
| 96 | 3300059423 | Ga0590074_000356 | Ga0590074_000356_1525_2424 | 299 |
| 97 | 3300059424 | Ga0590075_003127 | Ga0590075_003127_1078_1977 | 299 |
| 98 | 3300059426 | Ga0590077_000154 | Ga0590077_000154_12041_12940 | 299 |
| 99 | 3300005548 | Ga0070665_100002142 | Ga0070665_1000021428 | 300 |
| 100 | 3300005618 | Ga0068864_100255785 | Ga0068864_1002557852 | 300 |
| 101 | 3300005841 | Ga0068863_100060836 | Ga0068863_1000608362 | 300 |
| 102 | 3300005842 | Ga0068858_100011512 | Ga0068858_1000115127 | 300 |
| 103 | 3300009177 | Ga0105248_10002829 | Ga0105248_100028298 | 300 |
| 104 | 3300009177 | Ga0105248_10418052 | Ga0105248_104180522 | 300 |
| 105 | 3300014325 | Ga0163163_10003623 | Ga0163163_100036235 | 300 |
| 106 | 3300025900 | Ga0207710_10012841 | Ga0207710_100128412 | 300 |
| 107 | 3300025941 | Ga0207711_10038082 | Ga0207711_100380826 | 300 |
| 108 | 3300026035 | Ga0207703_10464061 | Ga0207703_104640611 | 300 |
| 109 | 3300036401 | Ga0373937_0100622 | Ga0373937_0100622_339_1289 | 300 |
| 110 | 3300046477 | Ga0495664_0098006 | Ga0495664_0098006_337_1287 | 300 |
| 111 | 3300046543 | Ga0495645_0001236 | Ga0495645_0001236_10242_11192 | 300 |
| 112 | 3300046683 | Ga0495658_0140913 | Ga0495658_0140913_207_1157 | 300 |
| 113 | 3300047319 | Ga0495674_0140203 | Ga0495674_0140203_933_1883 | 300 |
| 114 | 3300048911 | Ga0496108_0249357 | Ga0496108_0249357_377_1327 | 300 |
| 115 | 3300048912 | Ga0496109_0195359 | Ga0496109_0195359_737_1687 | 300 |
| 116 | 3300048915 | Ga0496112_0047081 | Ga0496112_0047081_365_1315 | 300 |
| 117 | 3300005328 | Ga0070676_10025692 | Ga0070676_100256922 | 301 |
| 118 | 3300005341 | Ga0070691_10159010 | Ga0070691_101590101 | 301 |
| 119 | 3300005347 | Ga0070668_100349160 | Ga0070668_1003491601 | 301 |
| 120 | 3300005353 | Ga0070669_100040437 | Ga0070669_1000404374 | 301 |
| 121 | 3300005354 | Ga0070675_100062460 | Ga0070675_1000624602 | 301 |
| 122 | 3300005436 | Ga0070713_100010796 | Ga0070713_1000107964 | 301 |
| 123 | 3300005436 | Ga0070713_100029301 | Ga0070713_1000293013 | 301 |
| 124 | 3300005440 | Ga0070705_100066016 | Ga0070705_1000660162 | 301 |
| 125 | 3300005549 | Ga0070704_100010966 | Ga0070704_1000109665 | 301 |
| 126 | 3300005549 | Ga0070704_100121913 | Ga0070704_1001219132 | 301 |
| 127 | 3300005615 | Ga0070702_100002245 | Ga0070702_1000022455 | 301 |
| 128 | 3300005719 | Ga0068861_100000990 | Ga0068861_10000099010 | 301 |
| 129 | 3300005719 | Ga0068861_100280118 | Ga0068861_1002801182 | 301 |
| 130 | 3300005841 | Ga0068863_100151221 | Ga0068863_1001512212 | 301 |
| 131 | 3300005844 | Ga0068862_100020513 | Ga0068862_1000205136 | 301 |
| 132 | 3300005937 | Ga0081455_10148489 | Ga0081455_101484892 | 301 |
| 133 | 3300006028 | Ga0070717_10265957 | Ga0070717_102659572 | 301 |
| 134 | 3300006237 | Ga0097621_100329435 | Ga0097621_1003294352 | 301 |
| 135 | 3300006852 | Ga0075433_10021430 | Ga0075433_100214302 | 301 |
| 136 | 3300006871 | Ga0075434_100006665 | Ga0075434_1000066658 | 301 |
| 137 | 3300007076 | Ga0075435_100043426 | Ga0075435_1000434264 | 301 |
| 138 | 3300007076 | Ga0075435_100071298 | Ga0075435_1000712982 | 301 |
| 139 | 3300007076 | Ga0075435_100172400 | Ga0075435_1001724002 | 301 |
| 140 | 3300009093 | Ga0105240_10009534 | Ga0105240_100095345 | 301 |
| 141 | 3300009094 | Ga0111539_10016736 | Ga0111539_100167362 | 301 |
| 142 | 3300009147 | Ga0114129_10015611 | Ga0114129_100156117 | 301 |
| 143 | 3300009147 | Ga0114129_10018568 | Ga0114129_100185686 | 301 |
| 144 | 3300009148 | Ga0105243_10012471 | Ga0105243_100124716 | 301 |
| 145 | 3300009148 | Ga0105243_10028881 | Ga0105243_100288812 | 301 |
| 146 | 3300009176 | Ga0105242_10080547 | Ga0105242_100805473 | 301 |
| 147 | 3300009553 | Ga0105249_10106574 | Ga0105249_101065743 | 301 |
| 148 | 3300009553 | Ga0105249_10567811 | Ga0105249_105678111 | 301 |
| 149 | 3300013105 | Ga0157369_10278067 | Ga0157369_102780673 | 301 |
| 150 | 3300014326 | Ga0157380_10037139 | Ga0157380_100371394 | 301 |
| 151 | 3300025906 | Ga0207699_10092667 | Ga0207699_100926672 | 301 |
| 152 | 3300025907 | Ga0207645_10001954 | Ga0207645_100019548 | 301 |
| 153 | 3300025907 | Ga0207645_10138402 | Ga0207645_101384022 | 301 |
| 154 | 3300025912 | Ga0207707_10267022 | Ga0207707_102670222 | 301 |
| 155 | 3300025922 | Ga0207646_10354495 | Ga0207646_103544952 | 301 |
| 156 | 3300025923 | Ga0207681_10063924 | Ga0207681_100639244 | 301 |
| 157 | 3300025928 | Ga0207700_10097795 | Ga0207700_100977953 | 301 |
| 158 | 3300025932 | Ga0207690_10385508 | Ga0207690_103855082 | 301 |
| 159 | 3300025933 | Ga0207706_10138325 | Ga0207706_101383253 | 301 |
| 160 | 3300025933 | Ga0207706_10211167 | Ga0207706_102111672 | 301 |
| 161 | 3300025934 | Ga0207686_10136918 | Ga0207686_101369182 | 301 |
| 162 | 3300025935 | Ga0207709_10161044 | Ga0207709_101610443 | 301 |
| 163 | 3300025944 | Ga0207661_10459845 | Ga0207661_104598451 | 301 |
| 164 | 3300025961 | Ga0207712_10022696 | Ga0207712_100226964 | 301 |
| 165 | 3300025972 | Ga0207668_10125297 | Ga0207668_101252972 | 301 |
| 166 | 3300026075 | Ga0207708_10004859 | Ga0207708_100048593 | 301 |
| 167 | 3300026089 | Ga0207648_10076154 | Ga0207648_100761541 | 301 |
| 168 | 3300026118 | Ga0207675_100002719 | Ga0207675_1000027197 | 301 |
| 169 | 3300036401 | Ga0373937_0001393 | Ga0373937_0001393_11759_12664 | 301 |
| 170 | 3300042876 | Ga0451577_0067468 | Ga0451577_0067468_122_1039 | 301 |
| 171 | 3300044712 | Ga0453684_0048126 | Ga0453684_0048126_1702_2619 | 301 |
| 172 | 3300047319 | Ga0495674_0196172 | Ga0495674_0196172_585_1490 | 301 |
| 173 | 3300048915 | Ga0496112_0022323 | Ga0496112_0022323_2327_3232 | 301 |
| 174 | 3300048917 | Ga0496114_0419836 | Ga0496114_0419836_153_1088 | 301 |
| 175 | 3300050507 | nmdc:mga05p37_7337_c1 | nmdc:mga05p37_7337_c1_5814_6746 | 301 |
| 176 | 3300050511 | nmdc:mga08y16_6653_c1 | nmdc:mga08y16_6653_c1_3196_4119 | 301 |
| 177 | 3300050512 | nmdc:mga0n895_29626_c1 | nmdc:mga0n895_29626_c1_910_1854 | 301 |
| 178 | 3300050512 | nmdc:mga0n895_62162_c1 | nmdc:mga0n895_62162_c1_432_1337 | 301 |
| 179 | 3300050513 | nmdc:mga0rr50_12518_c1 | nmdc:mga0rr50_12518_c1_4030_4935 | 301 |
| 180 | 3300050514 | nmdc:mga08x19_195096_c1 | nmdc:mga08x19_195096_c1_375_1319 | 301 |
| 181 | 3300050515 | nmdc:mga0a205_12794_c1 | nmdc:mga0a205_12794_c1_892_1824 | 301 |
| 182 | 3300005290 | Ga0065712_10133515 | Ga0065712_101335152 | 302 |
| 183 | 3300005293 | Ga0065715_10026638 | Ga0065715_100266382 | 302 |
| 184 | 3300005293 | Ga0065715_10090460 | Ga0065715_100904602 | 302 |
| 185 | 3300005293 | Ga0065715_10107914 | Ga0065715_101079142 | 302 |
| 186 | 3300005293 | Ga0065715_10129340 | Ga0065715_101293402 | 302 |
| 187 | 3300005293 | Ga0065715_10140628 | Ga0065715_101406282 | 302 |
| 188 | 3300005293 | Ga0065715_10173109 | Ga0065715_101731092 | 302 |
| 189 | 3300005295 | Ga0065707_10002000 | Ga0065707_100020005 | 302 |
| 190 | 3300005329 | Ga0070683_100007389 | Ga0070683_1000073893 | 302 |
| 191 | 3300005329 | Ga0070683_100116124 | Ga0070683_1001161241 | 302 |
| 192 | 3300005331 | Ga0070670_100031830 | Ga0070670_1000318303 | 302 |
| 193 | 3300005335 | Ga0070666_10013126 | Ga0070666_100131263 | 302 |
| 194 | 3300005335 | Ga0070666_10094283 | Ga0070666_100942832 | 302 |
| 195 | 3300005338 | Ga0068868_100046365 | Ga0068868_1000463652 | 302 |
| 196 | 3300005339 | Ga0070660_100102845 | Ga0070660_1001028451 | 302 |
| 197 | 3300005340 | Ga0070689_100019727 | Ga0070689_1000197273 | 302 |
| 198 | 3300005343 | Ga0070687_100020385 | Ga0070687_1000203853 | 302 |
| 199 | 3300005353 | Ga0070669_100038905 | Ga0070669_1000389053 | 302 |
| 200 | 3300005353 | Ga0070669_100113739 | Ga0070669_1001137392 | 302 |
| 201 | 3300005354 | Ga0070675_100038274 | Ga0070675_1000382744 | 302 |
| 202 | 3300005354 | Ga0070675_100115865 | Ga0070675_1001158652 | 302 |
| 203 | 3300005356 | Ga0070674_100069111 | Ga0070674_1000691112 | 302 |
| 204 | 3300005364 | Ga0070673_100004339 | Ga0070673_1000043391 | 302 |
| 205 | 3300005365 | Ga0070688_100088828 | Ga0070688_1000888282 | 302 |
| 206 | 3300005367 | Ga0070667_100100320 | Ga0070667_1001003202 | 302 |
| 207 | 3300005367 | Ga0070667_100306725 | Ga0070667_1003067251 | 302 |
| 208 | 3300005439 | Ga0070711_100188610 | Ga0070711_1001886102 | 302 |
| 209 | 3300005441 | Ga0070700_100216455 | Ga0070700_1002164552 | 302 |
| 210 | 3300005456 | Ga0070678_100236632 | Ga0070678_1002366322 | 302 |
| 211 | 3300005457 | Ga0070662_100014136 | Ga0070662_1000141363 | 302 |
| 212 | 3300005457 | Ga0070662_100207387 | Ga0070662_1002073872 | 302 |
| 213 | 3300005457 | Ga0070662_100471473 | Ga0070662_1004714731 | 302 |
| 214 | 3300005458 | Ga0070681_10044735 | Ga0070681_100447354 | 302 |
| 215 | 3300005458 | Ga0070681_10094421 | Ga0070681_100944212 | 302 |
| 216 | 3300005518 | Ga0070699_100003877 | Ga0070699_1000038774 | 302 |
| 217 | 3300005518 | Ga0070699_100057867 | Ga0070699_1000578674 | 302 |
| 218 | 3300005530 | Ga0070679_100011985 | Ga0070679_1000119857 | 302 |
| 219 | 3300005535 | Ga0070684_100000213 | Ga0070684_10000021321 | 302 |
| 220 | 3300005543 | Ga0070672_100017764 | Ga0070672_1000177644 | 302 |
| 221 | 3300005543 | Ga0070672_100106574 | Ga0070672_1001065741 | 302 |
| 222 | 3300005544 | Ga0070686_100000402 | Ga0070686_10000040214 | 302 |
| 223 | 3300005544 | Ga0070686_100060265 | Ga0070686_1000602652 | 302 |
| 224 | 3300005547 | Ga0070693_100031362 | Ga0070693_1000313622 | 302 |
| 225 | 3300005563 | Ga0068855_100004159 | Ga0068855_10000415913 | 302 |
| 226 | 3300005564 | Ga0070664_100000156 | Ga0070664_10000015636 | 302 |
| 227 | 3300005564 | Ga0070664_100127077 | Ga0070664_1001270772 | 302 |
| 228 | 3300005577 | Ga0068857_100014787 | Ga0068857_1000147875 | 302 |
| 229 | 3300005578 | Ga0068854_100066303 | Ga0068854_1000663035 | 302 |
| 230 | 3300005578 | Ga0068854_100078399 | Ga0068854_1000783993 | 302 |
| 231 | 3300005617 | Ga0068859_100127183 | Ga0068859_1001271833 | 302 |
| 232 | 3300005618 | Ga0068864_100041848 | Ga0068864_1000418482 | 302 |
| 233 | 3300005618 | Ga0068864_100104220 | Ga0068864_1001042202 | 302 |
| 234 | 3300005719 | Ga0068861_100080501 | Ga0068861_1000805015 | 302 |
| 235 | 3300005719 | Ga0068861_100337980 | Ga0068861_1003379801 | 302 |
| 236 | 3300005840 | Ga0068870_10129885 | Ga0068870_101298852 | 302 |
| 237 | 3300005841 | Ga0068863_100067820 | Ga0068863_1000678203 | 302 |
| 238 | 3300005842 | Ga0068858_100027466 | Ga0068858_1000274662 | 302 |
| 239 | 3300005842 | Ga0068858_100231893 | Ga0068858_1002318932 | 302 |
| 240 | 3300005843 | Ga0068860_100046416 | Ga0068860_1000464163 | 302 |
| 241 | 3300005844 | Ga0068862_100015306 | Ga0068862_1000153064 | 302 |
| 242 | 3300006042 | Ga0075368_10025116 | Ga0075368_100251162 | 302 |
| 243 | 3300006042 | Ga0075368_10040122 | Ga0075368_100401222 | 302 |
| 244 | 3300006051 | Ga0075364_10052328 | Ga0075364_100523282 | 302 |
| 245 | 3300006051 | Ga0075364_10210592 | Ga0075364_102105922 | 302 |
| 246 | 3300006178 | Ga0075367_10002285 | Ga0075367_100022854 | 302 |
| 247 | 3300006178 | Ga0075367_10058983 | Ga0075367_100589832 | 302 |
| 248 | 3300006178 | Ga0075367_10107242 | Ga0075367_101072422 | 302 |
| 249 | 3300006195 | Ga0075366_10010625 | Ga0075366_100106252 | 302 |
| 250 | 3300006195 | Ga0075366_10017597 | Ga0075366_100175973 | 302 |
| 251 | 3300006195 | Ga0075366_10156114 | Ga0075366_101561142 | 302 |
| 252 | 3300006353 | Ga0075370_10008919 | Ga0075370_100089194 | 302 |
| 253 | 3300006358 | Ga0068871_100052120 | Ga0068871_1000521202 | 302 |
| 254 | 3300006358 | Ga0068871_100090121 | Ga0068871_1000901212 | 302 |
| 255 | 3300006844 | Ga0075428_100003044 | Ga0075428_1000030447 | 302 |
| 256 | 3300006844 | Ga0075428_100393813 | Ga0075428_1003938132 | 302 |
| 257 | 3300006847 | Ga0075431_100041775 | Ga0075431_1000417753 | 302 |
| 258 | 3300006847 | Ga0075431_100076020 | Ga0075431_1000760203 | 302 |
| 259 | 3300006852 | Ga0075433_10002677 | Ga0075433_100026778 | 302 |
| 260 | 3300006852 | Ga0075433_10200391 | Ga0075433_102003912 | 302 |
| 261 | 3300006871 | Ga0075434_100283664 | Ga0075434_1002836642 | 302 |
| 262 | 3300006871 | Ga0075434_100288209 | Ga0075434_1002882092 | 302 |
| 263 | 3300006880 | Ga0075429_100061982 | Ga0075429_1000619823 | 302 |
| 264 | 3300006880 | Ga0075429_100069273 | Ga0075429_1000692733 | 302 |
| 265 | 3300006881 | Ga0068865_100147229 | Ga0068865_1001472291 | 302 |
| 266 | 3300006914 | Ga0075436_100073876 | Ga0075436_1000738763 | 302 |
| 267 | 3300006931 | Ga0097620_100127189 | Ga0097620_1001271893 | 302 |
| 268 | 3300007076 | Ga0075435_100001493 | Ga0075435_10000149311 | 302 |
| 269 | 3300007076 | Ga0075435_100033938 | Ga0075435_1000339382 | 302 |
| 270 | 3300007076 | Ga0075435_100056887 | Ga0075435_1000568872 | 302 |
| 271 | 3300007076 | Ga0075435_100155676 | Ga0075435_1001556762 | 302 |
| 272 | 3300007265 | Ga0099794_10102433 | Ga0099794_101024332 | 302 |
| 273 | 3300009098 | Ga0105245_10012513 | Ga0105245_100125135 | 302 |
| 274 | 3300009098 | Ga0105245_10026518 | Ga0105245_100265187 | 302 |
| 275 | 3300009147 | Ga0114129_10006311 | Ga0114129_100063117 | 302 |
| 276 | 3300009147 | Ga0114129_10008615 | Ga0114129_100086153 | 302 |
| 277 | 3300009147 | Ga0114129_10080128 | Ga0114129_100801283 | 302 |
| 278 | 3300009147 | Ga0114129_10086345 | Ga0114129_100863453 | 302 |
| 279 | 3300009147 | Ga0114129_10305331 | Ga0114129_103053312 | 302 |
| 280 | 3300009147 | Ga0114129_10320654 | Ga0114129_103206542 | 302 |
| 281 | 3300009174 | Ga0105241_10016171 | Ga0105241_100161716 | 302 |
| 282 | 3300009174 | Ga0105241_10109601 | Ga0105241_101096012 | 302 |
| 283 | 3300009174 | Ga0105241_10305966 | Ga0105241_103059662 | 302 |
| 284 | 3300009176 | Ga0105242_10002057 | Ga0105242_100020574 | 302 |
| 285 | 3300009176 | Ga0105242_10246176 | Ga0105242_102461761 | 302 |
| 286 | 3300009177 | Ga0105248_10026779 | Ga0105248_100267794 | 302 |
| 287 | 3300009177 | Ga0105248_10199687 | Ga0105248_101996871 | 302 |
| 288 | 3300009553 | Ga0105249_10029112 | Ga0105249_100291123 | 302 |
| 289 | 3300010375 | Ga0105239_10302767 | Ga0105239_103027672 | 302 |
| 290 | 3300010375 | Ga0105239_10367782 | Ga0105239_103677822 | 302 |
| 291 | 3300013306 | Ga0163162_10207193 | Ga0163162_102071932 | 302 |
| 292 | 3300013308 | Ga0157375_10433137 | Ga0157375_104331372 | 302 |
| 293 | 3300014325 | Ga0163163_10000155 | Ga0163163_1000015540 | 302 |
| 294 | 3300014325 | Ga0163163_10018017 | Ga0163163_100180173 | 302 |
| 295 | 3300014325 | Ga0163163_10051170 | Ga0163163_100511703 | 302 |
| 296 | 3300014326 | Ga0157380_10041387 | Ga0157380_100413872 | 302 |
| 297 | 3300014326 | Ga0157380_10516825 | Ga0157380_105168252 | 302 |
| 298 | 3300014968 | Ga0157379_10006235 | Ga0157379_100062353 | 302 |
| 299 | 3300014968 | Ga0157379_10330774 | Ga0157379_103307742 | 302 |
| 300 | 3300014969 | Ga0157376_10016212 | Ga0157376_100162122 | 302 |
| 301 | 3300014969 | Ga0157376_10036156 | Ga0157376_100361562 | 302 |
| 302 | 3300014969 | Ga0157376_10100247 | Ga0157376_101002472 | 302 |
| 303 | 3300025271 | Ga0207666_1011258 | Ga0207666_10112582 | 302 |
| 304 | 3300025315 | Ga0207697_10012847 | Ga0207697_100128472 | 302 |
| 305 | 3300025315 | Ga0207697_10036825 | Ga0207697_100368252 | 302 |
| 306 | 3300025901 | Ga0207688_10012499 | Ga0207688_100124993 | 302 |
| 307 | 3300025903 | Ga0207680_10143172 | Ga0207680_101431723 | 302 |
| 308 | 3300025907 | Ga0207645_10146583 | Ga0207645_101465831 | 302 |
| 309 | 3300025908 | Ga0207643_10172469 | Ga0207643_101724692 | 302 |
| 310 | 3300025909 | Ga0207705_10207200 | Ga0207705_102072002 | 302 |
| 311 | 3300025912 | Ga0207707_10114988 | Ga0207707_101149882 | 302 |
| 312 | 3300025918 | Ga0207662_10033527 | Ga0207662_100335271 | 302 |
| 313 | 3300025919 | Ga0207657_10007660 | Ga0207657_1000766011 | 302 |
| 314 | 3300025919 | Ga0207657_10227754 | Ga0207657_102277542 | 302 |
| 315 | 3300025927 | Ga0207687_10011884 | Ga0207687_100118847 | 302 |
| 316 | 3300025927 | Ga0207687_10037673 | Ga0207687_100376733 | 302 |
| 317 | 3300025928 | Ga0207700_10314319 | Ga0207700_103143192 | 302 |
| 318 | 3300025932 | Ga0207690_10039984 | Ga0207690_100399842 | 302 |
| 319 | 3300025933 | Ga0207706_10102125 | Ga0207706_101021253 | 302 |
| 320 | 3300025933 | Ga0207706_10183516 | Ga0207706_101835162 | 302 |
| 321 | 3300025933 | Ga0207706_10238013 | Ga0207706_102380131 | 302 |
| 322 | 3300025934 | Ga0207686_10012436 | Ga0207686_100124364 | 302 |
| 323 | 3300025935 | Ga0207709_10076972 | Ga0207709_100769722 | 302 |
| 324 | 3300025936 | Ga0207670_10069597 | Ga0207670_100695973 | 302 |
| 325 | 3300025937 | Ga0207669_10198343 | Ga0207669_101983432 | 302 |
| 326 | 3300025938 | Ga0207704_10041898 | Ga0207704_100418981 | 302 |
| 327 | 3300025938 | Ga0207704_10074914 | Ga0207704_100749142 | 302 |
| 328 | 3300025941 | Ga0207711_10170812 | Ga0207711_101708122 | 302 |
| 329 | 3300025941 | Ga0207711_10347471 | Ga0207711_103474711 | 302 |
| 330 | 3300025942 | Ga0207689_10032000 | Ga0207689_100320002 | 302 |
| 331 | 3300025944 | Ga0207661_10003873 | Ga0207661_100038732 | 302 |
| 332 | 3300025945 | Ga0207679_10009221 | Ga0207679_100092216 | 302 |
| 333 | 3300025945 | Ga0207679_10324232 | Ga0207679_103242321 | 302 |
| 334 | 3300025960 | Ga0207651_10001688 | Ga0207651_100016887 | 302 |
| 335 | 3300025961 | Ga0207712_10025077 | Ga0207712_100250773 | 302 |
| 336 | 3300025972 | Ga0207668_10156727 | Ga0207668_101567272 | 302 |
| 337 | 3300025981 | Ga0207640_10051567 | Ga0207640_100515671 | 302 |
| 338 | 3300025986 | Ga0207658_10087895 | Ga0207658_100878953 | 302 |
| 339 | 3300025986 | Ga0207658_10247209 | Ga0207658_102472092 | 302 |
| 340 | 3300026023 | Ga0207677_10074971 | Ga0207677_100749712 | 302 |
| 341 | 3300026035 | Ga0207703_10131545 | Ga0207703_101315452 | 302 |
| 342 | 3300026075 | Ga0207708_10009610 | Ga0207708_100096103 | 302 |
| 343 | 3300026078 | Ga0207702_10159566 | Ga0207702_101595662 | 302 |
| 344 | 3300026088 | Ga0207641_10074593 | Ga0207641_100745933 | 302 |
| 345 | 3300026088 | Ga0207641_10243233 | Ga0207641_102432332 | 302 |
| 346 | 3300026089 | Ga0207648_10000959 | Ga0207648_1000095921 | 302 |
| 347 | 3300026089 | Ga0207648_10198205 | Ga0207648_101982052 | 302 |
| 348 | 3300026095 | Ga0207676_10209816 | Ga0207676_102098161 | 302 |
| 349 | 3300026116 | Ga0207674_10154297 | Ga0207674_101542972 | 302 |
| 350 | 3300026118 | Ga0207675_100060920 | Ga0207675_1000609205 | 302 |
| 351 | 3300026118 | Ga0207675_100095148 | Ga0207675_1000951482 | 302 |
| 352 | 3300026118 | Ga0207675_100665399 | Ga0207675_1006653991 | 302 |
| 353 | 3300026121 | Ga0207683_10046286 | Ga0207683_100462862 | 302 |
| 354 | 3300026142 | Ga0207698_10262632 | Ga0207698_102626322 | 302 |
| 355 | 3300027907 | Ga0207428_10042798 | Ga0207428_100427984 | 302 |
| 356 | 3300027907 | Ga0207428_10276115 | Ga0207428_102761152 | 302 |
| 357 | 3300028381 | Ga0268264_10087723 | Ga0268264_100877231 | 302 |
| 358 | 3300028381 | Ga0268264_10340566 | Ga0268264_103405662 | 302 |
| 359 | 3300031731 | Ga0307405_10250213 | Ga0307405_102502132 | 302 |
| 360 | 3300031901 | Ga0307406_10096283 | Ga0307406_100962832 | 302 |
| 361 | 3300031995 | Ga0307409_100257579 | Ga0307409_1002575791 | 302 |
| 362 | 3300031995 | Ga0307409_100677999 | Ga0307409_1006779992 | 302 |
| 363 | 3300032126 | Ga0307415_100100428 | Ga0307415_1001004282 | 302 |
| 364 | 3300034817 | Ga0373948_0000421 | Ga0373948_0000421_3132_4073 | 302 |
| 365 | 3300034818 | Ga0373950_0018983 | Ga0373950_0018983_107_1048 | 302 |
| 366 | 3300034819 | Ga0373958_0000502 | Ga0373958_0000502_3096_4037 | 302 |
| 367 | 3300034957 | Ga0373938_0000158 | Ga0373938_0000158_8420_9361 | 302 |
| 368 | 3300035084 | Ga0373928_0006280 | Ga0373928_0006280_1166_2107 | 302 |
| 369 | 3300035086 | Ga0373934_0003609 | Ga0373934_0003609_2830_3738 | 302 |
| 370 | 3300035088 | Ga0373940_0000578 | Ga0373940_0000578_3336_4277 | 302 |
| 371 | 3300035090 | Ga0373949_0005298 | Ga0373949_0005298_343_1284 | 302 |
| 372 | 3300035091 | Ga0373951_0002991 | Ga0373951_0002991_736_1677 | 302 |
| 373 | 3300035112 | Ga0373932_0002107 | Ga0373932_0002107_261_1202 | 302 |
| 374 | 3300035114 | Ga0373939_0000700 | Ga0373939_0000700_2750_3691 | 302 |
| 375 | 3300035115 | Ga0373941_0000754 | Ga0373941_0000754_2765_3706 | 302 |
| 376 | 3300035117 | Ga0373953_0018120 | Ga0373953_0018120_194_1102 | 302 |
| 377 | 3300035118 | Ga0373954_0040967 | Ga0373954_0040967_1083_1991 | 302 |
| 378 | 3300035121 | Ga0373960_0000212 | Ga0373960_0000212_5879_6820 | 302 |
| 379 | 3300035207 | Ga0373942_0000280 | Ga0373942_0000280_2513_3454 | 302 |
| 380 | 3300035241 | Ga0373961_0001969 | Ga0373961_0001969_2305_3246 | 302 |
| 381 | 3300035242 | Ga0373962_0000486 | Ga0373962_0000486_6358_7299 | 302 |
| 382 | 3300035691 | Ga0373931_0006376 | Ga0373931_0006376_3565_4506 | 302 |
| 383 | 3300035724 | Ga0373933_0013370 | Ga0373933_0013370_2672_3580 | 302 |
| 384 | 3300036401 | Ga0373937_0000284 | Ga0373937_0000284_14519_15427 | 302 |
| 385 | 3300037471 | Ga0395905_0153751 | Ga0395905_0153751_528_1436 | 302 |
| 386 | 3300042015 | Ga0439462_0051874 | Ga0439462_0051874_45_989 | 302 |
| 387 | 3300042435 | Ga0439434_0021418 | Ga0439434_0021418_446_1390 | 302 |
| 388 | 3300044712 | Ga0453684_0654009 | Ga0453684_0654009_28_984 | 302 |
| 389 | 3300045051 | Ga0451576_0013147 | Ga0451576_0013147_855_1763 | 302 |
| 390 | 3300045051 | Ga0451576_0015218 | Ga0451576_0015218_6803_7744 | 302 |
| 391 | 3300045051 | Ga0451576_0154972 | Ga0451576_0154972_119_1093 | 302 |
| 392 | 3300048905 | Ga0496102_0010458 | Ga0496102_0010458_3997_4908 | 302 |
| 393 | 3300048906 | Ga0496103_0048553 | Ga0496103_0048553_576_1487 | 302 |
| 394 | 3300048907 | Ga0496104_0004973 | Ga0496104_0004973_9497_10414 | 302 |
| 395 | 3300048907 | Ga0496104_0229205 | Ga0496104_0229205_669_1622 | 302 |
| 396 | 3300048908 | Ga0496105_0023814 | Ga0496105_0023814_412_1329 | 302 |
| 397 | 3300048911 | Ga0496108_0002727 | Ga0496108_0002727_5310_6227 | 302 |
| 398 | 3300048911 | Ga0496108_0135396 | Ga0496108_0135396_1045_2022 | 302 |
| 399 | 3300048912 | Ga0496109_0003877 | Ga0496109_0003877_8041_8958 | 302 |
| 400 | 3300048912 | Ga0496109_0029415 | Ga0496109_0029415_3004_3915 | 302 |
| 401 | 3300048912 | Ga0496109_0258042 | Ga0496109_0258042_596_1504 | 302 |
| 402 | 3300048912 | Ga0496109_0299195 | Ga0496109_0299195_10_957 | 302 |
| 403 | 3300048913 | Ga0496110_0000648 | Ga0496110_0000648_767_1684 | 302 |
| 404 | 3300048913 | Ga0496110_0613159 | Ga0496110_0613159_22_930 | 302 |
| 405 | 3300048915 | Ga0496112_0007676 | Ga0496112_0007676_7322_8239 | 302 |
| 406 | 3300048916 | Ga0496113_0059021 | Ga0496113_0059021_1932_2849 | 302 |
| 407 | 3300048917 | Ga0496114_0043715 | Ga0496114_0043715_226_1179 | 302 |
| 408 | 3300049571 | Ga0501034_0287938 | Ga0501034_0287938_56_964 | 302 |
| 409 | 3300049571 | Ga0501034_0350428 | Ga0501034_0350428_345_1253 | 302 |
| 410 | 3300049576 | Ga0501040_0179405 | Ga0501040_0179405_80_988 | 302 |
| 411 | 3300049581 | Ga0501047_0065724 | Ga0501047_0065724_344_1252 | 302 |
| 412 | 3300049586 | Ga0501070_0252087 | Ga0501070_0252087_307_1215 | 302 |
| 413 | 3300049591 | Ga0501075_0111312 | Ga0501075_0111312_1087_2007 | 302 |
| 414 | 3300049592 | Ga0501076_0101600 | Ga0501076_0101600_448_1356 | 302 |
| 415 | 3300049593 | Ga0501077_0016739 | Ga0501077_0016739_1827_2735 | 302 |
| 416 | 3300049824 | Ga0501045_0375433 | Ga0501045_0375433_78_986 | 302 |
| 417 | 3300050489 | nmdc:mga03683_105481_c1 | nmdc:mga03683_105481_c1_111_1055 | 302 |
| 418 | 3300050491 | nmdc:mga00v17_71932_c1 | nmdc:mga00v17_71932_c1_784_1728 | 302 |
| 419 | 3300050491 | nmdc:mga00v17_8494_c1 | nmdc:mga00v17_8494_c1_3750_4697 | 302 |
| 420 | 3300050492 | nmdc:mga0yw44_106660_c1 | nmdc:mga0yw44_106660_c1_17_964 | 302 |
| 421 | 3300050493 | nmdc:mga0k408_141684_c1 | nmdc:mga0k408_141684_c1_183_1094 | 302 |
| 422 | 3300050493 | nmdc:mga0k408_25477_c1 | nmdc:mga0k408_25477_c1_2219_3136 | 302 |
| 423 | 3300050493 | nmdc:mga0k408_3316_c1 | nmdc:mga0k408_3316_c1_7494_8441 | 302 |
| 424 | 3300050493 | nmdc:mga0k408_3854_c1 | nmdc:mga0k408_3854_c1_4848_5792 | 302 |
| 425 | 3300050494 | nmdc:mga06z11_2986_c1 | nmdc:mga06z11_2986_c1_3237_4181 | 302 |
| 426 | 3300050496 | nmdc:mga07m45_76245_c1 | nmdc:mga07m45_76245_c1_384_1331 | 302 |
| 427 | 3300050507 | nmdc:mga05p37_13761_c1 | nmdc:mga05p37_13761_c1_7405_8379 | 302 |
| 428 | 3300050507 | nmdc:mga05p37_166585_c1 | nmdc:mga05p37_166585_c1_516_1433 | 302 |
| 429 | 3300050507 | nmdc:mga05p37_212429_c1 | nmdc:mga05p37_212429_c1_21_947 | 302 |
| 430 | 3300050507 | nmdc:mga05p37_245550_c1 | nmdc:mga05p37_245550_c1_1155_2072 | 302 |
| 431 | 3300050507 | nmdc:mga05p37_26012_c1 | nmdc:mga05p37_26012_c1_1569_2480 | 302 |
| 432 | 3300050507 | nmdc:mga05p37_27520_c1 | nmdc:mga05p37_27520_c1_2010_2930 | 302 |
| 433 | 3300050508 | nmdc:mga09592_362446_c1 | nmdc:mga09592_362446_c1_17_925 | 302 |
| 434 | 3300050508 | nmdc:mga09592_62116_c1 | nmdc:mga09592_62116_c1_1813_2733 | 302 |
| 435 | 3300050509 | nmdc:mga0qj67_101669_c1 | nmdc:mga0qj67_101669_c1_249_1166 | 302 |
| 436 | 3300050510 | nmdc:mga06r32_100237_c1 | nmdc:mga06r32_100237_c1_454_1368 | 302 |
| 437 | 3300050510 | nmdc:mga06r32_149712_c1 | nmdc:mga06r32_149712_c1_1225_2142 | 302 |
| 438 | 3300050510 | nmdc:mga06r32_175482_c1 | nmdc:mga06r32_175482_c1_1186_2103 | 302 |
| 439 | 3300050510 | nmdc:mga06r32_69246_c1 | nmdc:mga06r32_69246_c1_719_1639 | 302 |
| 440 | 3300050511 | nmdc:mga08y16_4189_c1 | nmdc:mga08y16_4189_c1_6191_7099 | 302 |
| 441 | 3300050511 | nmdc:mga08y16_67296_c1 | nmdc:mga08y16_67296_c1_2421_3335 | 302 |
| 442 | 3300050512 | nmdc:mga0n895_165847_c1 | nmdc:mga0n895_165847_c1_407_1351 | 302 |
| 443 | 3300050512 | nmdc:mga0n895_751956_c1 | nmdc:mga0n895_751956_c1_34_945 | 302 |
| 444 | 3300050513 | nmdc:mga0rr50_135477_c1 | nmdc:mga0rr50_135477_c1_161_1105 | 302 |
| 445 | 3300050513 | nmdc:mga0rr50_2711_c1 | nmdc:mga0rr50_2711_c1_2181_3122 | 302 |
| 446 | 3300050513 | nmdc:mga0rr50_39108_c1 | nmdc:mga0rr50_39108_c1_1528_2436 | 302 |
| 447 | 3300050514 | nmdc:mga08x19_101208_c1 | nmdc:mga08x19_101208_c1_642_1583 | 302 |
| 448 | 3300050514 | nmdc:mga08x19_206942_c1 | nmdc:mga08x19_206942_c1_67_975 | 302 |
| 449 | 3300059421 | Ga0590071_011180 | Ga0590071_011180_987_1901 | 302 |
| 450 | 3300059423 | Ga0590074_000185 | Ga0590074_000185_5660_6574 | 302 |
| 451 | 3300059424 | Ga0590075_000756 | Ga0590075_000756_1163_2077 | 302 |
| 452 | 3300059426 | Ga0590077_000988 | Ga0590077_000988_411_1325 | 302 |
| 453 | 3300059426 | Ga0590077_001839 | Ga0590077_001839_2598_3512 | 302 |
| 454 | 3300060353 | Ga0501082_0110974 | Ga0501082_0110974_522_1451 | 302 |
| 455 | 3300060353 | Ga0501082_0271846 | Ga0501082_0271846_79_1038 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8015 | 12 | 298 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7994 | 6 | 301 |
| 8djm-assembly1.cif.gz_B | hmgcr-ubiad1 complex state 1 | 0.7989 | 7 | 302 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7894 | 6 | 301 |
| 4tq5-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus | 0.7878 | 6 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57727_161_283_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.8855 | 183 | 301 | 1.20.120.1780 |
| af_Q57727_14_160_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8845 | 11 | 170 | 1.10.357.140 |
| af_A4I0M3_131_276_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8831 | 12 | 172 | 1.10.357.140 |
| af_A4I0M3_131_276_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8774 | 12 | 172 | 1.10.357.140 |
| af_I1N2Z4_95_254_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8692 | 12 | 168 | 1.10.357.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A640XNQ0-F1-model_v4 | Homogentisate phytyltransferase | 0.9672 | 1 | 302 |
GO:0016020
GO:0016765 |
| AF-A0A640XNQ0-F1-model_v4 | Homogentisate phytyltransferase | 0.964 | 1 | 302 |
GO:0016020
GO:0016765 |
| AF-A0A2V8EKF6-F1-model_v4 | Uncharacterized protein | 0.9627 | 45 | 302 |
GO:0016020
GO:0016765 |
| AF-A0A3N5X4C7-F1-model_v4 | Uncharacterized protein | 0.9618 | 1 | 220 |
GO:0016020
GO:0016765 |
| AF-A0A7C0X498-F1-model_v4 | UbiA family prenyltransferase | 0.9592 | 151 | 302 |
GO:0016020
GO:0016765 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar