F447534
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 455 | 312 | 455 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100348481|Ga0070679_1003484811 |
| Length | 107 |
| Sequence | MHRPAADADVFRAIADPTRRAILTRLRRDGPSHVNALAAAFAQSRPSISKHLKILHTAGVVSEQRAGRQRVYRLEPETLRQVDDWISSYRELWQDNLNRLKRYLEEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 237 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 241 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 242 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.4 |
| Nodule | 0 |
| Rhizoplane | 3.3 |
| Rhizosphere | 90.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_780787 | 2162886012 | Bacteria | 2710 |
| 2 | JGI24749J21850_1003664 | 3300002076 | Unclassified | 2147 |
| 3 | JGI24751J29686_10003963 | 3300002459 | Bacteria | 2993 |
| 4 | Ga0065715_10714337 | 3300005293 | Bacteria | 646 |
| 5 | Ga0070658_10000267 | 3300005327 | Bacteria | 45819 |
| 6 | Ga0070676_10000455 | 3300005328 | Bacteria | 19545 |
| 7 | Ga0070683_100002672 | 3300005329 | Bacteria | 14248 |
| 8 | Ga0070683_100073403 | 3300005329 | Bacteria | 3195 |
| 9 | Ga0070683_100378033 | 3300005329 | Unclassified | 1350 |
| 10 | Ga0070690_100000292 | 3300005330 | Bacteria | 25718 |
| 11 | Ga0070670_100002161 | 3300005331 | Bacteria | 16143 |
| 12 | Ga0070677_10000659 | 3300005333 | Bacteria | 11502 |
| 13 | Ga0068869_100000149 | 3300005334 | Bacteria | 34450 |
| 14 | Ga0070666_10005115 | 3300005335 | Bacteria | 8026 |
| 15 | Ga0070680_100032483 | 3300005336 | Bacteria | 4202 |
| 16 | Ga0070680_100866579 | 3300005336 | Bacteria | 779 |
| 17 | Ga0070682_100024779 | 3300005337 | Bacteria | 3574 |
| 18 | Ga0068868_100000367 | 3300005338 | Bacteria | 30665 |
| 19 | Ga0070660_100000058 | 3300005339 | Bacteria | 66503 |
| 20 | Ga0070689_100000151 | 3300005340 | Bacteria | 40558 |
| 21 | Ga0070689_100555850 | 3300005340 | Bacteria | 989 |
| 22 | Ga0070691_10106097 | 3300005341 | Unclassified | 1400 |
| 23 | Ga0070687_100000029 | 3300005343 | Bacteria | 43999 |
| 24 | Ga0070687_100230299 | 3300005343 | Bacteria | 1140 |
| 25 | Ga0070661_100000959 | 3300005344 | Bacteria | 20526 |
| 26 | Ga0070692_10000821 | 3300005345 | Bacteria | 10368 |
| 27 | Ga0070668_100000494 | 3300005347 | Bacteria | 26113 |
| 28 | Ga0070669_100000134 | 3300005353 | Bacteria | 67101 |
| 29 | Ga0070675_100017729 | 3300005354 | Bacteria | 5663 |
| 30 | Ga0070671_100000228 | 3300005355 | Bacteria | 37493 |
| 31 | Ga0070674_100003322 | 3300005356 | Bacteria | 9008 |
| 32 | Ga0070673_100006101 | 3300005364 | Bacteria | 7808 |
| 33 | Ga0070688_100000073 | 3300005365 | Bacteria | 49973 |
| 34 | Ga0070659_100034689 | 3300005366 | Bacteria | 3925 |
| 35 | Ga0070667_100000935 | 3300005367 | Bacteria | 26905 |
| 36 | Ga0070714_100602550 | 3300005435 | Bacteria | 1055 |
| 37 | Ga0070710_10150088 | 3300005437 | Bacteria | 1437 |
| 38 | Ga0070701_10001016 | 3300005438 | Bacteria | 10216 |
| 39 | Ga0070701_10398747 | 3300005438 | Bacteria | 871 |
| 40 | Ga0070711_100090769 | 3300005439 | Unclassified | 2201 |
| 41 | Ga0070711_101832406 | 3300005439 | Unclassified | 533 |
| 42 | Ga0070705_100000689 | 3300005440 | Bacteria | 19330 |
| 43 | Ga0070705_100015044 | 3300005440 | Bacteria | 3992 |
| 44 | Ga0070700_100003721 | 3300005441 | Bacteria | 7883 |
| 45 | Ga0070708_100063110 | 3300005445 | Unclassified | 3315 |
| 46 | Ga0070663_100000498 | 3300005455 | Bacteria | 20742 |
| 47 | Ga0070678_100013401 | 3300005456 | Bacteria | 5139 |
| 48 | Ga0070662_100000386 | 3300005457 | Bacteria | 26266 |
| 49 | Ga0068867_100000197 | 3300005459 | Bacteria | 39845 |
| 50 | Ga0070685_10000121 | 3300005466 | Bacteria | 50316 |
| 51 | Ga0070706_100000190 | 3300005467 | Bacteria | 77656 |
| 52 | Ga0070706_100099684 | 3300005467 | Bacteria | 2699 |
| 53 | Ga0070707_100694013 | 3300005468 | Unclassified | 981 |
| 54 | Ga0070698_100560481 | 3300005471 | Bacteria | 1082 |
| 55 | Ga0070698_101010184 | 3300005471 | Bacteria | 779 |
| 56 | Ga0070699_100484490 | 3300005518 | Unclassified | 1123 |
| 57 | Ga0070679_100348481 | 3300005530 | Unclassified | 1429 |
| 58 | Ga0070679_100508252 | 3300005530 | Bacteria | 1149 |
| 59 | Ga0070684_100033909 | 3300005535 | Unclassified | 4362 |
| 60 | Ga0070697_100002794 | 3300005536 | Bacteria | 13446 |
| 61 | Ga0068853_100000228 | 3300005539 | Bacteria | 39894 |
| 62 | Ga0070672_100000078 | 3300005543 | Bacteria | 45239 |
| 63 | Ga0070686_100000139 | 3300005544 | Bacteria | 49928 |
| 64 | Ga0070695_100006206 | 3300005545 | Bacteria | 7058 |
| 65 | Ga0070696_100010337 | 3300005546 | Bacteria | 6252 |
| 66 | Ga0070696_100995460 | 3300005546 | Bacteria | 700 |
| 67 | Ga0070693_100007457 | 3300005547 | Bacteria | 5350 |
| 68 | Ga0070665_100031779 | 3300005548 | Bacteria | 5313 |
| 69 | Ga0070665_101536484 | 3300005548 | Bacteria | 674 |
| 70 | Ga0070665_101910206 | 3300005548 | Bacteria | 599 |
| 71 | Ga0070704_100010095 | 3300005549 | Bacteria | 5741 |
| 72 | Ga0070704_100041230 | 3300005549 | Bacteria | 3185 |
| 73 | Ga0068855_100000217 | 3300005563 | Bacteria | 73115 |
| 74 | Ga0068855_101980404 | 3300005563 | Bacteria | 589 |
| 75 | Ga0068855_102524077 | 3300005563 | Bacteria | 511 |
| 76 | Ga0070664_100001075 | 3300005564 | Bacteria | 21516 |
| 77 | Ga0070664_100712228 | 3300005564 | Bacteria | 936 |
| 78 | Ga0068857_100003562 | 3300005577 | Bacteria | 13027 |
| 79 | Ga0068857_101163471 | 3300005577 | Bacteria | 746 |
| 80 | Ga0068857_101919760 | 3300005577 | Bacteria | 580 |
| 81 | Ga0068854_100000661 | 3300005578 | Bacteria | 20541 |
| 82 | Ga0068856_100005364 | 3300005614 | Bacteria | 12643 |
| 83 | Ga0068856_101044468 | 3300005614 | Bacteria | 835 |
| 84 | Ga0068856_102182298 | 3300005614 | Bacteria | 563 |
| 85 | Ga0070702_100031630 | 3300005615 | Unclassified | 2898 |
| 86 | Ga0068852_100000081 | 3300005616 | Bacteria | 67190 |
| 87 | Ga0068852_100207673 | 3300005616 | Bacteria | 1856 |
| 88 | Ga0068859_100003422 | 3300005617 | Bacteria | 16142 |
| 89 | Ga0068859_100031470 | 3300005617 | Bacteria | 5329 |
| 90 | Ga0068864_100002038 | 3300005618 | Bacteria | 16681 |
| 91 | Ga0068864_100093091 | 3300005618 | Bacteria | 2662 |
| 92 | Ga0068864_102229554 | 3300005618 | Bacteria | 554 |
| 93 | Ga0068866_10000231 | 3300005718 | Bacteria | 26309 |
| 94 | Ga0068866_10382962 | 3300005718 | Bacteria | 902 |
| 95 | Ga0068861_100000119 | 3300005719 | Bacteria | 40098 |
| 96 | Ga0068851_10000089 | 3300005834 | Bacteria | 50203 |
| 97 | Ga0068870_10000022 | 3300005840 | Bacteria | 51836 |
| 98 | Ga0068870_11030239 | 3300005840 | Unclassified | 588 |
| 99 | Ga0068863_100000598 | 3300005841 | Bacteria | 36657 |
| 100 | Ga0068863_100289673 | 3300005841 | Bacteria | 1587 |
| 101 | Ga0068858_100003407 | 3300005842 | Bacteria | 15814 |
| 102 | Ga0068860_100001206 | 3300005843 | Bacteria | 28199 |
| 103 | Ga0068862_100000893 | 3300005844 | Bacteria | 28981 |
| 104 | Ga0068862_102580727 | 3300005844 | Bacteria | 520 |
| 105 | Ga0081455_10091201 | 3300005937 | Bacteria | 2468 |
| 106 | Ga0081540_1001701 | 3300005983 | Bacteria | 18652 |
| 107 | Ga0075365_10646666 | 3300006038 | Bacteria | 747 |
| 108 | Ga0075368_10002170 | 3300006042 | Bacteria | 6348 |
| 109 | Ga0075363_100166879 | 3300006048 | Bacteria | 1248 |
| 110 | Ga0075364_10023671 | 3300006051 | Bacteria | 3890 |
| 111 | Ga0070716_101249767 | 3300006173 | Bacteria | 598 |
| 112 | Ga0070712_101590210 | 3300006175 | Bacteria | 572 |
| 113 | Ga0075362_10023259 | 3300006177 | Bacteria | 2620 |
| 114 | Ga0075367_10357195 | 3300006178 | Bacteria | 922 |
| 115 | Ga0075369_10015173 | 3300006186 | Bacteria | 3088 |
| 116 | Ga0075366_10087356 | 3300006195 | Bacteria | 1866 |
| 117 | Ga0097621_100000364 | 3300006237 | Bacteria | 31432 |
| 118 | Ga0097621_100084463 | 3300006237 | Bacteria | 2647 |
| 119 | Ga0097621_101579794 | 3300006237 | Bacteria | 623 |
| 120 | Ga0075370_10075145 | 3300006353 | Bacteria | 1937 |
| 121 | Ga0068871_100001311 | 3300006358 | Bacteria | 16640 |
| 122 | Ga0075433_10011793 | 3300006852 | Bacteria | 7040 |
| 123 | Ga0075433_10056536 | 3300006852 | Unclassified | 3427 |
| 124 | Ga0075433_10132629 | 3300006852 | Unclassified | 2213 |
| 125 | Ga0075434_100040544 | 3300006871 | Bacteria | 4611 |
| 126 | Ga0075434_100140598 | 3300006871 | Unclassified | 2433 |
| 127 | Ga0075434_101383310 | 3300006871 | Unclassified | 714 |
| 128 | Ga0068865_100000257 | 3300006881 | Bacteria | 29415 |
| 129 | Ga0068865_100897929 | 3300006881 | Bacteria | 770 |
| 130 | Ga0075436_100036208 | 3300006914 | Bacteria | 3406 |
| 131 | Ga0075436_100160528 | 3300006914 | Unclassified | 1584 |
| 132 | Ga0075436_101435981 | 3300006914 | Unclassified | 523 |
| 133 | Ga0097620_100003422 | 3300006931 | Bacteria | 16142 |
| 134 | Ga0097620_100031469 | 3300006931 | Bacteria | 5329 |
| 135 | Ga0075435_100054228 | 3300007076 | Unclassified | 3235 |
| 136 | Ga0075435_100192321 | 3300007076 | Unclassified | 1727 |
| 137 | Ga0075435_100197300 | 3300007076 | Bacteria | 1705 |
| 138 | Ga0075435_100575326 | 3300007076 | Unclassified | 976 |
| 139 | Ga0075435_101997488 | 3300007076 | Bacteria | 509 |
| 140 | Ga0099794_10000163 | 3300007265 | Bacteria | 24455 |
| 141 | Ga0105250_10263505 | 3300009092 | Bacteria | 739 |
| 142 | Ga0105240_10001539 | 3300009093 | Bacteria | 39146 |
| 143 | Ga0105240_10862461 | 3300009093 | Bacteria | 976 |
| 144 | Ga0105240_11105853 | 3300009093 | Bacteria | 843 |
| 145 | Ga0111539_12893028 | 3300009094 | Bacteria | 556 |
| 146 | Ga0105245_10000654 | 3300009098 | Bacteria | 31516 |
| 147 | Ga0105245_10756314 | 3300009098 | Bacteria | 1008 |
| 148 | Ga0105245_10995503 | 3300009098 | Bacteria | 882 |
| 149 | Ga0105245_11335820 | 3300009098 | Bacteria | 766 |
| 150 | Ga0105247_10002206 | 3300009101 | Bacteria | 13406 |
| 151 | Ga0114129_10071033 | 3300009147 | Bacteria | 4854 |
| 152 | Ga0114129_11378700 | 3300009147 | Bacteria | 871 |
| 153 | Ga0105243_10038421 | 3300009148 | Bacteria | 3728 |
| 154 | Ga0105243_10465265 | 3300009148 | Bacteria | 1190 |
| 155 | Ga0105241_10000131 | 3300009174 | Bacteria | 54082 |
| 156 | Ga0105248_10039085 | 3300009177 | Bacteria | 5313 |
| 157 | Ga0105237_10000612 | 3300009545 | Bacteria | 49843 |
| 158 | Ga0105238_10000291 | 3300009551 | Bacteria | 55788 |
| 159 | Ga0105249_10000315 | 3300009553 | Bacteria | 48867 |
| 160 | Ga0105239_10000109 | 3300010375 | Bacteria | 116335 |
| 161 | Ga0105246_10002083 | 3300011119 | Bacteria | 12053 |
| 162 | Ga0157373_11091279 | 3300013100 | Bacteria | 598 |
| 163 | Ga0157371_10000699 | 3300013102 | Bacteria | 39420 |
| 164 | Ga0157369_10113947 | 3300013105 | Bacteria | 2872 |
| 165 | Ga0157369_10699111 | 3300013105 | Bacteria | 1044 |
| 166 | Ga0157369_11252031 | 3300013105 | Bacteria | 757 |
| 167 | Ga0157374_10000551 | 3300013296 | Bacteria | 33486 |
| 168 | Ga0157374_10281966 | 3300013296 | Bacteria | 1641 |
| 169 | Ga0157374_10414903 | 3300013296 | Unclassified | 1344 |
| 170 | Ga0157374_10606110 | 3300013296 | Bacteria | 1105 |
| 171 | Ga0157378_10005511 | 3300013297 | Bacteria | 11093 |
| 172 | Ga0157378_10580585 | 3300013297 | Bacteria | 1130 |
| 173 | Ga0163162_10000262 | 3300013306 | Bacteria | 47948 |
| 174 | Ga0157372_10001703 | 3300013307 | Bacteria | 23832 |
| 175 | Ga0157372_10002253 | 3300013307 | Bacteria | 20908 |
| 176 | Ga0157375_10018741 | 3300013308 | Bacteria | 6280 |
| 177 | Ga0163163_10078207 | 3300014325 | Bacteria | 3304 |
| 178 | Ga0163163_12041713 | 3300014325 | Bacteria | 633 |
| 179 | Ga0157380_10351596 | 3300014326 | Unclassified | 1379 |
| 180 | Ga0157377_10000402 | 3300014745 | Bacteria | 18752 |
| 181 | Ga0157379_10000031 | 3300014968 | Bacteria | 84367 |
| 182 | Ga0157376_10000289 | 3300014969 | Bacteria | 33972 |
| 183 | Ga0157376_10046175 | 3300014969 | Bacteria | 3590 |
| 184 | Ga0157376_10814144 | 3300014969 | Bacteria | 947 |
| 185 | Ga0157376_12860975 | 3300014969 | Bacteria | 522 |
| 186 | Ga0213872_10057256 | 3300021361 | Bacteria | 1765 |
| 187 | Ga0213876_10057640 | 3300021384 | Bacteria | 2051 |
| 188 | Ga0213876_10099321 | 3300021384 | Bacteria | 1543 |
| 189 | Ga0207697_10000035 | 3300025315 | Bacteria | 50098 |
| 190 | Ga0207656_10005954 | 3300025321 | Bacteria | 4352 |
| 191 | Ga0207682_10000027 | 3300025893 | Bacteria | 60031 |
| 192 | Ga0207692_10069106 | 3300025898 | Bacteria | 1855 |
| 193 | Ga0207642_10005152 | 3300025899 | Bacteria | 4253 |
| 194 | Ga0207642_11130341 | 3300025899 | Bacteria | 507 |
| 195 | Ga0207710_10001160 | 3300025900 | Bacteria | 13406 |
| 196 | Ga0207688_10000069 | 3300025901 | Bacteria | 38157 |
| 197 | Ga0207680_10000061 | 3300025903 | Bacteria | 50036 |
| 198 | Ga0207647_10004258 | 3300025904 | Bacteria | 10609 |
| 199 | Ga0207647_10026713 | 3300025904 | Bacteria | 3773 |
| 200 | Ga0207645_10000004 | 3300025907 | Bacteria | 212114 |
| 201 | Ga0207643_10000015 | 3300025908 | Bacteria | 125948 |
| 202 | Ga0207705_10002373 | 3300025909 | Bacteria | 14552 |
| 203 | Ga0207684_10000056 | 3300025910 | Bacteria | 215717 |
| 204 | Ga0207684_10526285 | 3300025910 | Bacteria | 1012 |
| 205 | Ga0207654_10003832 | 3300025911 | Bacteria | 7583 |
| 206 | Ga0207707_10233375 | 3300025912 | Bacteria | 1601 |
| 207 | Ga0207695_10027571 | 3300025913 | Bacteria | 6322 |
| 208 | Ga0207671_10006955 | 3300025914 | Bacteria | 9952 |
| 209 | Ga0207663_10251931 | 3300025916 | Bacteria | 1300 |
| 210 | Ga0207660_10022025 | 3300025917 | Bacteria | 4291 |
| 211 | Ga0207660_10759768 | 3300025917 | Bacteria | 791 |
| 212 | Ga0207662_10000035 | 3300025918 | Bacteria | 60201 |
| 213 | Ga0207662_10252239 | 3300025918 | Bacteria | 1158 |
| 214 | Ga0207657_10000032 | 3300025919 | Bacteria | 129236 |
| 215 | Ga0207649_10000317 | 3300025920 | Bacteria | 36587 |
| 216 | Ga0207652_10284935 | 3300025921 | Unclassified | 1490 |
| 217 | Ga0207646_10030034 | 3300025922 | Bacteria | 4933 |
| 218 | Ga0207646_10751274 | 3300025922 | Bacteria | 870 |
| 219 | Ga0207681_10000091 | 3300025923 | Bacteria | 78672 |
| 220 | Ga0207694_10000541 | 3300025924 | Bacteria | 34288 |
| 221 | Ga0207650_10000113 | 3300025925 | Bacteria | 105325 |
| 222 | Ga0207659_10000026 | 3300025926 | Bacteria | 139726 |
| 223 | Ga0207687_10000953 | 3300025927 | Bacteria | 19700 |
| 224 | Ga0207687_10479867 | 3300025927 | Bacteria | 1035 |
| 225 | Ga0207664_11270592 | 3300025929 | Bacteria | 655 |
| 226 | Ga0207644_10000229 | 3300025931 | Bacteria | 38704 |
| 227 | Ga0207690_10001164 | 3300025932 | Bacteria | 16647 |
| 228 | Ga0207706_10000021 | 3300025933 | Bacteria | 160122 |
| 229 | Ga0207709_10081358 | 3300025935 | Bacteria | 2088 |
| 230 | Ga0207670_10000055 | 3300025936 | Bacteria | 84688 |
| 231 | Ga0207670_11015665 | 3300025936 | Bacteria | 698 |
| 232 | Ga0207669_10000108 | 3300025937 | Bacteria | 41349 |
| 233 | Ga0207704_10000122 | 3300025938 | Bacteria | 42122 |
| 234 | Ga0207691_10000008 | 3300025940 | Bacteria | 150329 |
| 235 | Ga0207711_10000037 | 3300025941 | Bacteria | 165538 |
| 236 | Ga0207689_10000001 | 3300025942 | Bacteria | 294504 |
| 237 | Ga0207661_10001929 | 3300025944 | Bacteria | 14259 |
| 238 | Ga0207661_10284405 | 3300025944 | Bacteria | 1479 |
| 239 | Ga0207661_10408245 | 3300025944 | Bacteria | 1232 |
| 240 | Ga0207661_10874802 | 3300025944 | Bacteria | 827 |
| 241 | Ga0207679_10000076 | 3300025945 | Bacteria | 87612 |
| 242 | Ga0207679_11394485 | 3300025945 | Bacteria | 643 |
| 243 | Ga0207667_10000897 | 3300025949 | Bacteria | 37944 |
| 244 | Ga0207667_10791484 | 3300025949 | Bacteria | 946 |
| 245 | Ga0207651_10000022 | 3300025960 | Bacteria | 76544 |
| 246 | Ga0207712_10000166 | 3300025961 | Bacteria | 67960 |
| 247 | Ga0207668_10000320 | 3300025972 | Bacteria | 31302 |
| 248 | Ga0207640_10000123 | 3300025981 | Bacteria | 59036 |
| 249 | Ga0207658_10000234 | 3300025986 | Bacteria | 58649 |
| 250 | Ga0207677_10000031 | 3300026023 | Bacteria | 120606 |
| 251 | Ga0207677_11262620 | 3300026023 | Bacteria | 677 |
| 252 | Ga0207703_10000068 | 3300026035 | Bacteria | 125011 |
| 253 | Ga0207639_10008421 | 3300026041 | Bacteria | 7067 |
| 254 | Ga0207678_10000639 | 3300026067 | Bacteria | 32178 |
| 255 | Ga0207708_10016736 | 3300026075 | Bacteria | 5517 |
| 256 | Ga0207702_10007670 | 3300026078 | Bacteria | 9175 |
| 257 | Ga0207641_10000324 | 3300026088 | Bacteria | 58511 |
| 258 | Ga0207641_10420306 | 3300026088 | Bacteria | 1287 |
| 259 | Ga0207648_10000004 | 3300026089 | Bacteria | 247806 |
| 260 | Ga0207676_10000122 | 3300026095 | Bacteria | 68609 |
| 261 | Ga0207676_10155360 | 3300026095 | Bacteria | 1976 |
| 262 | Ga0207674_10000088 | 3300026116 | Bacteria | 100118 |
| 263 | Ga0207675_100000003 | 3300026118 | Bacteria | 262542 |
| 264 | Ga0207683_10000054 | 3300026121 | Bacteria | 85047 |
| 265 | Ga0207698_10010068 | 3300026142 | Bacteria | 6056 |
| 266 | Ga0207698_10433275 | 3300026142 | Bacteria | 1265 |
| 267 | Ga0209588_1000018 | 3300027671 | Bacteria | 95943 |
| 268 | Ga0209813_10164719 | 3300027866 | Bacteria | 802 |
| 269 | Ga0268266_10000172 | 3300028379 | Bacteria | 117909 |
| 270 | Ga0268266_11079329 | 3300028379 | Bacteria | 777 |
| 271 | Ga0268266_11505429 | 3300028379 | Bacteria | 648 |
| 272 | Ga0268265_10000076 | 3300028380 | Bacteria | 124918 |
| 273 | Ga0268264_10000203 | 3300028381 | Bacteria | 121101 |
| 274 | Ga0265337_1163152 | 3300028556 | Bacteria | 604 |
| 275 | Ga0265337_1214941 | 3300028556 | Bacteria | 522 |
| 276 | Ga0265319_1002119 | 3300028563 | Bacteria | 11118 |
| 277 | Ga0265334_10035229 | 3300028573 | Unclassified | 1982 |
| 278 | Ga0265318_10000789 | 3300028577 | Bacteria | 20978 |
| 279 | Ga0265338_10109192 | 3300028800 | Bacteria | 2232 |
| 280 | Ga0265338_10127546 | 3300028800 | Bacteria | 2016 |
| 281 | Ga0265330_10000549 | 3300031235 | Bacteria | 24576 |
| 282 | Ga0265332_10002164 | 3300031238 | Bacteria | 10121 |
| 283 | Ga0265332_10247651 | 3300031238 | Unclassified | 737 |
| 284 | Ga0265328_10001977 | 3300031239 | Bacteria | 9310 |
| 285 | Ga0265320_10004029 | 3300031240 | Bacteria | 9652 |
| 286 | Ga0265320_10009542 | 3300031240 | Bacteria | 5846 |
| 287 | Ga0265320_10085755 | 3300031240 | Bacteria | 1465 |
| 288 | Ga0265320_10097156 | 3300031240 | Bacteria | 1359 |
| 289 | Ga0265325_10459623 | 3300031241 | Bacteria | 554 |
| 290 | Ga0265329_10004468 | 3300031242 | Bacteria | 5804 |
| 291 | Ga0265329_10098699 | 3300031242 | Bacteria | 929 |
| 292 | Ga0265340_10010877 | 3300031247 | Bacteria | 4855 |
| 293 | Ga0265339_10009032 | 3300031249 | Bacteria | 6296 |
| 294 | Ga0265339_10168845 | 3300031249 | Bacteria | 1096 |
| 295 | Ga0265331_10007955 | 3300031250 | Bacteria | 6071 |
| 296 | Ga0265316_10004965 | 3300031344 | Bacteria | 13070 |
| 297 | Ga0307509_10000002 | 3300031507 | Bacteria | 607551 |
| 298 | Ga0265313_10000147 | 3300031595 | Bacteria | 73404 |
| 299 | Ga0265314_10002182 | 3300031711 | Bacteria | 20464 |
| 300 | Ga0265314_10019170 | 3300031711 | Bacteria | 5306 |
| 301 | Ga0265314_10041020 | 3300031711 | Bacteria | 3317 |
| 302 | Ga0265314_10381285 | 3300031711 | Bacteria | 767 |
| 303 | Ga0265342_10000079 | 3300031712 | Bacteria | 104996 |
| 304 | Ga0265342_10000524 | 3300031712 | Bacteria | 40866 |
| 305 | Ga0265342_10185951 | 3300031712 | Bacteria | 1136 |
| 306 | Ga0373950_0000045 | 3300034818 | Bacteria | 97374 |
| 307 | Ga0373926_0289068 | 3300035083 | Bacteria | 639 |
| 308 | Ga0373940_0002902 | 3300035088 | Bacteria | 3416 |
| 309 | Ga0373944_0128704 | 3300035089 | Bacteria | 879 |
| 310 | Ga0373923_0614952 | 3300035111 | Bacteria | 536 |
| 311 | Ga0373936_0264945 | 3300035113 | Unclassified | 770 |
| 312 | Ga0373953_0388052 | 3300035117 | Bacteria | 614 |
| 313 | Ga0373954_0002640 | 3300035118 | Bacteria | 7545 |
| 314 | Ga0373954_0111002 | 3300035118 | Bacteria | 1326 |
| 315 | Ga0373956_0050560 | 3300035119 | Bacteria | 1866 |
| 316 | Ga0373957_0178038 | 3300035120 | Bacteria | 881 |
| 317 | Ga0373955_0004507 | 3300035172 | Bacteria | 6169 |
| 318 | Ga0373955_0302421 | 3300035172 | Bacteria | 965 |
| 319 | Ga0373942_0102266 | 3300035207 | Unclassified | 877 |
| 320 | Ga0373935_0194009 | 3300035692 | Bacteria | 1400 |
| 321 | Ga0373935_0224436 | 3300035692 | Bacteria | 1306 |
| 322 | Ga0373927_0017440 | 3300035695 | Bacteria | 4725 |
| 323 | Ga0373927_0405292 | 3300035695 | Bacteria | 900 |
| 324 | Ga0373933_0000382 | 3300035724 | Bacteria | 28423 |
| 325 | Ga0373933_0019125 | 3300035724 | Bacteria | 3863 |
| 326 | Ga0373933_0905139 | 3300035724 | Bacteria | 581 |
| 327 | Ga0373947_0484683 | 3300035725 | Bacteria | 839 |
| 328 | Ga0373937_0003214 | 3300036401 | Bacteria | 13682 |
| 329 | Ga0373937_0058361 | 3300036401 | Bacteria | 3545 |
| 330 | Ga0373937_1033137 | 3300036401 | Bacteria | 770 |
| 331 | Ga0373925_0064233 | 3300037068 | Bacteria | 2763 |
| 332 | Ga0373925_0791265 | 3300037068 | Bacteria | 782 |
| 333 | Ga0373925_1071628 | 3300037068 | Bacteria | 663 |
| 334 | Ga0395899_0046520 | 3300037312 | Bacteria | 3232 |
| 335 | Ga0395900_0078787 | 3300037418 | Bacteria | 3385 |
| 336 | Ga0395900_0558378 | 3300037418 | Bacteria | 1089 |
| 337 | Ga0395898_0026714 | 3300037466 | Bacteria | 5802 |
| 338 | Ga0436364_0585700 | 3300037853 | Bacteria | 744 |
| 339 | Ga0436364_1152798 | 3300037853 | Unclassified | 772 |
| 340 | Ga0395901_0127211 | 3300038443 | Bacteria | 2677 |
| 341 | Ga0242420_079651 | 3300038996 | Unclassified | 675 |
| 342 | Ga0436365_0047339 | 3300039437 | Bacteria | 5858 |
| 343 | Ga0436365_0261465 | 3300039437 | Bacteria | 2789 |
| 344 | Ga0436360_0541243 | 3300039438 | Bacteria | 879 |
| 345 | Ga0436361_0120850 | 3300039447 | Bacteria | 15595 |
| 346 | Ga0436361_0125710 | 3300039447 | Bacteria | 709 |
| 347 | Ga0436361_0554441 | 3300039447 | Bacteria | 1528 |
| 348 | Ga0436363_0041486 | 3300039450 | Bacteria | 790 |
| 349 | Ga0451804_0687014 | 3300041463 | Unclassified | 547 |
| 350 | Ga0451851_0548223 | 3300041507 | Bacteria | 1020 |
| 351 | Ga0439450_090028 | 3300042008 | Bacteria | 770 |
| 352 | Ga0439458_0176955 | 3300042157 | Bacteria | 578 |
| 353 | Ga0453684_0018480 | 3300044712 | Bacteria | 10697 |
| 354 | Ga0466957_0011360 | 3300044842 | Bacteria | 5135 |
| 355 | Ga0466960_0207723 | 3300044901 | Bacteria | 1072 |
| 356 | Ga0466959_0029847 | 3300045049 | Unclassified | 4039 |
| 357 | Ga0451576_0002519 | 3300045051 | Bacteria | 27136 |
| 358 | Ga0451576_0425517 | 3300045051 | Bacteria | 1393 |
| 359 | Ga0495590_0127275 | 3300046457 | Unclassified | 915 |
| 360 | Ga0495641_0262417 | 3300046461 | Bacteria | 777 |
| 361 | Ga0495641_0443387 | 3300046461 | Archaea | 590 |
| 362 | Ga0495651_0278629 | 3300046462 | Bacteria | 1131 |
| 363 | Ga0495662_0194380 | 3300046476 | Archaea | 1000 |
| 364 | Ga0495594_0343948 | 3300046499 | Archaea | 849 |
| 365 | Ga0495632_0203706 | 3300046519 | Bacteria | 900 |
| 366 | Ga0495645_0829005 | 3300046543 | Unclassified | 553 |
| 367 | Ga0495667_0100738 | 3300046559 | Bacteria | 1869 |
| 368 | Ga0495634_0588141 | 3300046642 | Bacteria | 647 |
| 369 | Ga0495657_0247854 | 3300046675 | Bacteria | 1073 |
| 370 | Ga0495658_0042519 | 3300046683 | Bacteria | 2537 |
| 371 | Ga0495624_0639471 | 3300046690 | Archaea | 633 |
| 372 | Ga0495604_0590805 | 3300047317 | Bacteria | 713 |
| 373 | Ga0495680_0056239 | 3300047322 | Bacteria | 3047 |
| 374 | Ga0495680_0299690 | 3300047322 | Bacteria | 1129 |
| 375 | Ga0495680_0868547 | 3300047322 | Bacteria | 585 |
| 376 | Ga0496100_1079638 | 3300048903 | Bacteria | 632 |
| 377 | Ga0496101_0414046 | 3300048904 | Bacteria | 1062 |
| 378 | Ga0496102_0002715 | 3300048905 | Bacteria | 15057 |
| 379 | Ga0496103_0014431 | 3300048906 | Bacteria | 4690 |
| 380 | Ga0496104_0958386 | 3300048907 | Bacteria | 760 |
| 381 | Ga0496106_0008714 | 3300048909 | Bacteria | 7503 |
| 382 | Ga0496107_0039419 | 3300048910 | Bacteria | 3389 |
| 383 | Ga0496107_0930193 | 3300048910 | Bacteria | 633 |
| 384 | Ga0496108_0024906 | 3300048911 | Bacteria | 4929 |
| 385 | Ga0496109_0064405 | 3300048912 | Bacteria | 3354 |
| 386 | Ga0496110_0293328 | 3300048913 | Unclassified | 1481 |
| 387 | Ga0496112_0000099 | 3300048915 | Bacteria | 56380 |
| 388 | Ga0496113_0268479 | 3300048916 | Unclassified | 1363 |
| 389 | Ga0496114_0152124 | 3300048917 | Unclassified | 2008 |
| 390 | Ga0501034_0000306 | 3300049571 | Bacteria | 87050 |
| 391 | Ga0501034_0313088 | 3300049571 | Bacteria | 1504 |
| 392 | Ga0501036_0007224 | 3300049572 | Bacteria | 9044 |
| 393 | Ga0501036_0086908 | 3300049572 | Bacteria | 2643 |
| 394 | Ga0501038_0083437 | 3300049574 | Unclassified | 2690 |
| 395 | Ga0501043_0002392 | 3300049579 | Bacteria | 15897 |
| 396 | Ga0501043_0209220 | 3300049579 | Unclassified | 1512 |
| 397 | Ga0501043_0701512 | 3300049579 | Bacteria | 739 |
| 398 | Ga0501046_0002309 | 3300049580 | Bacteria | 17976 |
| 399 | Ga0501047_0000009 | 3300049581 | Bacteria | 436619 |
| 400 | Ga0501047_0057675 | 3300049581 | Bacteria | 3755 |
| 401 | Ga0501048_0004641 | 3300049582 | Bacteria | 10457 |
| 402 | Ga0501068_0001628 | 3300049584 | Bacteria | 11974 |
| 403 | Ga0501068_0078581 | 3300049584 | Bacteria | 2022 |
| 404 | Ga0501069_0159040 | 3300049585 | Bacteria | 1301 |
| 405 | Ga0501069_0201477 | 3300049585 | Bacteria | 1153 |
| 406 | Ga0501070_0125883 | 3300049586 | Unclassified | 2117 |
| 407 | Ga0501070_0364768 | 3300049586 | Bacteria | 1171 |
| 408 | Ga0501072_0000022 | 3300049588 | Bacteria | 152450 |
| 409 | Ga0501073_0005858 | 3300049589 | Bacteria | 9170 |
| 410 | Ga0501073_0015700 | 3300049589 | Bacteria | 5492 |
| 411 | Ga0501073_0025467 | 3300049589 | Bacteria | 4242 |
| 412 | Ga0501074_0000142 | 3300049590 | Bacteria | 37577 |
| 413 | Ga0501074_0422427 | 3300049590 | Unclassified | 945 |
| 414 | Ga0501079_0001689 | 3300049741 | Bacteria | 15699 |
| 415 | Ga0501080_0264807 | 3300049742 | Bacteria | 1565 |
| 416 | Ga0501083_0005104 | 3300049744 | Bacteria | 9295 |
| 417 | Ga0501083_0020518 | 3300049744 | Bacteria | 4596 |
| 418 | Ga0501083_0397265 | 3300049744 | Bacteria | 897 |
| 419 | Ga0501035_1492554 | 3300049822 | Bacteria | 516 |
| 420 | Ga0501044_1424336 | 3300049823 | Bacteria | 558 |
| 421 | nmdc:mga0yw44_160220_c1 | 3300050492 | Bacteria | 1473 |
| 422 | nmdc:mga0k408_720684_c1 | 3300050493 | Bacteria | 584 |
| 423 | nmdc:mga06z11_347333_c1 | 3300050494 | Bacteria | 888 |
| 424 | nmdc:mga04h51_20105_c1 | 3300050495 | Bacteria | 1989 |
| 425 | nmdc:mga07m45_86896_c1 | 3300050496 | Bacteria | 1789 |
| 426 | nmdc:mga05p37_256841_c1 | 3300050507 | Bacteria | 2093 |
| 427 | nmdc:mga09592_1104465_c1 | 3300050508 | Unclassified | 659 |
| 428 | nmdc:mga0n895_132731_c1 | 3300050512 | Unclassified | 2516 |
| 429 | nmdc:mga0n895_1421891_c1 | 3300050512 | Unclassified | 662 |
| 430 | nmdc:mga0n895_1678113_c1 | 3300050512 | Bacteria | 598 |
| 431 | nmdc:mga0n895_1681325_c1 | 3300050512 | Bacteria | 598 |
| 432 | nmdc:mga0n895_4828_c1 | 3300050512 | Bacteria | 11163 |
| 433 | nmdc:mga0n895_77688_c1 | 3300050512 | Bacteria | 3303 |
| 434 | nmdc:mga0rr50_38659_c1 | 3300050513 | Unclassified | 3455 |
| 435 | nmdc:mga0rr50_57452_c1 | 3300050513 | Bacteria | 2911 |
| 436 | nmdc:mga0rr50_94229_c1 | 3300050513 | Unclassified | 2338 |
| 437 | nmdc:mga08x19_1231623_c1 | 3300050514 | Unclassified | 530 |
| 438 | nmdc:mga08x19_16994_c1 | 3300050514 | Bacteria | 4446 |
| 439 | nmdc:mga08x19_423619_c1 | 3300050514 | Unclassified | 935 |
| 440 | nmdc:mga08x19_508430_c1 | 3300050514 | Unclassified | 851 |
| 441 | nmdc:mga0a205_152032_c1 | 3300050515 | Unclassified | 2214 |
| 442 | nmdc:mga0a205_29873_c1 | 3300050515 | Bacteria | 5216 |
| 443 | Ga0495601_0047786 | 3300053077 | Bacteria | 2695 |
| 444 | Ga0495601_0147834 | 3300053077 | Bacteria | 1534 |
| 445 | Ga0495619_0260742 | 3300053085 | Bacteria | 1201 |
| 446 | Ga0500644_0399860 | 3300053088 | Unclassified | 599 |
| 447 | Ga0500555_121689 | 3300053103 | Unclassified | 652 |
| 448 | Ga0500655_021670 | 3300053133 | Bacteria | 1206 |
| 449 | Ga0500568_0090339 | 3300053139 | Bacteria | 1155 |
| 450 | Ga0500636_0062150 | 3300053177 | Bacteria | 2178 |
| 451 | Ga0501084_0000006 | 3300054114 | Bacteria | 234041 |
| 452 | Ga0501084_0071919 | 3300054114 | Bacteria | 2896 |
| 453 | Ga0501082_0078471 | 3300060353 | Bacteria | 2848 |
| 454 | Ga0501082_0082054 | 3300060353 | Unclassified | 2781 |
| 455 | Ga0501082_0309675 | 3300060353 | Bacteria | 1375 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005577 | Ga0068857_101919760 | Ga0068857_1019197602 | 103 |
| 2 | 3300006881 | Ga0068865_100897929 | Ga0068865_1008979291 | 103 |
| 3 | 3300009148 | Ga0105243_10465265 | Ga0105243_104652652 | 103 |
| 4 | 3300014325 | Ga0163163_12041713 | Ga0163163_120417132 | 103 |
| 5 | 3300031507 | Ga0307509_10000002 | Ga0307509_10000002156 | 103 |
| 6 | 3300044712 | Ga0453684_0018480 | Ga0453684_0018480_9413_9751 | 103 |
| 7 | 3300046519 | Ga0495632_0203706 | Ga0495632_0203706_344_688 | 103 |
| 8 | 3300005840 | Ga0068870_11030239 | Ga0068870_110302392 | 104 |
| 9 | 3300026023 | Ga0207677_11262620 | Ga0207677_112626202 | 104 |
| 10 | 3300005329 | Ga0070683_100073403 | Ga0070683_1000734034 | 106 |
| 11 | 3300005336 | Ga0070680_100866579 | Ga0070680_1008665792 | 106 |
| 12 | 3300005340 | Ga0070689_100555850 | Ga0070689_1005558502 | 106 |
| 13 | 3300005343 | Ga0070687_100230299 | Ga0070687_1002302992 | 106 |
| 14 | 3300005435 | Ga0070714_100602550 | Ga0070714_1006025502 | 106 |
| 15 | 3300005437 | Ga0070710_10150088 | Ga0070710_101500882 | 106 |
| 16 | 3300005438 | Ga0070701_10398747 | Ga0070701_103987471 | 106 |
| 17 | 3300005439 | Ga0070711_101832406 | Ga0070711_1018324062 | 106 |
| 18 | 3300005440 | Ga0070705_100015044 | Ga0070705_1000150445 | 106 |
| 19 | 3300005445 | Ga0070708_100063110 | Ga0070708_1000631104 | 106 |
| 20 | 3300005467 | Ga0070706_100000190 | Ga0070706_10000019060 | 106 |
| 21 | 3300005467 | Ga0070706_100099684 | Ga0070706_1000996843 | 106 |
| 22 | 3300005468 | Ga0070707_100694013 | Ga0070707_1006940132 | 106 |
| 23 | 3300005471 | Ga0070698_100560481 | Ga0070698_1005604812 | 106 |
| 24 | 3300005471 | Ga0070698_101010184 | Ga0070698_1010101842 | 106 |
| 25 | 3300005518 | Ga0070699_100484490 | Ga0070699_1004844902 | 106 |
| 26 | 3300005530 | Ga0070679_100348481 | Ga0070679_1003484811 | 106 |
| 27 | 3300005530 | Ga0070679_100508252 | Ga0070679_1005082522 | 106 |
| 28 | 3300005536 | Ga0070697_100002794 | Ga0070697_1000027948 | 106 |
| 29 | 3300005546 | Ga0070696_100010337 | Ga0070696_1000103377 | 106 |
| 30 | 3300005546 | Ga0070696_100995460 | Ga0070696_1009954601 | 106 |
| 31 | 3300005548 | Ga0070665_101536484 | Ga0070665_1015364842 | 106 |
| 32 | 3300005548 | Ga0070665_101910206 | Ga0070665_1019102062 | 106 |
| 33 | 3300005549 | Ga0070704_100041230 | Ga0070704_1000412304 | 106 |
| 34 | 3300005563 | Ga0068855_101980404 | Ga0068855_1019804042 | 106 |
| 35 | 3300005563 | Ga0068855_102524077 | Ga0068855_1025240771 | 106 |
| 36 | 3300005577 | Ga0068857_101163471 | Ga0068857_1011634712 | 106 |
| 37 | 3300005614 | Ga0068856_101044468 | Ga0068856_1010444682 | 106 |
| 38 | 3300005614 | Ga0068856_102182298 | Ga0068856_1021822981 | 106 |
| 39 | 3300005616 | Ga0068852_100207673 | Ga0068852_1002076732 | 106 |
| 40 | 3300005617 | Ga0068859_100031470 | Ga0068859_1000314704 | 106 |
| 41 | 3300005618 | Ga0068864_100093091 | Ga0068864_1000930912 | 106 |
| 42 | 3300005841 | Ga0068863_100289673 | Ga0068863_1002896733 | 106 |
| 43 | 3300005844 | Ga0068862_102580727 | Ga0068862_1025807271 | 106 |
| 44 | 3300005937 | Ga0081455_10091201 | Ga0081455_100912012 | 106 |
| 45 | 3300006038 | Ga0075365_10646666 | Ga0075365_106466661 | 106 |
| 46 | 3300006042 | Ga0075368_10002170 | Ga0075368_100021705 | 106 |
| 47 | 3300006048 | Ga0075363_100166879 | Ga0075363_1001668792 | 106 |
| 48 | 3300006051 | Ga0075364_10023671 | Ga0075364_100236712 | 106 |
| 49 | 3300006175 | Ga0070712_101590210 | Ga0070712_1015902102 | 106 |
| 50 | 3300006177 | Ga0075362_10023259 | Ga0075362_100232592 | 106 |
| 51 | 3300006178 | Ga0075367_10357195 | Ga0075367_103571952 | 106 |
| 52 | 3300006186 | Ga0075369_10015173 | Ga0075369_100151735 | 106 |
| 53 | 3300006195 | Ga0075366_10087356 | Ga0075366_100873563 | 106 |
| 54 | 3300006237 | Ga0097621_101579794 | Ga0097621_1015797942 | 106 |
| 55 | 3300006353 | Ga0075370_10075145 | Ga0075370_100751452 | 106 |
| 56 | 3300006852 | Ga0075433_10011793 | Ga0075433_100117936 | 106 |
| 57 | 3300006852 | Ga0075433_10056536 | Ga0075433_100565362 | 106 |
| 58 | 3300006852 | Ga0075433_10132629 | Ga0075433_101326291 | 106 |
| 59 | 3300006871 | Ga0075434_100040544 | Ga0075434_1000405443 | 106 |
| 60 | 3300006871 | Ga0075434_100140598 | Ga0075434_1001405984 | 106 |
| 61 | 3300006914 | Ga0075436_100036208 | Ga0075436_1000362083 | 106 |
| 62 | 3300006914 | Ga0075436_100160528 | Ga0075436_1001605283 | 106 |
| 63 | 3300006914 | Ga0075436_101435981 | Ga0075436_1014359811 | 106 |
| 64 | 3300006931 | Ga0097620_100031469 | Ga0097620_1000314694 | 106 |
| 65 | 3300007076 | Ga0075435_100054228 | Ga0075435_1000542282 | 106 |
| 66 | 3300007076 | Ga0075435_100192321 | Ga0075435_1001923213 | 106 |
| 67 | 3300007076 | Ga0075435_100197300 | Ga0075435_1001973002 | 106 |
| 68 | 3300007076 | Ga0075435_100575326 | Ga0075435_1005753262 | 106 |
| 69 | 3300007076 | Ga0075435_101997488 | Ga0075435_1019974882 | 106 |
| 70 | 3300007265 | Ga0099794_10000163 | Ga0099794_1000016318 | 106 |
| 71 | 3300009093 | Ga0105240_10862461 | Ga0105240_108624611 | 106 |
| 72 | 3300009093 | Ga0105240_11105853 | Ga0105240_111058532 | 106 |
| 73 | 3300009094 | Ga0111539_12893028 | Ga0111539_128930282 | 106 |
| 74 | 3300009098 | Ga0105245_10756314 | Ga0105245_107563142 | 106 |
| 75 | 3300009098 | Ga0105245_10995503 | Ga0105245_109955031 | 106 |
| 76 | 3300009098 | Ga0105245_11335820 | Ga0105245_113358202 | 106 |
| 77 | 3300009147 | Ga0114129_10071033 | Ga0114129_100710332 | 106 |
| 78 | 3300009147 | Ga0114129_11378700 | Ga0114129_113787002 | 106 |
| 79 | 3300013105 | Ga0157369_11252031 | Ga0157369_112520312 | 106 |
| 80 | 3300013296 | Ga0157374_10281966 | Ga0157374_102819662 | 106 |
| 81 | 3300013296 | Ga0157374_10414903 | Ga0157374_104149032 | 106 |
| 82 | 3300013296 | Ga0157374_10606110 | Ga0157374_106061102 | 106 |
| 83 | 3300013297 | Ga0157378_10580585 | Ga0157378_105805852 | 106 |
| 84 | 3300014969 | Ga0157376_10814144 | Ga0157376_108141442 | 106 |
| 85 | 3300014969 | Ga0157376_12860975 | Ga0157376_128609752 | 106 |
| 86 | 3300021361 | Ga0213872_10057256 | Ga0213872_100572561 | 106 |
| 87 | 3300021384 | Ga0213876_10099321 | Ga0213876_100993212 | 106 |
| 88 | 3300025898 | Ga0207692_10069106 | Ga0207692_100691063 | 106 |
| 89 | 3300025904 | Ga0207647_10026713 | Ga0207647_100267132 | 106 |
| 90 | 3300025910 | Ga0207684_10000056 | Ga0207684_1000005659 | 106 |
| 91 | 3300025910 | Ga0207684_10526285 | Ga0207684_105262852 | 106 |
| 92 | 3300025912 | Ga0207707_10233375 | Ga0207707_102333752 | 106 |
| 93 | 3300025916 | Ga0207663_10251931 | Ga0207663_102519312 | 106 |
| 94 | 3300025917 | Ga0207660_10759768 | Ga0207660_107597682 | 106 |
| 95 | 3300025918 | Ga0207662_10252239 | Ga0207662_102522392 | 106 |
| 96 | 3300025921 | Ga0207652_10284935 | Ga0207652_102849352 | 106 |
| 97 | 3300025922 | Ga0207646_10030034 | Ga0207646_100300345 | 106 |
| 98 | 3300025922 | Ga0207646_10751274 | Ga0207646_107512741 | 106 |
| 99 | 3300025927 | Ga0207687_10479867 | Ga0207687_104798672 | 106 |
| 100 | 3300025929 | Ga0207664_11270592 | Ga0207664_112705922 | 106 |
| 101 | 3300025936 | Ga0207670_11015665 | Ga0207670_110156652 | 106 |
| 102 | 3300025944 | Ga0207661_10408245 | Ga0207661_104082452 | 106 |
| 103 | 3300025944 | Ga0207661_10874802 | Ga0207661_108748022 | 106 |
| 104 | 3300025949 | Ga0207667_10791484 | Ga0207667_107914842 | 106 |
| 105 | 3300026088 | Ga0207641_10420306 | Ga0207641_104203061 | 106 |
| 106 | 3300026095 | Ga0207676_10155360 | Ga0207676_101553602 | 106 |
| 107 | 3300026142 | Ga0207698_10433275 | Ga0207698_104332752 | 106 |
| 108 | 3300027671 | Ga0209588_1000018 | Ga0209588_100001819 | 106 |
| 109 | 3300027866 | Ga0209813_10164719 | Ga0209813_101647192 | 106 |
| 110 | 3300028379 | Ga0268266_11079329 | Ga0268266_110793292 | 106 |
| 111 | 3300028379 | Ga0268266_11505429 | Ga0268266_115054292 | 106 |
| 112 | 3300028556 | Ga0265337_1214941 | Ga0265337_12149412 | 106 |
| 113 | 3300028573 | Ga0265334_10035229 | Ga0265334_100352292 | 106 |
| 114 | 3300028800 | Ga0265338_10109192 | Ga0265338_101091922 | 106 |
| 115 | 3300031238 | Ga0265332_10247651 | Ga0265332_102476512 | 106 |
| 116 | 3300031240 | Ga0265320_10009542 | Ga0265320_100095427 | 106 |
| 117 | 3300031240 | Ga0265320_10097156 | Ga0265320_100971562 | 106 |
| 118 | 3300031242 | Ga0265329_10098699 | Ga0265329_100986992 | 106 |
| 119 | 3300031249 | Ga0265339_10168845 | Ga0265339_101688452 | 106 |
| 120 | 3300031711 | Ga0265314_10019170 | Ga0265314_100191704 | 106 |
| 121 | 3300031711 | Ga0265314_10041020 | Ga0265314_100410203 | 106 |
| 122 | 3300031712 | Ga0265342_10000079 | Ga0265342_1000007929 | 106 |
| 123 | 3300031712 | Ga0265342_10185951 | Ga0265342_101859512 | 106 |
| 124 | 3300034818 | Ga0373950_0000045 | Ga0373950_0000045_61951_62271 | 106 |
| 125 | 3300035083 | Ga0373926_0289068 | Ga0373926_0289068_288_608 | 106 |
| 126 | 3300035111 | Ga0373923_0614952 | Ga0373923_0614952_163_483 | 106 |
| 127 | 3300035113 | Ga0373936_0264945 | Ga0373936_0264945_358_678 | 106 |
| 128 | 3300035117 | Ga0373953_0388052 | Ga0373953_0388052_76_396 | 106 |
| 129 | 3300035118 | Ga0373954_0002640 | Ga0373954_0002640_657_977 | 106 |
| 130 | 3300035118 | Ga0373954_0111002 | Ga0373954_0111002_583_903 | 106 |
| 131 | 3300035119 | Ga0373956_0050560 | Ga0373956_0050560_822_1142 | 106 |
| 132 | 3300035120 | Ga0373957_0178038 | Ga0373957_0178038_351_671 | 106 |
| 133 | 3300035172 | Ga0373955_0004507 | Ga0373955_0004507_3592_3912 | 106 |
| 134 | 3300035692 | Ga0373935_0224436 | Ga0373935_0224436_324_644 | 106 |
| 135 | 3300035724 | Ga0373933_0000382 | Ga0373933_0000382_3733_4053 | 106 |
| 136 | 3300035724 | Ga0373933_0019125 | Ga0373933_0019125_37_357 | 106 |
| 137 | 3300036401 | Ga0373937_0003214 | Ga0373937_0003214_9385_9705 | 106 |
| 138 | 3300036401 | Ga0373937_0058361 | Ga0373937_0058361_1110_1430 | 106 |
| 139 | 3300037068 | Ga0373925_1071628 | Ga0373925_1071628_55_375 | 106 |
| 140 | 3300037312 | Ga0395899_0046520 | Ga0395899_0046520_285_608 | 106 |
| 141 | 3300037418 | Ga0395900_0078787 | Ga0395900_0078787_1486_1809 | 106 |
| 142 | 3300037418 | Ga0395900_0558378 | Ga0395900_0558378_388_732 | 106 |
| 143 | 3300037466 | Ga0395898_0026714 | Ga0395898_0026714_1313_1636 | 106 |
| 144 | 3300037853 | Ga0436364_0585700 | Ga0436364_0585700_358_678 | 106 |
| 145 | 3300037853 | Ga0436364_1152798 | Ga0436364_1152798_111_431 | 106 |
| 146 | 3300038443 | Ga0395901_0127211 | Ga0395901_0127211_2029_2352 | 106 |
| 147 | 3300038996 | Ga0242420_079651 | Ga0242420_079651_146_466 | 106 |
| 148 | 3300039437 | Ga0436365_0261465 | Ga0436365_0261465_1368_1688 | 106 |
| 149 | 3300039438 | Ga0436360_0541243 | Ga0436360_0541243_236_556 | 106 |
| 150 | 3300039447 | Ga0436361_0120850 | Ga0436361_0120850_12802_13125 | 106 |
| 151 | 3300039447 | Ga0436361_0125710 | Ga0436361_0125710_296_616 | 106 |
| 152 | 3300039447 | Ga0436361_0554441 | Ga0436361_0554441_321_707 | 106 |
| 153 | 3300041507 | Ga0451851_0548223 | Ga0451851_0548223_39_359 | 106 |
| 154 | 3300044842 | Ga0466957_0011360 | Ga0466957_0011360_4561_4884 | 106 |
| 155 | 3300044901 | Ga0466960_0207723 | Ga0466960_0207723_122_442 | 106 |
| 156 | 3300045049 | Ga0466959_0029847 | Ga0466959_0029847_722_1042 | 106 |
| 157 | 3300045051 | Ga0451576_0002519 | Ga0451576_0002519_11721_12041 | 106 |
| 158 | 3300046457 | Ga0495590_0127275 | Ga0495590_0127275_428_748 | 106 |
| 159 | 3300046461 | Ga0495641_0262417 | Ga0495641_0262417_392_712 | 106 |
| 160 | 3300046461 | Ga0495641_0443387 | Ga0495641_0443387_41_361 | 106 |
| 161 | 3300046462 | Ga0495651_0278629 | Ga0495651_0278629_551_871 | 106 |
| 162 | 3300046476 | Ga0495662_0194380 | Ga0495662_0194380_187_507 | 106 |
| 163 | 3300046499 | Ga0495594_0343948 | Ga0495594_0343948_514_834 | 106 |
| 164 | 3300046543 | Ga0495645_0829005 | Ga0495645_0829005_192_512 | 106 |
| 165 | 3300046559 | Ga0495667_0100738 | Ga0495667_0100738_1042_1362 | 106 |
| 166 | 3300046642 | Ga0495634_0588141 | Ga0495634_0588141_106_426 | 106 |
| 167 | 3300046675 | Ga0495657_0247854 | Ga0495657_0247854_597_917 | 106 |
| 168 | 3300046690 | Ga0495624_0639471 | Ga0495624_0639471_167_487 | 106 |
| 169 | 3300047317 | Ga0495604_0590805 | Ga0495604_0590805_280_600 | 106 |
| 170 | 3300047322 | Ga0495680_0056239 | Ga0495680_0056239_49_369 | 106 |
| 171 | 3300047322 | Ga0495680_0299690 | Ga0495680_0299690_280_600 | 106 |
| 172 | 3300047322 | Ga0495680_0868547 | Ga0495680_0868547_11_331 | 106 |
| 173 | 3300048910 | Ga0496107_0930193 | Ga0496107_0930193_67_387 | 106 |
| 174 | 3300048917 | Ga0496114_0152124 | Ga0496114_0152124_711_1031 | 106 |
| 175 | 3300049571 | Ga0501034_0000306 | Ga0501034_0000306_26960_27280 | 106 |
| 176 | 3300049572 | Ga0501036_0007224 | Ga0501036_0007224_4214_4534 | 106 |
| 177 | 3300049572 | Ga0501036_0086908 | Ga0501036_0086908_1573_1893 | 106 |
| 178 | 3300049574 | Ga0501038_0083437 | Ga0501038_0083437_1590_1910 | 106 |
| 179 | 3300049579 | Ga0501043_0002392 | Ga0501043_0002392_9129_9449 | 106 |
| 180 | 3300049579 | Ga0501043_0209220 | Ga0501043_0209220_31_351 | 106 |
| 181 | 3300049579 | Ga0501043_0701512 | Ga0501043_0701512_202_522 | 106 |
| 182 | 3300049580 | Ga0501046_0002309 | Ga0501046_0002309_1400_1720 | 106 |
| 183 | 3300049581 | Ga0501047_0000009 | Ga0501047_0000009_119988_120308 | 106 |
| 184 | 3300049581 | Ga0501047_0057675 | Ga0501047_0057675_2597_2917 | 106 |
| 185 | 3300049582 | Ga0501048_0004641 | Ga0501048_0004641_2931_3251 | 106 |
| 186 | 3300049584 | Ga0501068_0001628 | Ga0501068_0001628_8949_9269 | 106 |
| 187 | 3300049584 | Ga0501068_0078581 | Ga0501068_0078581_20_340 | 106 |
| 188 | 3300049585 | Ga0501069_0159040 | Ga0501069_0159040_411_731 | 106 |
| 189 | 3300049585 | Ga0501069_0201477 | Ga0501069_0201477_560_880 | 106 |
| 190 | 3300049586 | Ga0501070_0125883 | Ga0501070_0125883_398_718 | 106 |
| 191 | 3300049586 | Ga0501070_0364768 | Ga0501070_0364768_158_478 | 106 |
| 192 | 3300049588 | Ga0501072_0000022 | Ga0501072_0000022_94212_94532 | 106 |
| 193 | 3300049589 | Ga0501073_0005858 | Ga0501073_0005858_5653_5973 | 106 |
| 194 | 3300049589 | Ga0501073_0025467 | Ga0501073_0025467_3674_3994 | 106 |
| 195 | 3300049590 | Ga0501074_0000142 | Ga0501074_0000142_16289_16609 | 106 |
| 196 | 3300049590 | Ga0501074_0422427 | Ga0501074_0422427_76_396 | 106 |
| 197 | 3300049741 | Ga0501079_0001689 | Ga0501079_0001689_9652_9972 | 106 |
| 198 | 3300049742 | Ga0501080_0264807 | Ga0501080_0264807_809_1129 | 106 |
| 199 | 3300049744 | Ga0501083_0005104 | Ga0501083_0005104_5936_6256 | 106 |
| 200 | 3300049744 | Ga0501083_0020518 | Ga0501083_0020518_944_1264 | 106 |
| 201 | 3300049744 | Ga0501083_0397265 | Ga0501083_0397265_137_457 | 106 |
| 202 | 3300049822 | Ga0501035_1492554 | Ga0501035_1492554_74_394 | 106 |
| 203 | 3300049823 | Ga0501044_1424336 | Ga0501044_1424336_183_503 | 106 |
| 204 | 3300050492 | nmdc:mga0yw44_160220_c1 | nmdc:mga0yw44_160220_c1_654_974 | 106 |
| 205 | 3300050493 | nmdc:mga0k408_720684_c1 | nmdc:mga0k408_720684_c1_253_573 | 106 |
| 206 | 3300050494 | nmdc:mga06z11_347333_c1 | nmdc:mga06z11_347333_c1_385_705 | 106 |
| 207 | 3300050495 | nmdc:mga04h51_20105_c1 | nmdc:mga04h51_20105_c1_1144_1464 | 106 |
| 208 | 3300050496 | nmdc:mga07m45_86896_c1 | nmdc:mga07m45_86896_c1_1014_1334 | 106 |
| 209 | 3300050507 | nmdc:mga05p37_256841_c1 | nmdc:mga05p37_256841_c1_118_438 | 106 |
| 210 | 3300050508 | nmdc:mga09592_1104465_c1 | nmdc:mga09592_1104465_c1_62_382 | 106 |
| 211 | 3300050512 | nmdc:mga0n895_132731_c1 | nmdc:mga0n895_132731_c1_1938_2258 | 106 |
| 212 | 3300050512 | nmdc:mga0n895_1421891_c1 | nmdc:mga0n895_1421891_c1_168_488 | 106 |
| 213 | 3300050512 | nmdc:mga0n895_1678113_c1 | nmdc:mga0n895_1678113_c1_202_522 | 106 |
| 214 | 3300050512 | nmdc:mga0n895_1681325_c1 | nmdc:mga0n895_1681325_c1_99_419 | 106 |
| 215 | 3300050512 | nmdc:mga0n895_4828_c1 | nmdc:mga0n895_4828_c1_10109_10429 | 106 |
| 216 | 3300050512 | nmdc:mga0n895_77688_c1 | nmdc:mga0n895_77688_c1_2378_2698 | 106 |
| 217 | 3300050513 | nmdc:mga0rr50_38659_c1 | nmdc:mga0rr50_38659_c1_619_939 | 106 |
| 218 | 3300050513 | nmdc:mga0rr50_57452_c1 | nmdc:mga0rr50_57452_c1_112_432 | 106 |
| 219 | 3300050513 | nmdc:mga0rr50_94229_c1 | nmdc:mga0rr50_94229_c1_522_842 | 106 |
| 220 | 3300050514 | nmdc:mga08x19_1231623_c1 | nmdc:mga08x19_1231623_c1_175_495 | 106 |
| 221 | 3300050514 | nmdc:mga08x19_16994_c1 | nmdc:mga08x19_16994_c1_2056_2376 | 106 |
| 222 | 3300050514 | nmdc:mga08x19_423619_c1 | nmdc:mga08x19_423619_c1_557_877 | 106 |
| 223 | 3300050514 | nmdc:mga08x19_508430_c1 | nmdc:mga08x19_508430_c1_14_334 | 106 |
| 224 | 3300050515 | nmdc:mga0a205_152032_c1 | nmdc:mga0a205_152032_c1_401_721 | 106 |
| 225 | 3300050515 | nmdc:mga0a205_29873_c1 | nmdc:mga0a205_29873_c1_1938_2258 | 106 |
| 226 | 3300053077 | Ga0495601_0047786 | Ga0495601_0047786_1996_2319 | 106 |
| 227 | 3300053077 | Ga0495601_0147834 | Ga0495601_0147834_540_860 | 106 |
| 228 | 3300053085 | Ga0495619_0260742 | Ga0495619_0260742_534_854 | 106 |
| 229 | 3300053133 | Ga0500655_021670 | Ga0500655_021670_243_563 | 106 |
| 230 | 3300053139 | Ga0500568_0090339 | Ga0500568_0090339_502_822 | 106 |
| 231 | 3300053177 | Ga0500636_0062150 | Ga0500636_0062150_45_365 | 106 |
| 232 | 3300054114 | Ga0501084_0000006 | Ga0501084_0000006_119988_120308 | 106 |
| 233 | 3300054114 | Ga0501084_0071919 | Ga0501084_0071919_25_345 | 106 |
| 234 | 3300060353 | Ga0501082_0078471 | Ga0501082_0078471_27_347 | 106 |
| 235 | 3300060353 | Ga0501082_0082054 | Ga0501082_0082054_1340_1660 | 106 |
| 236 | 3300060353 | Ga0501082_0309675 | Ga0501082_0309675_731_1051 | 106 |
| 237 | 3300005329 | Ga0070683_100378033 | Ga0070683_1003780332 | 107 |
| 238 | 3300005618 | Ga0068864_102229554 | Ga0068864_1022295542 | 107 |
| 239 | 3300005718 | Ga0068866_10382962 | Ga0068866_103829622 | 107 |
| 240 | 3300013105 | Ga0157369_10699111 | Ga0157369_106991112 | 107 |
| 241 | 3300013307 | Ga0157372_10001703 | Ga0157372_100017039 | 107 |
| 242 | 3300021384 | Ga0213876_10057640 | Ga0213876_100576403 | 107 |
| 243 | 3300025899 | Ga0207642_11130341 | Ga0207642_111303411 | 107 |
| 244 | 3300025944 | Ga0207661_10284405 | Ga0207661_102844052 | 107 |
| 245 | 3300028556 | Ga0265337_1163152 | Ga0265337_11631522 | 107 |
| 246 | 3300028563 | Ga0265319_1002119 | Ga0265319_10021196 | 107 |
| 247 | 3300028577 | Ga0265318_10000789 | Ga0265318_1000078918 | 107 |
| 248 | 3300028800 | Ga0265338_10127546 | Ga0265338_101275463 | 107 |
| 249 | 3300031235 | Ga0265330_10000549 | Ga0265330_100005493 | 107 |
| 250 | 3300031238 | Ga0265332_10002164 | Ga0265332_100021647 | 107 |
| 251 | 3300031239 | Ga0265328_10001977 | Ga0265328_100019775 | 107 |
| 252 | 3300031240 | Ga0265320_10004029 | Ga0265320_100040297 | 107 |
| 253 | 3300031240 | Ga0265320_10085755 | Ga0265320_100857552 | 107 |
| 254 | 3300031242 | Ga0265329_10004468 | Ga0265329_100044687 | 107 |
| 255 | 3300031247 | Ga0265340_10010877 | Ga0265340_100108772 | 107 |
| 256 | 3300031249 | Ga0265339_10009032 | Ga0265339_100090325 | 107 |
| 257 | 3300031250 | Ga0265331_10007955 | Ga0265331_100079552 | 107 |
| 258 | 3300031344 | Ga0265316_10004965 | Ga0265316_100049657 | 107 |
| 259 | 3300031595 | Ga0265313_10000147 | Ga0265313_1000014758 | 107 |
| 260 | 3300031711 | Ga0265314_10002182 | Ga0265314_1000218222 | 107 |
| 261 | 3300031712 | Ga0265342_10000524 | Ga0265342_1000052418 | 107 |
| 262 | 3300035172 | Ga0373955_0302421 | Ga0373955_0302421_274_609 | 107 |
| 263 | 3300035692 | Ga0373935_0194009 | Ga0373935_0194009_385_720 | 107 |
| 264 | 3300035695 | Ga0373927_0017440 | Ga0373927_0017440_3467_3802 | 107 |
| 265 | 3300035724 | Ga0373933_0905139 | Ga0373933_0905139_52_387 | 107 |
| 266 | 3300037068 | Ga0373925_0064233 | Ga0373925_0064233_2271_2606 | 107 |
| 267 | 3300039437 | Ga0436365_0047339 | Ga0436365_0047339_748_1071 | 107 |
| 268 | 3300039450 | Ga0436363_0041486 | Ga0436363_0041486_34_360 | 107 |
| 269 | 3300041463 | Ga0451804_0687014 | Ga0451804_0687014_44_367 | 107 |
| 270 | 3300049571 | Ga0501034_0313088 | Ga0501034_0313088_44_367 | 107 |
| 271 | 3300049589 | Ga0501073_0015700 | Ga0501073_0015700_4207_4530 | 107 |
| 272 | 3300005564 | Ga0070664_100712228 | Ga0070664_1007122282 | 108 |
| 273 | 3300005983 | Ga0081540_1001701 | Ga0081540_10017014 | 108 |
| 274 | 3300006237 | Ga0097621_100084463 | Ga0097621_1000844631 | 108 |
| 275 | 3300013100 | Ga0157373_11091279 | Ga0157373_110912792 | 108 |
| 276 | 3300025945 | Ga0207679_11394485 | Ga0207679_113944852 | 108 |
| 277 | 3300031241 | Ga0265325_10459623 | Ga0265325_104596232 | 108 |
| 278 | 3300031711 | Ga0265314_10381285 | Ga0265314_103812851 | 108 |
| 279 | 3300035088 | Ga0373940_0002902 | Ga0373940_0002902_1219_1545 | 108 |
| 280 | 3300035089 | Ga0373944_0128704 | Ga0373944_0128704_312_638 | 108 |
| 281 | 3300035207 | Ga0373942_0102266 | Ga0373942_0102266_321_647 | 108 |
| 282 | 3300035695 | Ga0373927_0405292 | Ga0373927_0405292_520_846 | 108 |
| 283 | 3300035725 | Ga0373947_0484683 | Ga0373947_0484683_139_465 | 108 |
| 284 | 3300036401 | Ga0373937_1033137 | Ga0373937_1033137_152_478 | 108 |
| 285 | 3300037068 | Ga0373925_0791265 | Ga0373925_0791265_51_377 | 108 |
| 286 | 3300042008 | Ga0439450_090028 | Ga0439450_090028_394_720 | 108 |
| 287 | 3300042157 | Ga0439458_0176955 | Ga0439458_0176955_133_459 | 108 |
| 288 | 3300045051 | Ga0451576_0425517 | Ga0451576_0425517_754_1080 | 108 |
| 289 | 3300046683 | Ga0495658_0042519 | Ga0495658_0042519_30_356 | 108 |
| 290 | 3300053088 | Ga0500644_0399860 | Ga0500644_0399860_256_588 | 108 |
| 291 | 3300053103 | Ga0500555_121689 | Ga0500555_121689_172_504 | 108 |
| 292 | 2162886012 | MBSR1b_contig_780787 | MBSR1b_0446.00001520 | 109 |
| 293 | 3300002076 | JGI24749J21850_1003664 | JGI24749J21850_10036643 | 109 |
| 294 | 3300002459 | JGI24751J29686_10003963 | JGI24751J29686_100039634 | 109 |
| 295 | 3300005293 | Ga0065715_10714337 | Ga0065715_107143371 | 109 |
| 296 | 3300005327 | Ga0070658_10000267 | Ga0070658_1000026726 | 109 |
| 297 | 3300005328 | Ga0070676_10000455 | Ga0070676_1000045520 | 109 |
| 298 | 3300005329 | Ga0070683_100002672 | Ga0070683_1000026723 | 109 |
| 299 | 3300005330 | Ga0070690_100000292 | Ga0070690_10000029212 | 109 |
| 300 | 3300005331 | Ga0070670_100002161 | Ga0070670_10000216116 | 109 |
| 301 | 3300005333 | Ga0070677_10000659 | Ga0070677_100006593 | 109 |
| 302 | 3300005334 | Ga0068869_100000149 | Ga0068869_10000014934 | 109 |
| 303 | 3300005335 | Ga0070666_10005115 | Ga0070666_100051156 | 109 |
| 304 | 3300005336 | Ga0070680_100032483 | Ga0070680_1000324832 | 109 |
| 305 | 3300005337 | Ga0070682_100024779 | Ga0070682_1000247794 | 109 |
| 306 | 3300005338 | Ga0068868_100000367 | Ga0068868_10000036722 | 109 |
| 307 | 3300005339 | Ga0070660_100000058 | Ga0070660_10000005850 | 109 |
| 308 | 3300005340 | Ga0070689_100000151 | Ga0070689_10000015115 | 109 |
| 309 | 3300005341 | Ga0070691_10106097 | Ga0070691_101060971 | 109 |
| 310 | 3300005343 | Ga0070687_100000029 | Ga0070687_10000002938 | 109 |
| 311 | 3300005344 | Ga0070661_100000959 | Ga0070661_10000095917 | 109 |
| 312 | 3300005345 | Ga0070692_10000821 | Ga0070692_1000082110 | 109 |
| 313 | 3300005347 | Ga0070668_100000494 | Ga0070668_1000004943 | 109 |
| 314 | 3300005353 | Ga0070669_100000134 | Ga0070669_10000013432 | 109 |
| 315 | 3300005354 | Ga0070675_100017729 | Ga0070675_1000177295 | 109 |
| 316 | 3300005355 | Ga0070671_100000228 | Ga0070671_10000022822 | 109 |
| 317 | 3300005356 | Ga0070674_100003322 | Ga0070674_1000033225 | 109 |
| 318 | 3300005364 | Ga0070673_100006101 | Ga0070673_1000061015 | 109 |
| 319 | 3300005365 | Ga0070688_100000073 | Ga0070688_10000007332 | 109 |
| 320 | 3300005366 | Ga0070659_100034689 | Ga0070659_1000346892 | 109 |
| 321 | 3300005367 | Ga0070667_100000935 | Ga0070667_10000093517 | 109 |
| 322 | 3300005438 | Ga0070701_10001016 | Ga0070701_100010165 | 109 |
| 323 | 3300005439 | Ga0070711_100090769 | Ga0070711_1000907692 | 109 |
| 324 | 3300005440 | Ga0070705_100000689 | Ga0070705_10000068920 | 109 |
| 325 | 3300005441 | Ga0070700_100003721 | Ga0070700_1000037213 | 109 |
| 326 | 3300005455 | Ga0070663_100000498 | Ga0070663_1000004983 | 109 |
| 327 | 3300005456 | Ga0070678_100013401 | Ga0070678_1000134012 | 109 |
| 328 | 3300005457 | Ga0070662_100000386 | Ga0070662_1000003867 | 109 |
| 329 | 3300005459 | Ga0068867_100000197 | Ga0068867_10000019719 | 109 |
| 330 | 3300005466 | Ga0070685_10000121 | Ga0070685_1000012132 | 109 |
| 331 | 3300005535 | Ga0070684_100033909 | Ga0070684_1000339093 | 109 |
| 332 | 3300005539 | Ga0068853_100000228 | Ga0068853_10000022823 | 109 |
| 333 | 3300005543 | Ga0070672_100000078 | Ga0070672_10000007837 | 109 |
| 334 | 3300005544 | Ga0070686_100000139 | Ga0070686_10000013923 | 109 |
| 335 | 3300005545 | Ga0070695_100006206 | Ga0070695_1000062066 | 109 |
| 336 | 3300005547 | Ga0070693_100007457 | Ga0070693_1000074575 | 109 |
| 337 | 3300005548 | Ga0070665_100031779 | Ga0070665_1000317796 | 109 |
| 338 | 3300005549 | Ga0070704_100010095 | Ga0070704_1000100953 | 109 |
| 339 | 3300005563 | Ga0068855_100000217 | Ga0068855_10000021754 | 109 |
| 340 | 3300005564 | Ga0070664_100001075 | Ga0070664_10000107518 | 109 |
| 341 | 3300005577 | Ga0068857_100003562 | Ga0068857_10000356210 | 109 |
| 342 | 3300005578 | Ga0068854_100000661 | Ga0068854_10000066117 | 109 |
| 343 | 3300005614 | Ga0068856_100005364 | Ga0068856_1000053643 | 109 |
| 344 | 3300005615 | Ga0070702_100031630 | Ga0070702_1000316303 | 109 |
| 345 | 3300005616 | Ga0068852_100000081 | Ga0068852_10000008150 | 109 |
| 346 | 3300005617 | Ga0068859_100003422 | Ga0068859_10000342216 | 109 |
| 347 | 3300005618 | Ga0068864_100002038 | Ga0068864_10000203817 | 109 |
| 348 | 3300005718 | Ga0068866_10000231 | Ga0068866_1000023110 | 109 |
| 349 | 3300005719 | Ga0068861_100000119 | Ga0068861_10000011920 | 109 |
| 350 | 3300005834 | Ga0068851_10000089 | Ga0068851_1000008936 | 109 |
| 351 | 3300005840 | Ga0068870_10000022 | Ga0068870_1000002216 | 109 |
| 352 | 3300005841 | Ga0068863_100000598 | Ga0068863_1000005989 | 109 |
| 353 | 3300005842 | Ga0068858_100003407 | Ga0068858_10000340716 | 109 |
| 354 | 3300005843 | Ga0068860_100001206 | Ga0068860_1000012065 | 109 |
| 355 | 3300005844 | Ga0068862_100000893 | Ga0068862_10000089312 | 109 |
| 356 | 3300006173 | Ga0070716_101249767 | Ga0070716_1012497672 | 109 |
| 357 | 3300006237 | Ga0097621_100000364 | Ga0097621_10000036418 | 109 |
| 358 | 3300006358 | Ga0068871_100001311 | Ga0068871_1000013114 | 109 |
| 359 | 3300006871 | Ga0075434_101383310 | Ga0075434_1013833101 | 109 |
| 360 | 3300006881 | Ga0068865_100000257 | Ga0068865_1000002575 | 109 |
| 361 | 3300006931 | Ga0097620_100003422 | Ga0097620_10000342216 | 109 |
| 362 | 3300009092 | Ga0105250_10263505 | Ga0105250_102635052 | 109 |
| 363 | 3300009093 | Ga0105240_10001539 | Ga0105240_1000153922 | 109 |
| 364 | 3300009098 | Ga0105245_10000654 | Ga0105245_1000065410 | 109 |
| 365 | 3300009101 | Ga0105247_10002206 | Ga0105247_1000220612 | 109 |
| 366 | 3300009148 | Ga0105243_10038421 | Ga0105243_100384214 | 109 |
| 367 | 3300009174 | Ga0105241_10000131 | Ga0105241_1000013126 | 109 |
| 368 | 3300009177 | Ga0105248_10039085 | Ga0105248_100390852 | 109 |
| 369 | 3300009545 | Ga0105237_10000612 | Ga0105237_1000061232 | 109 |
| 370 | 3300009551 | Ga0105238_10000291 | Ga0105238_1000029111 | 109 |
| 371 | 3300009553 | Ga0105249_10000315 | Ga0105249_1000031515 | 109 |
| 372 | 3300010375 | Ga0105239_10000109 | Ga0105239_1000010950 | 109 |
| 373 | 3300011119 | Ga0105246_10002083 | Ga0105246_100020835 | 109 |
| 374 | 3300013102 | Ga0157371_10000699 | Ga0157371_1000069933 | 109 |
| 375 | 3300013105 | Ga0157369_10113947 | Ga0157369_101139473 | 109 |
| 376 | 3300013296 | Ga0157374_10000551 | Ga0157374_1000055115 | 109 |
| 377 | 3300013297 | Ga0157378_10005511 | Ga0157378_100055118 | 109 |
| 378 | 3300013306 | Ga0163162_10000262 | Ga0163162_1000026231 | 109 |
| 379 | 3300013307 | Ga0157372_10002253 | Ga0157372_100022533 | 109 |
| 380 | 3300013308 | Ga0157375_10018741 | Ga0157375_100187413 | 109 |
| 381 | 3300014325 | Ga0163163_10078207 | Ga0163163_100782073 | 109 |
| 382 | 3300014326 | Ga0157380_10351596 | Ga0157380_103515962 | 109 |
| 383 | 3300014745 | Ga0157377_10000402 | Ga0157377_100004023 | 109 |
| 384 | 3300014968 | Ga0157379_10000031 | Ga0157379_1000003137 | 109 |
| 385 | 3300014969 | Ga0157376_10000289 | Ga0157376_1000028918 | 109 |
| 386 | 3300014969 | Ga0157376_10046175 | Ga0157376_100461754 | 109 |
| 387 | 3300025315 | Ga0207697_10000035 | Ga0207697_1000003524 | 109 |
| 388 | 3300025321 | Ga0207656_10005954 | Ga0207656_100059543 | 109 |
| 389 | 3300025893 | Ga0207682_10000027 | Ga0207682_100000275 | 109 |
| 390 | 3300025899 | Ga0207642_10005152 | Ga0207642_100051523 | 109 |
| 391 | 3300025900 | Ga0207710_10001160 | Ga0207710_1000116012 | 109 |
| 392 | 3300025901 | Ga0207688_10000069 | Ga0207688_100000695 | 109 |
| 393 | 3300025903 | Ga0207680_10000061 | Ga0207680_1000006127 | 109 |
| 394 | 3300025904 | Ga0207647_10004258 | Ga0207647_100042584 | 109 |
| 395 | 3300025907 | Ga0207645_10000004 | Ga0207645_1000000475 | 109 |
| 396 | 3300025908 | Ga0207643_10000015 | Ga0207643_1000001535 | 109 |
| 397 | 3300025909 | Ga0207705_10002373 | Ga0207705_100023734 | 109 |
| 398 | 3300025911 | Ga0207654_10003832 | Ga0207654_100038325 | 109 |
| 399 | 3300025913 | Ga0207695_10027571 | Ga0207695_100275712 | 109 |
| 400 | 3300025914 | Ga0207671_10006955 | Ga0207671_100069554 | 109 |
| 401 | 3300025917 | Ga0207660_10022025 | Ga0207660_100220252 | 109 |
| 402 | 3300025918 | Ga0207662_10000035 | Ga0207662_1000003514 | 109 |
| 403 | 3300025919 | Ga0207657_10000032 | Ga0207657_1000003246 | 109 |
| 404 | 3300025920 | Ga0207649_10000317 | Ga0207649_100003178 | 109 |
| 405 | 3300025923 | Ga0207681_10000091 | Ga0207681_1000009146 | 109 |
| 406 | 3300025924 | Ga0207694_10000541 | Ga0207694_1000054126 | 109 |
| 407 | 3300025925 | Ga0207650_10000113 | Ga0207650_1000011374 | 109 |
| 408 | 3300025926 | Ga0207659_10000026 | Ga0207659_1000002664 | 109 |
| 409 | 3300025927 | Ga0207687_10000953 | Ga0207687_100009534 | 109 |
| 410 | 3300025931 | Ga0207644_10000229 | Ga0207644_1000022925 | 109 |
| 411 | 3300025932 | Ga0207690_10001164 | Ga0207690_1000116411 | 109 |
| 412 | 3300025933 | Ga0207706_10000021 | Ga0207706_1000002195 | 109 |
| 413 | 3300025935 | Ga0207709_10081358 | Ga0207709_100813581 | 109 |
| 414 | 3300025936 | Ga0207670_10000055 | Ga0207670_1000005550 | 109 |
| 415 | 3300025937 | Ga0207669_10000108 | Ga0207669_1000010825 | 109 |
| 416 | 3300025938 | Ga0207704_10000122 | Ga0207704_1000012216 | 109 |
| 417 | 3300025940 | Ga0207691_10000008 | Ga0207691_1000000889 | 109 |
| 418 | 3300025941 | Ga0207711_10000037 | Ga0207711_1000003764 | 109 |
| 419 | 3300025942 | Ga0207689_10000001 | Ga0207689_10000001185 | 109 |
| 420 | 3300025944 | Ga0207661_10001929 | Ga0207661_100019293 | 109 |
| 421 | 3300025945 | Ga0207679_10000076 | Ga0207679_1000007650 | 109 |
| 422 | 3300025949 | Ga0207667_10000897 | Ga0207667_1000089716 | 109 |
| 423 | 3300025960 | Ga0207651_10000022 | Ga0207651_1000002225 | 109 |
| 424 | 3300025961 | Ga0207712_10000166 | Ga0207712_1000016615 | 109 |
| 425 | 3300025972 | Ga0207668_10000320 | Ga0207668_1000032025 | 109 |
| 426 | 3300025981 | Ga0207640_10000123 | Ga0207640_1000012333 | 109 |
| 427 | 3300025986 | Ga0207658_10000234 | Ga0207658_100002348 | 109 |
| 428 | 3300026023 | Ga0207677_10000031 | Ga0207677_1000003170 | 109 |
| 429 | 3300026035 | Ga0207703_10000068 | Ga0207703_1000006846 | 109 |
| 430 | 3300026041 | Ga0207639_10008421 | Ga0207639_100084214 | 109 |
| 431 | 3300026067 | Ga0207678_10000639 | Ga0207678_1000063927 | 109 |
| 432 | 3300026075 | Ga0207708_10016736 | Ga0207708_100167363 | 109 |
| 433 | 3300026078 | Ga0207702_10007670 | Ga0207702_100076708 | 109 |
| 434 | 3300026088 | Ga0207641_10000324 | Ga0207641_1000032438 | 109 |
| 435 | 3300026089 | Ga0207648_10000004 | Ga0207648_10000004184 | 109 |
| 436 | 3300026095 | Ga0207676_10000122 | Ga0207676_1000012217 | 109 |
| 437 | 3300026116 | Ga0207674_10000088 | Ga0207674_1000008811 | 109 |
| 438 | 3300026118 | Ga0207675_100000003 | Ga0207675_10000000384 | 109 |
| 439 | 3300026121 | Ga0207683_10000054 | Ga0207683_1000005433 | 109 |
| 440 | 3300026142 | Ga0207698_10010068 | Ga0207698_100100685 | 109 |
| 441 | 3300028379 | Ga0268266_10000172 | Ga0268266_1000017246 | 109 |
| 442 | 3300028380 | Ga0268265_10000076 | Ga0268265_1000007675 | 109 |
| 443 | 3300028381 | Ga0268264_10000203 | Ga0268264_1000020333 | 109 |
| 444 | 3300048903 | Ga0496100_1079638 | Ga0496100_1079638_100_429 | 109 |
| 445 | 3300048904 | Ga0496101_0414046 | Ga0496101_0414046_494_823 | 109 |
| 446 | 3300048905 | Ga0496102_0002715 | Ga0496102_0002715_12052_12381 | 109 |
| 447 | 3300048906 | Ga0496103_0014431 | Ga0496103_0014431_3647_3976 | 109 |
| 448 | 3300048907 | Ga0496104_0958386 | Ga0496104_0958386_274_603 | 109 |
| 449 | 3300048909 | Ga0496106_0008714 | Ga0496106_0008714_5366_5695 | 109 |
| 450 | 3300048910 | Ga0496107_0039419 | Ga0496107_0039419_2270_2599 | 109 |
| 451 | 3300048911 | Ga0496108_0024906 | Ga0496108_0024906_4039_4368 | 109 |
| 452 | 3300048912 | Ga0496109_0064405 | Ga0496109_0064405_705_1034 | 109 |
| 453 | 3300048913 | Ga0496110_0293328 | Ga0496110_0293328_359_688 | 109 |
| 454 | 3300048915 | Ga0496112_0000099 | Ga0496112_0000099_24549_24878 | 109 |
| 455 | 3300048916 | Ga0496113_0268479 | Ga0496113_0268479_1014_1343 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9396 | 4 | 88 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9276 | 22 | 73 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9269 | 4 | 80 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9264 | 19 | 74 |
| 2oqg-assembly1.cif.gz_B | arsr-like transcriptional regulator from rhodococcus sp. rha1 | 0.922 | 6 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9796 | 18 | 73 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9707 | 16 | 72 | 1.10.10.10 |
| af_P76066_81_136_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9504 | 27 | 73 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9447 | 12 | 73 | 1.10.10.10 |
| af_Q2FXF7_1_94_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9405 | 5 | 86 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T7N934-F1-model_v4 | Transcriptional regulator | 0.9924 | 6 | 90 |
GO:0003700
|
| AF-A0A3Q9B8T7-F1-model_v4 | deleted | 0.985 | 6 | 88 |
|
| AF-A0A7V8YLT6-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9838 | 4 | 90 |
GO:0003700
|
| AF-A0A499V473-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9838 | 6 | 81 |
GO:0003700
|
| AF-A0A1C6B492-F1-model_v4 | HTH-type transcriptional repressor AseR | 0.9832 | 7 | 89 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar