F447534

General Info

Members Datasets Scaffolds Average Seq Length
455 312 455 108

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100348481|Ga0070679_1003484811
Length 107
Sequence MHRPAADADVFRAIADPTRRAILTRLRRDGPSHVNALAAAFAQSRPSISKHLKILHTAGVVSEQRAGRQRVYRLEPETLRQVDDWISSYRELWQDNLNRLKRYLEEQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
193 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
240 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
241 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
242 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
307 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
308 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 3.3
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_780787 2162886012 Bacteria 2710
2 JGI24749J21850_1003664 3300002076 Unclassified 2147
3 JGI24751J29686_10003963 3300002459 Bacteria 2993
4 Ga0065715_10714337 3300005293 Bacteria 646
5 Ga0070658_10000267 3300005327 Bacteria 45819
6 Ga0070676_10000455 3300005328 Bacteria 19545
7 Ga0070683_100002672 3300005329 Bacteria 14248
8 Ga0070683_100073403 3300005329 Bacteria 3195
9 Ga0070683_100378033 3300005329 Unclassified 1350
10 Ga0070690_100000292 3300005330 Bacteria 25718
11 Ga0070670_100002161 3300005331 Bacteria 16143
12 Ga0070677_10000659 3300005333 Bacteria 11502
13 Ga0068869_100000149 3300005334 Bacteria 34450
14 Ga0070666_10005115 3300005335 Bacteria 8026
15 Ga0070680_100032483 3300005336 Bacteria 4202
16 Ga0070680_100866579 3300005336 Bacteria 779
17 Ga0070682_100024779 3300005337 Bacteria 3574
18 Ga0068868_100000367 3300005338 Bacteria 30665
19 Ga0070660_100000058 3300005339 Bacteria 66503
20 Ga0070689_100000151 3300005340 Bacteria 40558
21 Ga0070689_100555850 3300005340 Bacteria 989
22 Ga0070691_10106097 3300005341 Unclassified 1400
23 Ga0070687_100000029 3300005343 Bacteria 43999
24 Ga0070687_100230299 3300005343 Bacteria 1140
25 Ga0070661_100000959 3300005344 Bacteria 20526
26 Ga0070692_10000821 3300005345 Bacteria 10368
27 Ga0070668_100000494 3300005347 Bacteria 26113
28 Ga0070669_100000134 3300005353 Bacteria 67101
29 Ga0070675_100017729 3300005354 Bacteria 5663
30 Ga0070671_100000228 3300005355 Bacteria 37493
31 Ga0070674_100003322 3300005356 Bacteria 9008
32 Ga0070673_100006101 3300005364 Bacteria 7808
33 Ga0070688_100000073 3300005365 Bacteria 49973
34 Ga0070659_100034689 3300005366 Bacteria 3925
35 Ga0070667_100000935 3300005367 Bacteria 26905
36 Ga0070714_100602550 3300005435 Bacteria 1055
37 Ga0070710_10150088 3300005437 Bacteria 1437
38 Ga0070701_10001016 3300005438 Bacteria 10216
39 Ga0070701_10398747 3300005438 Bacteria 871
40 Ga0070711_100090769 3300005439 Unclassified 2201
41 Ga0070711_101832406 3300005439 Unclassified 533
42 Ga0070705_100000689 3300005440 Bacteria 19330
43 Ga0070705_100015044 3300005440 Bacteria 3992
44 Ga0070700_100003721 3300005441 Bacteria 7883
45 Ga0070708_100063110 3300005445 Unclassified 3315
46 Ga0070663_100000498 3300005455 Bacteria 20742
47 Ga0070678_100013401 3300005456 Bacteria 5139
48 Ga0070662_100000386 3300005457 Bacteria 26266
49 Ga0068867_100000197 3300005459 Bacteria 39845
50 Ga0070685_10000121 3300005466 Bacteria 50316
51 Ga0070706_100000190 3300005467 Bacteria 77656
52 Ga0070706_100099684 3300005467 Bacteria 2699
53 Ga0070707_100694013 3300005468 Unclassified 981
54 Ga0070698_100560481 3300005471 Bacteria 1082
55 Ga0070698_101010184 3300005471 Bacteria 779
56 Ga0070699_100484490 3300005518 Unclassified 1123
57 Ga0070679_100348481 3300005530 Unclassified 1429
58 Ga0070679_100508252 3300005530 Bacteria 1149
59 Ga0070684_100033909 3300005535 Unclassified 4362
60 Ga0070697_100002794 3300005536 Bacteria 13446
61 Ga0068853_100000228 3300005539 Bacteria 39894
62 Ga0070672_100000078 3300005543 Bacteria 45239
63 Ga0070686_100000139 3300005544 Bacteria 49928
64 Ga0070695_100006206 3300005545 Bacteria 7058
65 Ga0070696_100010337 3300005546 Bacteria 6252
66 Ga0070696_100995460 3300005546 Bacteria 700
67 Ga0070693_100007457 3300005547 Bacteria 5350
68 Ga0070665_100031779 3300005548 Bacteria 5313
69 Ga0070665_101536484 3300005548 Bacteria 674
70 Ga0070665_101910206 3300005548 Bacteria 599
71 Ga0070704_100010095 3300005549 Bacteria 5741
72 Ga0070704_100041230 3300005549 Bacteria 3185
73 Ga0068855_100000217 3300005563 Bacteria 73115
74 Ga0068855_101980404 3300005563 Bacteria 589
75 Ga0068855_102524077 3300005563 Bacteria 511
76 Ga0070664_100001075 3300005564 Bacteria 21516
77 Ga0070664_100712228 3300005564 Bacteria 936
78 Ga0068857_100003562 3300005577 Bacteria 13027
79 Ga0068857_101163471 3300005577 Bacteria 746
80 Ga0068857_101919760 3300005577 Bacteria 580
81 Ga0068854_100000661 3300005578 Bacteria 20541
82 Ga0068856_100005364 3300005614 Bacteria 12643
83 Ga0068856_101044468 3300005614 Bacteria 835
84 Ga0068856_102182298 3300005614 Bacteria 563
85 Ga0070702_100031630 3300005615 Unclassified 2898
86 Ga0068852_100000081 3300005616 Bacteria 67190
87 Ga0068852_100207673 3300005616 Bacteria 1856
88 Ga0068859_100003422 3300005617 Bacteria 16142
89 Ga0068859_100031470 3300005617 Bacteria 5329
90 Ga0068864_100002038 3300005618 Bacteria 16681
91 Ga0068864_100093091 3300005618 Bacteria 2662
92 Ga0068864_102229554 3300005618 Bacteria 554
93 Ga0068866_10000231 3300005718 Bacteria 26309
94 Ga0068866_10382962 3300005718 Bacteria 902
95 Ga0068861_100000119 3300005719 Bacteria 40098
96 Ga0068851_10000089 3300005834 Bacteria 50203
97 Ga0068870_10000022 3300005840 Bacteria 51836
98 Ga0068870_11030239 3300005840 Unclassified 588
99 Ga0068863_100000598 3300005841 Bacteria 36657
100 Ga0068863_100289673 3300005841 Bacteria 1587
101 Ga0068858_100003407 3300005842 Bacteria 15814
102 Ga0068860_100001206 3300005843 Bacteria 28199
103 Ga0068862_100000893 3300005844 Bacteria 28981
104 Ga0068862_102580727 3300005844 Bacteria 520
105 Ga0081455_10091201 3300005937 Bacteria 2468
106 Ga0081540_1001701 3300005983 Bacteria 18652
107 Ga0075365_10646666 3300006038 Bacteria 747
108 Ga0075368_10002170 3300006042 Bacteria 6348
109 Ga0075363_100166879 3300006048 Bacteria 1248
110 Ga0075364_10023671 3300006051 Bacteria 3890
111 Ga0070716_101249767 3300006173 Bacteria 598
112 Ga0070712_101590210 3300006175 Bacteria 572
113 Ga0075362_10023259 3300006177 Bacteria 2620
114 Ga0075367_10357195 3300006178 Bacteria 922
115 Ga0075369_10015173 3300006186 Bacteria 3088
116 Ga0075366_10087356 3300006195 Bacteria 1866
117 Ga0097621_100000364 3300006237 Bacteria 31432
118 Ga0097621_100084463 3300006237 Bacteria 2647
119 Ga0097621_101579794 3300006237 Bacteria 623
120 Ga0075370_10075145 3300006353 Bacteria 1937
121 Ga0068871_100001311 3300006358 Bacteria 16640
122 Ga0075433_10011793 3300006852 Bacteria 7040
123 Ga0075433_10056536 3300006852 Unclassified 3427
124 Ga0075433_10132629 3300006852 Unclassified 2213
125 Ga0075434_100040544 3300006871 Bacteria 4611
126 Ga0075434_100140598 3300006871 Unclassified 2433
127 Ga0075434_101383310 3300006871 Unclassified 714
128 Ga0068865_100000257 3300006881 Bacteria 29415
129 Ga0068865_100897929 3300006881 Bacteria 770
130 Ga0075436_100036208 3300006914 Bacteria 3406
131 Ga0075436_100160528 3300006914 Unclassified 1584
132 Ga0075436_101435981 3300006914 Unclassified 523
133 Ga0097620_100003422 3300006931 Bacteria 16142
134 Ga0097620_100031469 3300006931 Bacteria 5329
135 Ga0075435_100054228 3300007076 Unclassified 3235
136 Ga0075435_100192321 3300007076 Unclassified 1727
137 Ga0075435_100197300 3300007076 Bacteria 1705
138 Ga0075435_100575326 3300007076 Unclassified 976
139 Ga0075435_101997488 3300007076 Bacteria 509
140 Ga0099794_10000163 3300007265 Bacteria 24455
141 Ga0105250_10263505 3300009092 Bacteria 739
142 Ga0105240_10001539 3300009093 Bacteria 39146
143 Ga0105240_10862461 3300009093 Bacteria 976
144 Ga0105240_11105853 3300009093 Bacteria 843
145 Ga0111539_12893028 3300009094 Bacteria 556
146 Ga0105245_10000654 3300009098 Bacteria 31516
147 Ga0105245_10756314 3300009098 Bacteria 1008
148 Ga0105245_10995503 3300009098 Bacteria 882
149 Ga0105245_11335820 3300009098 Bacteria 766
150 Ga0105247_10002206 3300009101 Bacteria 13406
151 Ga0114129_10071033 3300009147 Bacteria 4854
152 Ga0114129_11378700 3300009147 Bacteria 871
153 Ga0105243_10038421 3300009148 Bacteria 3728
154 Ga0105243_10465265 3300009148 Bacteria 1190
155 Ga0105241_10000131 3300009174 Bacteria 54082
156 Ga0105248_10039085 3300009177 Bacteria 5313
157 Ga0105237_10000612 3300009545 Bacteria 49843
158 Ga0105238_10000291 3300009551 Bacteria 55788
159 Ga0105249_10000315 3300009553 Bacteria 48867
160 Ga0105239_10000109 3300010375 Bacteria 116335
161 Ga0105246_10002083 3300011119 Bacteria 12053
162 Ga0157373_11091279 3300013100 Bacteria 598
163 Ga0157371_10000699 3300013102 Bacteria 39420
164 Ga0157369_10113947 3300013105 Bacteria 2872
165 Ga0157369_10699111 3300013105 Bacteria 1044
166 Ga0157369_11252031 3300013105 Bacteria 757
167 Ga0157374_10000551 3300013296 Bacteria 33486
168 Ga0157374_10281966 3300013296 Bacteria 1641
169 Ga0157374_10414903 3300013296 Unclassified 1344
170 Ga0157374_10606110 3300013296 Bacteria 1105
171 Ga0157378_10005511 3300013297 Bacteria 11093
172 Ga0157378_10580585 3300013297 Bacteria 1130
173 Ga0163162_10000262 3300013306 Bacteria 47948
174 Ga0157372_10001703 3300013307 Bacteria 23832
175 Ga0157372_10002253 3300013307 Bacteria 20908
176 Ga0157375_10018741 3300013308 Bacteria 6280
177 Ga0163163_10078207 3300014325 Bacteria 3304
178 Ga0163163_12041713 3300014325 Bacteria 633
179 Ga0157380_10351596 3300014326 Unclassified 1379
180 Ga0157377_10000402 3300014745 Bacteria 18752
181 Ga0157379_10000031 3300014968 Bacteria 84367
182 Ga0157376_10000289 3300014969 Bacteria 33972
183 Ga0157376_10046175 3300014969 Bacteria 3590
184 Ga0157376_10814144 3300014969 Bacteria 947
185 Ga0157376_12860975 3300014969 Bacteria 522
186 Ga0213872_10057256 3300021361 Bacteria 1765
187 Ga0213876_10057640 3300021384 Bacteria 2051
188 Ga0213876_10099321 3300021384 Bacteria 1543
189 Ga0207697_10000035 3300025315 Bacteria 50098
190 Ga0207656_10005954 3300025321 Bacteria 4352
191 Ga0207682_10000027 3300025893 Bacteria 60031
192 Ga0207692_10069106 3300025898 Bacteria 1855
193 Ga0207642_10005152 3300025899 Bacteria 4253
194 Ga0207642_11130341 3300025899 Bacteria 507
195 Ga0207710_10001160 3300025900 Bacteria 13406
196 Ga0207688_10000069 3300025901 Bacteria 38157
197 Ga0207680_10000061 3300025903 Bacteria 50036
198 Ga0207647_10004258 3300025904 Bacteria 10609
199 Ga0207647_10026713 3300025904 Bacteria 3773
200 Ga0207645_10000004 3300025907 Bacteria 212114
201 Ga0207643_10000015 3300025908 Bacteria 125948
202 Ga0207705_10002373 3300025909 Bacteria 14552
203 Ga0207684_10000056 3300025910 Bacteria 215717
204 Ga0207684_10526285 3300025910 Bacteria 1012
205 Ga0207654_10003832 3300025911 Bacteria 7583
206 Ga0207707_10233375 3300025912 Bacteria 1601
207 Ga0207695_10027571 3300025913 Bacteria 6322
208 Ga0207671_10006955 3300025914 Bacteria 9952
209 Ga0207663_10251931 3300025916 Bacteria 1300
210 Ga0207660_10022025 3300025917 Bacteria 4291
211 Ga0207660_10759768 3300025917 Bacteria 791
212 Ga0207662_10000035 3300025918 Bacteria 60201
213 Ga0207662_10252239 3300025918 Bacteria 1158
214 Ga0207657_10000032 3300025919 Bacteria 129236
215 Ga0207649_10000317 3300025920 Bacteria 36587
216 Ga0207652_10284935 3300025921 Unclassified 1490
217 Ga0207646_10030034 3300025922 Bacteria 4933
218 Ga0207646_10751274 3300025922 Bacteria 870
219 Ga0207681_10000091 3300025923 Bacteria 78672
220 Ga0207694_10000541 3300025924 Bacteria 34288
221 Ga0207650_10000113 3300025925 Bacteria 105325
222 Ga0207659_10000026 3300025926 Bacteria 139726
223 Ga0207687_10000953 3300025927 Bacteria 19700
224 Ga0207687_10479867 3300025927 Bacteria 1035
225 Ga0207664_11270592 3300025929 Bacteria 655
226 Ga0207644_10000229 3300025931 Bacteria 38704
227 Ga0207690_10001164 3300025932 Bacteria 16647
228 Ga0207706_10000021 3300025933 Bacteria 160122
229 Ga0207709_10081358 3300025935 Bacteria 2088
230 Ga0207670_10000055 3300025936 Bacteria 84688
231 Ga0207670_11015665 3300025936 Bacteria 698
232 Ga0207669_10000108 3300025937 Bacteria 41349
233 Ga0207704_10000122 3300025938 Bacteria 42122
234 Ga0207691_10000008 3300025940 Bacteria 150329
235 Ga0207711_10000037 3300025941 Bacteria 165538
236 Ga0207689_10000001 3300025942 Bacteria 294504
237 Ga0207661_10001929 3300025944 Bacteria 14259
238 Ga0207661_10284405 3300025944 Bacteria 1479
239 Ga0207661_10408245 3300025944 Bacteria 1232
240 Ga0207661_10874802 3300025944 Bacteria 827
241 Ga0207679_10000076 3300025945 Bacteria 87612
242 Ga0207679_11394485 3300025945 Bacteria 643
243 Ga0207667_10000897 3300025949 Bacteria 37944
244 Ga0207667_10791484 3300025949 Bacteria 946
245 Ga0207651_10000022 3300025960 Bacteria 76544
246 Ga0207712_10000166 3300025961 Bacteria 67960
247 Ga0207668_10000320 3300025972 Bacteria 31302
248 Ga0207640_10000123 3300025981 Bacteria 59036
249 Ga0207658_10000234 3300025986 Bacteria 58649
250 Ga0207677_10000031 3300026023 Bacteria 120606
251 Ga0207677_11262620 3300026023 Bacteria 677
252 Ga0207703_10000068 3300026035 Bacteria 125011
253 Ga0207639_10008421 3300026041 Bacteria 7067
254 Ga0207678_10000639 3300026067 Bacteria 32178
255 Ga0207708_10016736 3300026075 Bacteria 5517
256 Ga0207702_10007670 3300026078 Bacteria 9175
257 Ga0207641_10000324 3300026088 Bacteria 58511
258 Ga0207641_10420306 3300026088 Bacteria 1287
259 Ga0207648_10000004 3300026089 Bacteria 247806
260 Ga0207676_10000122 3300026095 Bacteria 68609
261 Ga0207676_10155360 3300026095 Bacteria 1976
262 Ga0207674_10000088 3300026116 Bacteria 100118
263 Ga0207675_100000003 3300026118 Bacteria 262542
264 Ga0207683_10000054 3300026121 Bacteria 85047
265 Ga0207698_10010068 3300026142 Bacteria 6056
266 Ga0207698_10433275 3300026142 Bacteria 1265
267 Ga0209588_1000018 3300027671 Bacteria 95943
268 Ga0209813_10164719 3300027866 Bacteria 802
269 Ga0268266_10000172 3300028379 Bacteria 117909
270 Ga0268266_11079329 3300028379 Bacteria 777
271 Ga0268266_11505429 3300028379 Bacteria 648
272 Ga0268265_10000076 3300028380 Bacteria 124918
273 Ga0268264_10000203 3300028381 Bacteria 121101
274 Ga0265337_1163152 3300028556 Bacteria 604
275 Ga0265337_1214941 3300028556 Bacteria 522
276 Ga0265319_1002119 3300028563 Bacteria 11118
277 Ga0265334_10035229 3300028573 Unclassified 1982
278 Ga0265318_10000789 3300028577 Bacteria 20978
279 Ga0265338_10109192 3300028800 Bacteria 2232
280 Ga0265338_10127546 3300028800 Bacteria 2016
281 Ga0265330_10000549 3300031235 Bacteria 24576
282 Ga0265332_10002164 3300031238 Bacteria 10121
283 Ga0265332_10247651 3300031238 Unclassified 737
284 Ga0265328_10001977 3300031239 Bacteria 9310
285 Ga0265320_10004029 3300031240 Bacteria 9652
286 Ga0265320_10009542 3300031240 Bacteria 5846
287 Ga0265320_10085755 3300031240 Bacteria 1465
288 Ga0265320_10097156 3300031240 Bacteria 1359
289 Ga0265325_10459623 3300031241 Bacteria 554
290 Ga0265329_10004468 3300031242 Bacteria 5804
291 Ga0265329_10098699 3300031242 Bacteria 929
292 Ga0265340_10010877 3300031247 Bacteria 4855
293 Ga0265339_10009032 3300031249 Bacteria 6296
294 Ga0265339_10168845 3300031249 Bacteria 1096
295 Ga0265331_10007955 3300031250 Bacteria 6071
296 Ga0265316_10004965 3300031344 Bacteria 13070
297 Ga0307509_10000002 3300031507 Bacteria 607551
298 Ga0265313_10000147 3300031595 Bacteria 73404
299 Ga0265314_10002182 3300031711 Bacteria 20464
300 Ga0265314_10019170 3300031711 Bacteria 5306
301 Ga0265314_10041020 3300031711 Bacteria 3317
302 Ga0265314_10381285 3300031711 Bacteria 767
303 Ga0265342_10000079 3300031712 Bacteria 104996
304 Ga0265342_10000524 3300031712 Bacteria 40866
305 Ga0265342_10185951 3300031712 Bacteria 1136
306 Ga0373950_0000045 3300034818 Bacteria 97374
307 Ga0373926_0289068 3300035083 Bacteria 639
308 Ga0373940_0002902 3300035088 Bacteria 3416
309 Ga0373944_0128704 3300035089 Bacteria 879
310 Ga0373923_0614952 3300035111 Bacteria 536
311 Ga0373936_0264945 3300035113 Unclassified 770
312 Ga0373953_0388052 3300035117 Bacteria 614
313 Ga0373954_0002640 3300035118 Bacteria 7545
314 Ga0373954_0111002 3300035118 Bacteria 1326
315 Ga0373956_0050560 3300035119 Bacteria 1866
316 Ga0373957_0178038 3300035120 Bacteria 881
317 Ga0373955_0004507 3300035172 Bacteria 6169
318 Ga0373955_0302421 3300035172 Bacteria 965
319 Ga0373942_0102266 3300035207 Unclassified 877
320 Ga0373935_0194009 3300035692 Bacteria 1400
321 Ga0373935_0224436 3300035692 Bacteria 1306
322 Ga0373927_0017440 3300035695 Bacteria 4725
323 Ga0373927_0405292 3300035695 Bacteria 900
324 Ga0373933_0000382 3300035724 Bacteria 28423
325 Ga0373933_0019125 3300035724 Bacteria 3863
326 Ga0373933_0905139 3300035724 Bacteria 581
327 Ga0373947_0484683 3300035725 Bacteria 839
328 Ga0373937_0003214 3300036401 Bacteria 13682
329 Ga0373937_0058361 3300036401 Bacteria 3545
330 Ga0373937_1033137 3300036401 Bacteria 770
331 Ga0373925_0064233 3300037068 Bacteria 2763
332 Ga0373925_0791265 3300037068 Bacteria 782
333 Ga0373925_1071628 3300037068 Bacteria 663
334 Ga0395899_0046520 3300037312 Bacteria 3232
335 Ga0395900_0078787 3300037418 Bacteria 3385
336 Ga0395900_0558378 3300037418 Bacteria 1089
337 Ga0395898_0026714 3300037466 Bacteria 5802
338 Ga0436364_0585700 3300037853 Bacteria 744
339 Ga0436364_1152798 3300037853 Unclassified 772
340 Ga0395901_0127211 3300038443 Bacteria 2677
341 Ga0242420_079651 3300038996 Unclassified 675
342 Ga0436365_0047339 3300039437 Bacteria 5858
343 Ga0436365_0261465 3300039437 Bacteria 2789
344 Ga0436360_0541243 3300039438 Bacteria 879
345 Ga0436361_0120850 3300039447 Bacteria 15595
346 Ga0436361_0125710 3300039447 Bacteria 709
347 Ga0436361_0554441 3300039447 Bacteria 1528
348 Ga0436363_0041486 3300039450 Bacteria 790
349 Ga0451804_0687014 3300041463 Unclassified 547
350 Ga0451851_0548223 3300041507 Bacteria 1020
351 Ga0439450_090028 3300042008 Bacteria 770
352 Ga0439458_0176955 3300042157 Bacteria 578
353 Ga0453684_0018480 3300044712 Bacteria 10697
354 Ga0466957_0011360 3300044842 Bacteria 5135
355 Ga0466960_0207723 3300044901 Bacteria 1072
356 Ga0466959_0029847 3300045049 Unclassified 4039
357 Ga0451576_0002519 3300045051 Bacteria 27136
358 Ga0451576_0425517 3300045051 Bacteria 1393
359 Ga0495590_0127275 3300046457 Unclassified 915
360 Ga0495641_0262417 3300046461 Bacteria 777
361 Ga0495641_0443387 3300046461 Archaea 590
362 Ga0495651_0278629 3300046462 Bacteria 1131
363 Ga0495662_0194380 3300046476 Archaea 1000
364 Ga0495594_0343948 3300046499 Archaea 849
365 Ga0495632_0203706 3300046519 Bacteria 900
366 Ga0495645_0829005 3300046543 Unclassified 553
367 Ga0495667_0100738 3300046559 Bacteria 1869
368 Ga0495634_0588141 3300046642 Bacteria 647
369 Ga0495657_0247854 3300046675 Bacteria 1073
370 Ga0495658_0042519 3300046683 Bacteria 2537
371 Ga0495624_0639471 3300046690 Archaea 633
372 Ga0495604_0590805 3300047317 Bacteria 713
373 Ga0495680_0056239 3300047322 Bacteria 3047
374 Ga0495680_0299690 3300047322 Bacteria 1129
375 Ga0495680_0868547 3300047322 Bacteria 585
376 Ga0496100_1079638 3300048903 Bacteria 632
377 Ga0496101_0414046 3300048904 Bacteria 1062
378 Ga0496102_0002715 3300048905 Bacteria 15057
379 Ga0496103_0014431 3300048906 Bacteria 4690
380 Ga0496104_0958386 3300048907 Bacteria 760
381 Ga0496106_0008714 3300048909 Bacteria 7503
382 Ga0496107_0039419 3300048910 Bacteria 3389
383 Ga0496107_0930193 3300048910 Bacteria 633
384 Ga0496108_0024906 3300048911 Bacteria 4929
385 Ga0496109_0064405 3300048912 Bacteria 3354
386 Ga0496110_0293328 3300048913 Unclassified 1481
387 Ga0496112_0000099 3300048915 Bacteria 56380
388 Ga0496113_0268479 3300048916 Unclassified 1363
389 Ga0496114_0152124 3300048917 Unclassified 2008
390 Ga0501034_0000306 3300049571 Bacteria 87050
391 Ga0501034_0313088 3300049571 Bacteria 1504
392 Ga0501036_0007224 3300049572 Bacteria 9044
393 Ga0501036_0086908 3300049572 Bacteria 2643
394 Ga0501038_0083437 3300049574 Unclassified 2690
395 Ga0501043_0002392 3300049579 Bacteria 15897
396 Ga0501043_0209220 3300049579 Unclassified 1512
397 Ga0501043_0701512 3300049579 Bacteria 739
398 Ga0501046_0002309 3300049580 Bacteria 17976
399 Ga0501047_0000009 3300049581 Bacteria 436619
400 Ga0501047_0057675 3300049581 Bacteria 3755
401 Ga0501048_0004641 3300049582 Bacteria 10457
402 Ga0501068_0001628 3300049584 Bacteria 11974
403 Ga0501068_0078581 3300049584 Bacteria 2022
404 Ga0501069_0159040 3300049585 Bacteria 1301
405 Ga0501069_0201477 3300049585 Bacteria 1153
406 Ga0501070_0125883 3300049586 Unclassified 2117
407 Ga0501070_0364768 3300049586 Bacteria 1171
408 Ga0501072_0000022 3300049588 Bacteria 152450
409 Ga0501073_0005858 3300049589 Bacteria 9170
410 Ga0501073_0015700 3300049589 Bacteria 5492
411 Ga0501073_0025467 3300049589 Bacteria 4242
412 Ga0501074_0000142 3300049590 Bacteria 37577
413 Ga0501074_0422427 3300049590 Unclassified 945
414 Ga0501079_0001689 3300049741 Bacteria 15699
415 Ga0501080_0264807 3300049742 Bacteria 1565
416 Ga0501083_0005104 3300049744 Bacteria 9295
417 Ga0501083_0020518 3300049744 Bacteria 4596
418 Ga0501083_0397265 3300049744 Bacteria 897
419 Ga0501035_1492554 3300049822 Bacteria 516
420 Ga0501044_1424336 3300049823 Bacteria 558
421 nmdc:mga0yw44_160220_c1 3300050492 Bacteria 1473
422 nmdc:mga0k408_720684_c1 3300050493 Bacteria 584
423 nmdc:mga06z11_347333_c1 3300050494 Bacteria 888
424 nmdc:mga04h51_20105_c1 3300050495 Bacteria 1989
425 nmdc:mga07m45_86896_c1 3300050496 Bacteria 1789
426 nmdc:mga05p37_256841_c1 3300050507 Bacteria 2093
427 nmdc:mga09592_1104465_c1 3300050508 Unclassified 659
428 nmdc:mga0n895_132731_c1 3300050512 Unclassified 2516
429 nmdc:mga0n895_1421891_c1 3300050512 Unclassified 662
430 nmdc:mga0n895_1678113_c1 3300050512 Bacteria 598
431 nmdc:mga0n895_1681325_c1 3300050512 Bacteria 598
432 nmdc:mga0n895_4828_c1 3300050512 Bacteria 11163
433 nmdc:mga0n895_77688_c1 3300050512 Bacteria 3303
434 nmdc:mga0rr50_38659_c1 3300050513 Unclassified 3455
435 nmdc:mga0rr50_57452_c1 3300050513 Bacteria 2911
436 nmdc:mga0rr50_94229_c1 3300050513 Unclassified 2338
437 nmdc:mga08x19_1231623_c1 3300050514 Unclassified 530
438 nmdc:mga08x19_16994_c1 3300050514 Bacteria 4446
439 nmdc:mga08x19_423619_c1 3300050514 Unclassified 935
440 nmdc:mga08x19_508430_c1 3300050514 Unclassified 851
441 nmdc:mga0a205_152032_c1 3300050515 Unclassified 2214
442 nmdc:mga0a205_29873_c1 3300050515 Bacteria 5216
443 Ga0495601_0047786 3300053077 Bacteria 2695
444 Ga0495601_0147834 3300053077 Bacteria 1534
445 Ga0495619_0260742 3300053085 Bacteria 1201
446 Ga0500644_0399860 3300053088 Unclassified 599
447 Ga0500555_121689 3300053103 Unclassified 652
448 Ga0500655_021670 3300053133 Bacteria 1206
449 Ga0500568_0090339 3300053139 Bacteria 1155
450 Ga0500636_0062150 3300053177 Bacteria 2178
451 Ga0501084_0000006 3300054114 Bacteria 234041
452 Ga0501084_0071919 3300054114 Bacteria 2896
453 Ga0501082_0078471 3300060353 Bacteria 2848
454 Ga0501082_0082054 3300060353 Unclassified 2781
455 Ga0501082_0309675 3300060353 Bacteria 1375

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_101919760 Ga0068857_1019197602 103
2 3300006881 Ga0068865_100897929 Ga0068865_1008979291 103
3 3300009148 Ga0105243_10465265 Ga0105243_104652652 103
4 3300014325 Ga0163163_12041713 Ga0163163_120417132 103
5 3300031507 Ga0307509_10000002 Ga0307509_10000002156 103
6 3300044712 Ga0453684_0018480 Ga0453684_0018480_9413_9751 103
7 3300046519 Ga0495632_0203706 Ga0495632_0203706_344_688 103
8 3300005840 Ga0068870_11030239 Ga0068870_110302392 104
9 3300026023 Ga0207677_11262620 Ga0207677_112626202 104
10 3300005329 Ga0070683_100073403 Ga0070683_1000734034 106
11 3300005336 Ga0070680_100866579 Ga0070680_1008665792 106
12 3300005340 Ga0070689_100555850 Ga0070689_1005558502 106
13 3300005343 Ga0070687_100230299 Ga0070687_1002302992 106
14 3300005435 Ga0070714_100602550 Ga0070714_1006025502 106
15 3300005437 Ga0070710_10150088 Ga0070710_101500882 106
16 3300005438 Ga0070701_10398747 Ga0070701_103987471 106
17 3300005439 Ga0070711_101832406 Ga0070711_1018324062 106
18 3300005440 Ga0070705_100015044 Ga0070705_1000150445 106
19 3300005445 Ga0070708_100063110 Ga0070708_1000631104 106
20 3300005467 Ga0070706_100000190 Ga0070706_10000019060 106
21 3300005467 Ga0070706_100099684 Ga0070706_1000996843 106
22 3300005468 Ga0070707_100694013 Ga0070707_1006940132 106
23 3300005471 Ga0070698_100560481 Ga0070698_1005604812 106
24 3300005471 Ga0070698_101010184 Ga0070698_1010101842 106
25 3300005518 Ga0070699_100484490 Ga0070699_1004844902 106
26 3300005530 Ga0070679_100348481 Ga0070679_1003484811 106
27 3300005530 Ga0070679_100508252 Ga0070679_1005082522 106
28 3300005536 Ga0070697_100002794 Ga0070697_1000027948 106
29 3300005546 Ga0070696_100010337 Ga0070696_1000103377 106
30 3300005546 Ga0070696_100995460 Ga0070696_1009954601 106
31 3300005548 Ga0070665_101536484 Ga0070665_1015364842 106
32 3300005548 Ga0070665_101910206 Ga0070665_1019102062 106
33 3300005549 Ga0070704_100041230 Ga0070704_1000412304 106
34 3300005563 Ga0068855_101980404 Ga0068855_1019804042 106
35 3300005563 Ga0068855_102524077 Ga0068855_1025240771 106
36 3300005577 Ga0068857_101163471 Ga0068857_1011634712 106
37 3300005614 Ga0068856_101044468 Ga0068856_1010444682 106
38 3300005614 Ga0068856_102182298 Ga0068856_1021822981 106
39 3300005616 Ga0068852_100207673 Ga0068852_1002076732 106
40 3300005617 Ga0068859_100031470 Ga0068859_1000314704 106
41 3300005618 Ga0068864_100093091 Ga0068864_1000930912 106
42 3300005841 Ga0068863_100289673 Ga0068863_1002896733 106
43 3300005844 Ga0068862_102580727 Ga0068862_1025807271 106
44 3300005937 Ga0081455_10091201 Ga0081455_100912012 106
45 3300006038 Ga0075365_10646666 Ga0075365_106466661 106
46 3300006042 Ga0075368_10002170 Ga0075368_100021705 106
47 3300006048 Ga0075363_100166879 Ga0075363_1001668792 106
48 3300006051 Ga0075364_10023671 Ga0075364_100236712 106
49 3300006175 Ga0070712_101590210 Ga0070712_1015902102 106
50 3300006177 Ga0075362_10023259 Ga0075362_100232592 106
51 3300006178 Ga0075367_10357195 Ga0075367_103571952 106
52 3300006186 Ga0075369_10015173 Ga0075369_100151735 106
53 3300006195 Ga0075366_10087356 Ga0075366_100873563 106
54 3300006237 Ga0097621_101579794 Ga0097621_1015797942 106
55 3300006353 Ga0075370_10075145 Ga0075370_100751452 106
56 3300006852 Ga0075433_10011793 Ga0075433_100117936 106
57 3300006852 Ga0075433_10056536 Ga0075433_100565362 106
58 3300006852 Ga0075433_10132629 Ga0075433_101326291 106
59 3300006871 Ga0075434_100040544 Ga0075434_1000405443 106
60 3300006871 Ga0075434_100140598 Ga0075434_1001405984 106
61 3300006914 Ga0075436_100036208 Ga0075436_1000362083 106
62 3300006914 Ga0075436_100160528 Ga0075436_1001605283 106
63 3300006914 Ga0075436_101435981 Ga0075436_1014359811 106
64 3300006931 Ga0097620_100031469 Ga0097620_1000314694 106
65 3300007076 Ga0075435_100054228 Ga0075435_1000542282 106
66 3300007076 Ga0075435_100192321 Ga0075435_1001923213 106
67 3300007076 Ga0075435_100197300 Ga0075435_1001973002 106
68 3300007076 Ga0075435_100575326 Ga0075435_1005753262 106
69 3300007076 Ga0075435_101997488 Ga0075435_1019974882 106
70 3300007265 Ga0099794_10000163 Ga0099794_1000016318 106
71 3300009093 Ga0105240_10862461 Ga0105240_108624611 106
72 3300009093 Ga0105240_11105853 Ga0105240_111058532 106
73 3300009094 Ga0111539_12893028 Ga0111539_128930282 106
74 3300009098 Ga0105245_10756314 Ga0105245_107563142 106
75 3300009098 Ga0105245_10995503 Ga0105245_109955031 106
76 3300009098 Ga0105245_11335820 Ga0105245_113358202 106
77 3300009147 Ga0114129_10071033 Ga0114129_100710332 106
78 3300009147 Ga0114129_11378700 Ga0114129_113787002 106
79 3300013105 Ga0157369_11252031 Ga0157369_112520312 106
80 3300013296 Ga0157374_10281966 Ga0157374_102819662 106
81 3300013296 Ga0157374_10414903 Ga0157374_104149032 106
82 3300013296 Ga0157374_10606110 Ga0157374_106061102 106
83 3300013297 Ga0157378_10580585 Ga0157378_105805852 106
84 3300014969 Ga0157376_10814144 Ga0157376_108141442 106
85 3300014969 Ga0157376_12860975 Ga0157376_128609752 106
86 3300021361 Ga0213872_10057256 Ga0213872_100572561 106
87 3300021384 Ga0213876_10099321 Ga0213876_100993212 106
88 3300025898 Ga0207692_10069106 Ga0207692_100691063 106
89 3300025904 Ga0207647_10026713 Ga0207647_100267132 106
90 3300025910 Ga0207684_10000056 Ga0207684_1000005659 106
91 3300025910 Ga0207684_10526285 Ga0207684_105262852 106
92 3300025912 Ga0207707_10233375 Ga0207707_102333752 106
93 3300025916 Ga0207663_10251931 Ga0207663_102519312 106
94 3300025917 Ga0207660_10759768 Ga0207660_107597682 106
95 3300025918 Ga0207662_10252239 Ga0207662_102522392 106
96 3300025921 Ga0207652_10284935 Ga0207652_102849352 106
97 3300025922 Ga0207646_10030034 Ga0207646_100300345 106
98 3300025922 Ga0207646_10751274 Ga0207646_107512741 106
99 3300025927 Ga0207687_10479867 Ga0207687_104798672 106
100 3300025929 Ga0207664_11270592 Ga0207664_112705922 106
101 3300025936 Ga0207670_11015665 Ga0207670_110156652 106
102 3300025944 Ga0207661_10408245 Ga0207661_104082452 106
103 3300025944 Ga0207661_10874802 Ga0207661_108748022 106
104 3300025949 Ga0207667_10791484 Ga0207667_107914842 106
105 3300026088 Ga0207641_10420306 Ga0207641_104203061 106
106 3300026095 Ga0207676_10155360 Ga0207676_101553602 106
107 3300026142 Ga0207698_10433275 Ga0207698_104332752 106
108 3300027671 Ga0209588_1000018 Ga0209588_100001819 106
109 3300027866 Ga0209813_10164719 Ga0209813_101647192 106
110 3300028379 Ga0268266_11079329 Ga0268266_110793292 106
111 3300028379 Ga0268266_11505429 Ga0268266_115054292 106
112 3300028556 Ga0265337_1214941 Ga0265337_12149412 106
113 3300028573 Ga0265334_10035229 Ga0265334_100352292 106
114 3300028800 Ga0265338_10109192 Ga0265338_101091922 106
115 3300031238 Ga0265332_10247651 Ga0265332_102476512 106
116 3300031240 Ga0265320_10009542 Ga0265320_100095427 106
117 3300031240 Ga0265320_10097156 Ga0265320_100971562 106
118 3300031242 Ga0265329_10098699 Ga0265329_100986992 106
119 3300031249 Ga0265339_10168845 Ga0265339_101688452 106
120 3300031711 Ga0265314_10019170 Ga0265314_100191704 106
121 3300031711 Ga0265314_10041020 Ga0265314_100410203 106
122 3300031712 Ga0265342_10000079 Ga0265342_1000007929 106
123 3300031712 Ga0265342_10185951 Ga0265342_101859512 106
124 3300034818 Ga0373950_0000045 Ga0373950_0000045_61951_62271 106
125 3300035083 Ga0373926_0289068 Ga0373926_0289068_288_608 106
126 3300035111 Ga0373923_0614952 Ga0373923_0614952_163_483 106
127 3300035113 Ga0373936_0264945 Ga0373936_0264945_358_678 106
128 3300035117 Ga0373953_0388052 Ga0373953_0388052_76_396 106
129 3300035118 Ga0373954_0002640 Ga0373954_0002640_657_977 106
130 3300035118 Ga0373954_0111002 Ga0373954_0111002_583_903 106
131 3300035119 Ga0373956_0050560 Ga0373956_0050560_822_1142 106
132 3300035120 Ga0373957_0178038 Ga0373957_0178038_351_671 106
133 3300035172 Ga0373955_0004507 Ga0373955_0004507_3592_3912 106
134 3300035692 Ga0373935_0224436 Ga0373935_0224436_324_644 106
135 3300035724 Ga0373933_0000382 Ga0373933_0000382_3733_4053 106
136 3300035724 Ga0373933_0019125 Ga0373933_0019125_37_357 106
137 3300036401 Ga0373937_0003214 Ga0373937_0003214_9385_9705 106
138 3300036401 Ga0373937_0058361 Ga0373937_0058361_1110_1430 106
139 3300037068 Ga0373925_1071628 Ga0373925_1071628_55_375 106
140 3300037312 Ga0395899_0046520 Ga0395899_0046520_285_608 106
141 3300037418 Ga0395900_0078787 Ga0395900_0078787_1486_1809 106
142 3300037418 Ga0395900_0558378 Ga0395900_0558378_388_732 106
143 3300037466 Ga0395898_0026714 Ga0395898_0026714_1313_1636 106
144 3300037853 Ga0436364_0585700 Ga0436364_0585700_358_678 106
145 3300037853 Ga0436364_1152798 Ga0436364_1152798_111_431 106
146 3300038443 Ga0395901_0127211 Ga0395901_0127211_2029_2352 106
147 3300038996 Ga0242420_079651 Ga0242420_079651_146_466 106
148 3300039437 Ga0436365_0261465 Ga0436365_0261465_1368_1688 106
149 3300039438 Ga0436360_0541243 Ga0436360_0541243_236_556 106
150 3300039447 Ga0436361_0120850 Ga0436361_0120850_12802_13125 106
151 3300039447 Ga0436361_0125710 Ga0436361_0125710_296_616 106
152 3300039447 Ga0436361_0554441 Ga0436361_0554441_321_707 106
153 3300041507 Ga0451851_0548223 Ga0451851_0548223_39_359 106
154 3300044842 Ga0466957_0011360 Ga0466957_0011360_4561_4884 106
155 3300044901 Ga0466960_0207723 Ga0466960_0207723_122_442 106
156 3300045049 Ga0466959_0029847 Ga0466959_0029847_722_1042 106
157 3300045051 Ga0451576_0002519 Ga0451576_0002519_11721_12041 106
158 3300046457 Ga0495590_0127275 Ga0495590_0127275_428_748 106
159 3300046461 Ga0495641_0262417 Ga0495641_0262417_392_712 106
160 3300046461 Ga0495641_0443387 Ga0495641_0443387_41_361 106
161 3300046462 Ga0495651_0278629 Ga0495651_0278629_551_871 106
162 3300046476 Ga0495662_0194380 Ga0495662_0194380_187_507 106
163 3300046499 Ga0495594_0343948 Ga0495594_0343948_514_834 106
164 3300046543 Ga0495645_0829005 Ga0495645_0829005_192_512 106
165 3300046559 Ga0495667_0100738 Ga0495667_0100738_1042_1362 106
166 3300046642 Ga0495634_0588141 Ga0495634_0588141_106_426 106
167 3300046675 Ga0495657_0247854 Ga0495657_0247854_597_917 106
168 3300046690 Ga0495624_0639471 Ga0495624_0639471_167_487 106
169 3300047317 Ga0495604_0590805 Ga0495604_0590805_280_600 106
170 3300047322 Ga0495680_0056239 Ga0495680_0056239_49_369 106
171 3300047322 Ga0495680_0299690 Ga0495680_0299690_280_600 106
172 3300047322 Ga0495680_0868547 Ga0495680_0868547_11_331 106
173 3300048910 Ga0496107_0930193 Ga0496107_0930193_67_387 106
174 3300048917 Ga0496114_0152124 Ga0496114_0152124_711_1031 106
175 3300049571 Ga0501034_0000306 Ga0501034_0000306_26960_27280 106
176 3300049572 Ga0501036_0007224 Ga0501036_0007224_4214_4534 106
177 3300049572 Ga0501036_0086908 Ga0501036_0086908_1573_1893 106
178 3300049574 Ga0501038_0083437 Ga0501038_0083437_1590_1910 106
179 3300049579 Ga0501043_0002392 Ga0501043_0002392_9129_9449 106
180 3300049579 Ga0501043_0209220 Ga0501043_0209220_31_351 106
181 3300049579 Ga0501043_0701512 Ga0501043_0701512_202_522 106
182 3300049580 Ga0501046_0002309 Ga0501046_0002309_1400_1720 106
183 3300049581 Ga0501047_0000009 Ga0501047_0000009_119988_120308 106
184 3300049581 Ga0501047_0057675 Ga0501047_0057675_2597_2917 106
185 3300049582 Ga0501048_0004641 Ga0501048_0004641_2931_3251 106
186 3300049584 Ga0501068_0001628 Ga0501068_0001628_8949_9269 106
187 3300049584 Ga0501068_0078581 Ga0501068_0078581_20_340 106
188 3300049585 Ga0501069_0159040 Ga0501069_0159040_411_731 106
189 3300049585 Ga0501069_0201477 Ga0501069_0201477_560_880 106
190 3300049586 Ga0501070_0125883 Ga0501070_0125883_398_718 106
191 3300049586 Ga0501070_0364768 Ga0501070_0364768_158_478 106
192 3300049588 Ga0501072_0000022 Ga0501072_0000022_94212_94532 106
193 3300049589 Ga0501073_0005858 Ga0501073_0005858_5653_5973 106
194 3300049589 Ga0501073_0025467 Ga0501073_0025467_3674_3994 106
195 3300049590 Ga0501074_0000142 Ga0501074_0000142_16289_16609 106
196 3300049590 Ga0501074_0422427 Ga0501074_0422427_76_396 106
197 3300049741 Ga0501079_0001689 Ga0501079_0001689_9652_9972 106
198 3300049742 Ga0501080_0264807 Ga0501080_0264807_809_1129 106
199 3300049744 Ga0501083_0005104 Ga0501083_0005104_5936_6256 106
200 3300049744 Ga0501083_0020518 Ga0501083_0020518_944_1264 106
201 3300049744 Ga0501083_0397265 Ga0501083_0397265_137_457 106
202 3300049822 Ga0501035_1492554 Ga0501035_1492554_74_394 106
203 3300049823 Ga0501044_1424336 Ga0501044_1424336_183_503 106
204 3300050492 nmdc:mga0yw44_160220_c1 nmdc:mga0yw44_160220_c1_654_974 106
205 3300050493 nmdc:mga0k408_720684_c1 nmdc:mga0k408_720684_c1_253_573 106
206 3300050494 nmdc:mga06z11_347333_c1 nmdc:mga06z11_347333_c1_385_705 106
207 3300050495 nmdc:mga04h51_20105_c1 nmdc:mga04h51_20105_c1_1144_1464 106
208 3300050496 nmdc:mga07m45_86896_c1 nmdc:mga07m45_86896_c1_1014_1334 106
209 3300050507 nmdc:mga05p37_256841_c1 nmdc:mga05p37_256841_c1_118_438 106
210 3300050508 nmdc:mga09592_1104465_c1 nmdc:mga09592_1104465_c1_62_382 106
211 3300050512 nmdc:mga0n895_132731_c1 nmdc:mga0n895_132731_c1_1938_2258 106
212 3300050512 nmdc:mga0n895_1421891_c1 nmdc:mga0n895_1421891_c1_168_488 106
213 3300050512 nmdc:mga0n895_1678113_c1 nmdc:mga0n895_1678113_c1_202_522 106
214 3300050512 nmdc:mga0n895_1681325_c1 nmdc:mga0n895_1681325_c1_99_419 106
215 3300050512 nmdc:mga0n895_4828_c1 nmdc:mga0n895_4828_c1_10109_10429 106
216 3300050512 nmdc:mga0n895_77688_c1 nmdc:mga0n895_77688_c1_2378_2698 106
217 3300050513 nmdc:mga0rr50_38659_c1 nmdc:mga0rr50_38659_c1_619_939 106
218 3300050513 nmdc:mga0rr50_57452_c1 nmdc:mga0rr50_57452_c1_112_432 106
219 3300050513 nmdc:mga0rr50_94229_c1 nmdc:mga0rr50_94229_c1_522_842 106
220 3300050514 nmdc:mga08x19_1231623_c1 nmdc:mga08x19_1231623_c1_175_495 106
221 3300050514 nmdc:mga08x19_16994_c1 nmdc:mga08x19_16994_c1_2056_2376 106
222 3300050514 nmdc:mga08x19_423619_c1 nmdc:mga08x19_423619_c1_557_877 106
223 3300050514 nmdc:mga08x19_508430_c1 nmdc:mga08x19_508430_c1_14_334 106
224 3300050515 nmdc:mga0a205_152032_c1 nmdc:mga0a205_152032_c1_401_721 106
225 3300050515 nmdc:mga0a205_29873_c1 nmdc:mga0a205_29873_c1_1938_2258 106
226 3300053077 Ga0495601_0047786 Ga0495601_0047786_1996_2319 106
227 3300053077 Ga0495601_0147834 Ga0495601_0147834_540_860 106
228 3300053085 Ga0495619_0260742 Ga0495619_0260742_534_854 106
229 3300053133 Ga0500655_021670 Ga0500655_021670_243_563 106
230 3300053139 Ga0500568_0090339 Ga0500568_0090339_502_822 106
231 3300053177 Ga0500636_0062150 Ga0500636_0062150_45_365 106
232 3300054114 Ga0501084_0000006 Ga0501084_0000006_119988_120308 106
233 3300054114 Ga0501084_0071919 Ga0501084_0071919_25_345 106
234 3300060353 Ga0501082_0078471 Ga0501082_0078471_27_347 106
235 3300060353 Ga0501082_0082054 Ga0501082_0082054_1340_1660 106
236 3300060353 Ga0501082_0309675 Ga0501082_0309675_731_1051 106
237 3300005329 Ga0070683_100378033 Ga0070683_1003780332 107
238 3300005618 Ga0068864_102229554 Ga0068864_1022295542 107
239 3300005718 Ga0068866_10382962 Ga0068866_103829622 107
240 3300013105 Ga0157369_10699111 Ga0157369_106991112 107
241 3300013307 Ga0157372_10001703 Ga0157372_100017039 107
242 3300021384 Ga0213876_10057640 Ga0213876_100576403 107
243 3300025899 Ga0207642_11130341 Ga0207642_111303411 107
244 3300025944 Ga0207661_10284405 Ga0207661_102844052 107
245 3300028556 Ga0265337_1163152 Ga0265337_11631522 107
246 3300028563 Ga0265319_1002119 Ga0265319_10021196 107
247 3300028577 Ga0265318_10000789 Ga0265318_1000078918 107
248 3300028800 Ga0265338_10127546 Ga0265338_101275463 107
249 3300031235 Ga0265330_10000549 Ga0265330_100005493 107
250 3300031238 Ga0265332_10002164 Ga0265332_100021647 107
251 3300031239 Ga0265328_10001977 Ga0265328_100019775 107
252 3300031240 Ga0265320_10004029 Ga0265320_100040297 107
253 3300031240 Ga0265320_10085755 Ga0265320_100857552 107
254 3300031242 Ga0265329_10004468 Ga0265329_100044687 107
255 3300031247 Ga0265340_10010877 Ga0265340_100108772 107
256 3300031249 Ga0265339_10009032 Ga0265339_100090325 107
257 3300031250 Ga0265331_10007955 Ga0265331_100079552 107
258 3300031344 Ga0265316_10004965 Ga0265316_100049657 107
259 3300031595 Ga0265313_10000147 Ga0265313_1000014758 107
260 3300031711 Ga0265314_10002182 Ga0265314_1000218222 107
261 3300031712 Ga0265342_10000524 Ga0265342_1000052418 107
262 3300035172 Ga0373955_0302421 Ga0373955_0302421_274_609 107
263 3300035692 Ga0373935_0194009 Ga0373935_0194009_385_720 107
264 3300035695 Ga0373927_0017440 Ga0373927_0017440_3467_3802 107
265 3300035724 Ga0373933_0905139 Ga0373933_0905139_52_387 107
266 3300037068 Ga0373925_0064233 Ga0373925_0064233_2271_2606 107
267 3300039437 Ga0436365_0047339 Ga0436365_0047339_748_1071 107
268 3300039450 Ga0436363_0041486 Ga0436363_0041486_34_360 107
269 3300041463 Ga0451804_0687014 Ga0451804_0687014_44_367 107
270 3300049571 Ga0501034_0313088 Ga0501034_0313088_44_367 107
271 3300049589 Ga0501073_0015700 Ga0501073_0015700_4207_4530 107
272 3300005564 Ga0070664_100712228 Ga0070664_1007122282 108
273 3300005983 Ga0081540_1001701 Ga0081540_10017014 108
274 3300006237 Ga0097621_100084463 Ga0097621_1000844631 108
275 3300013100 Ga0157373_11091279 Ga0157373_110912792 108
276 3300025945 Ga0207679_11394485 Ga0207679_113944852 108
277 3300031241 Ga0265325_10459623 Ga0265325_104596232 108
278 3300031711 Ga0265314_10381285 Ga0265314_103812851 108
279 3300035088 Ga0373940_0002902 Ga0373940_0002902_1219_1545 108
280 3300035089 Ga0373944_0128704 Ga0373944_0128704_312_638 108
281 3300035207 Ga0373942_0102266 Ga0373942_0102266_321_647 108
282 3300035695 Ga0373927_0405292 Ga0373927_0405292_520_846 108
283 3300035725 Ga0373947_0484683 Ga0373947_0484683_139_465 108
284 3300036401 Ga0373937_1033137 Ga0373937_1033137_152_478 108
285 3300037068 Ga0373925_0791265 Ga0373925_0791265_51_377 108
286 3300042008 Ga0439450_090028 Ga0439450_090028_394_720 108
287 3300042157 Ga0439458_0176955 Ga0439458_0176955_133_459 108
288 3300045051 Ga0451576_0425517 Ga0451576_0425517_754_1080 108
289 3300046683 Ga0495658_0042519 Ga0495658_0042519_30_356 108
290 3300053088 Ga0500644_0399860 Ga0500644_0399860_256_588 108
291 3300053103 Ga0500555_121689 Ga0500555_121689_172_504 108
292 2162886012 MBSR1b_contig_780787 MBSR1b_0446.00001520 109
293 3300002076 JGI24749J21850_1003664 JGI24749J21850_10036643 109
294 3300002459 JGI24751J29686_10003963 JGI24751J29686_100039634 109
295 3300005293 Ga0065715_10714337 Ga0065715_107143371 109
296 3300005327 Ga0070658_10000267 Ga0070658_1000026726 109
297 3300005328 Ga0070676_10000455 Ga0070676_1000045520 109
298 3300005329 Ga0070683_100002672 Ga0070683_1000026723 109
299 3300005330 Ga0070690_100000292 Ga0070690_10000029212 109
300 3300005331 Ga0070670_100002161 Ga0070670_10000216116 109
301 3300005333 Ga0070677_10000659 Ga0070677_100006593 109
302 3300005334 Ga0068869_100000149 Ga0068869_10000014934 109
303 3300005335 Ga0070666_10005115 Ga0070666_100051156 109
304 3300005336 Ga0070680_100032483 Ga0070680_1000324832 109
305 3300005337 Ga0070682_100024779 Ga0070682_1000247794 109
306 3300005338 Ga0068868_100000367 Ga0068868_10000036722 109
307 3300005339 Ga0070660_100000058 Ga0070660_10000005850 109
308 3300005340 Ga0070689_100000151 Ga0070689_10000015115 109
309 3300005341 Ga0070691_10106097 Ga0070691_101060971 109
310 3300005343 Ga0070687_100000029 Ga0070687_10000002938 109
311 3300005344 Ga0070661_100000959 Ga0070661_10000095917 109
312 3300005345 Ga0070692_10000821 Ga0070692_1000082110 109
313 3300005347 Ga0070668_100000494 Ga0070668_1000004943 109
314 3300005353 Ga0070669_100000134 Ga0070669_10000013432 109
315 3300005354 Ga0070675_100017729 Ga0070675_1000177295 109
316 3300005355 Ga0070671_100000228 Ga0070671_10000022822 109
317 3300005356 Ga0070674_100003322 Ga0070674_1000033225 109
318 3300005364 Ga0070673_100006101 Ga0070673_1000061015 109
319 3300005365 Ga0070688_100000073 Ga0070688_10000007332 109
320 3300005366 Ga0070659_100034689 Ga0070659_1000346892 109
321 3300005367 Ga0070667_100000935 Ga0070667_10000093517 109
322 3300005438 Ga0070701_10001016 Ga0070701_100010165 109
323 3300005439 Ga0070711_100090769 Ga0070711_1000907692 109
324 3300005440 Ga0070705_100000689 Ga0070705_10000068920 109
325 3300005441 Ga0070700_100003721 Ga0070700_1000037213 109
326 3300005455 Ga0070663_100000498 Ga0070663_1000004983 109
327 3300005456 Ga0070678_100013401 Ga0070678_1000134012 109
328 3300005457 Ga0070662_100000386 Ga0070662_1000003867 109
329 3300005459 Ga0068867_100000197 Ga0068867_10000019719 109
330 3300005466 Ga0070685_10000121 Ga0070685_1000012132 109
331 3300005535 Ga0070684_100033909 Ga0070684_1000339093 109
332 3300005539 Ga0068853_100000228 Ga0068853_10000022823 109
333 3300005543 Ga0070672_100000078 Ga0070672_10000007837 109
334 3300005544 Ga0070686_100000139 Ga0070686_10000013923 109
335 3300005545 Ga0070695_100006206 Ga0070695_1000062066 109
336 3300005547 Ga0070693_100007457 Ga0070693_1000074575 109
337 3300005548 Ga0070665_100031779 Ga0070665_1000317796 109
338 3300005549 Ga0070704_100010095 Ga0070704_1000100953 109
339 3300005563 Ga0068855_100000217 Ga0068855_10000021754 109
340 3300005564 Ga0070664_100001075 Ga0070664_10000107518 109
341 3300005577 Ga0068857_100003562 Ga0068857_10000356210 109
342 3300005578 Ga0068854_100000661 Ga0068854_10000066117 109
343 3300005614 Ga0068856_100005364 Ga0068856_1000053643 109
344 3300005615 Ga0070702_100031630 Ga0070702_1000316303 109
345 3300005616 Ga0068852_100000081 Ga0068852_10000008150 109
346 3300005617 Ga0068859_100003422 Ga0068859_10000342216 109
347 3300005618 Ga0068864_100002038 Ga0068864_10000203817 109
348 3300005718 Ga0068866_10000231 Ga0068866_1000023110 109
349 3300005719 Ga0068861_100000119 Ga0068861_10000011920 109
350 3300005834 Ga0068851_10000089 Ga0068851_1000008936 109
351 3300005840 Ga0068870_10000022 Ga0068870_1000002216 109
352 3300005841 Ga0068863_100000598 Ga0068863_1000005989 109
353 3300005842 Ga0068858_100003407 Ga0068858_10000340716 109
354 3300005843 Ga0068860_100001206 Ga0068860_1000012065 109
355 3300005844 Ga0068862_100000893 Ga0068862_10000089312 109
356 3300006173 Ga0070716_101249767 Ga0070716_1012497672 109
357 3300006237 Ga0097621_100000364 Ga0097621_10000036418 109
358 3300006358 Ga0068871_100001311 Ga0068871_1000013114 109
359 3300006871 Ga0075434_101383310 Ga0075434_1013833101 109
360 3300006881 Ga0068865_100000257 Ga0068865_1000002575 109
361 3300006931 Ga0097620_100003422 Ga0097620_10000342216 109
362 3300009092 Ga0105250_10263505 Ga0105250_102635052 109
363 3300009093 Ga0105240_10001539 Ga0105240_1000153922 109
364 3300009098 Ga0105245_10000654 Ga0105245_1000065410 109
365 3300009101 Ga0105247_10002206 Ga0105247_1000220612 109
366 3300009148 Ga0105243_10038421 Ga0105243_100384214 109
367 3300009174 Ga0105241_10000131 Ga0105241_1000013126 109
368 3300009177 Ga0105248_10039085 Ga0105248_100390852 109
369 3300009545 Ga0105237_10000612 Ga0105237_1000061232 109
370 3300009551 Ga0105238_10000291 Ga0105238_1000029111 109
371 3300009553 Ga0105249_10000315 Ga0105249_1000031515 109
372 3300010375 Ga0105239_10000109 Ga0105239_1000010950 109
373 3300011119 Ga0105246_10002083 Ga0105246_100020835 109
374 3300013102 Ga0157371_10000699 Ga0157371_1000069933 109
375 3300013105 Ga0157369_10113947 Ga0157369_101139473 109
376 3300013296 Ga0157374_10000551 Ga0157374_1000055115 109
377 3300013297 Ga0157378_10005511 Ga0157378_100055118 109
378 3300013306 Ga0163162_10000262 Ga0163162_1000026231 109
379 3300013307 Ga0157372_10002253 Ga0157372_100022533 109
380 3300013308 Ga0157375_10018741 Ga0157375_100187413 109
381 3300014325 Ga0163163_10078207 Ga0163163_100782073 109
382 3300014326 Ga0157380_10351596 Ga0157380_103515962 109
383 3300014745 Ga0157377_10000402 Ga0157377_100004023 109
384 3300014968 Ga0157379_10000031 Ga0157379_1000003137 109
385 3300014969 Ga0157376_10000289 Ga0157376_1000028918 109
386 3300014969 Ga0157376_10046175 Ga0157376_100461754 109
387 3300025315 Ga0207697_10000035 Ga0207697_1000003524 109
388 3300025321 Ga0207656_10005954 Ga0207656_100059543 109
389 3300025893 Ga0207682_10000027 Ga0207682_100000275 109
390 3300025899 Ga0207642_10005152 Ga0207642_100051523 109
391 3300025900 Ga0207710_10001160 Ga0207710_1000116012 109
392 3300025901 Ga0207688_10000069 Ga0207688_100000695 109
393 3300025903 Ga0207680_10000061 Ga0207680_1000006127 109
394 3300025904 Ga0207647_10004258 Ga0207647_100042584 109
395 3300025907 Ga0207645_10000004 Ga0207645_1000000475 109
396 3300025908 Ga0207643_10000015 Ga0207643_1000001535 109
397 3300025909 Ga0207705_10002373 Ga0207705_100023734 109
398 3300025911 Ga0207654_10003832 Ga0207654_100038325 109
399 3300025913 Ga0207695_10027571 Ga0207695_100275712 109
400 3300025914 Ga0207671_10006955 Ga0207671_100069554 109
401 3300025917 Ga0207660_10022025 Ga0207660_100220252 109
402 3300025918 Ga0207662_10000035 Ga0207662_1000003514 109
403 3300025919 Ga0207657_10000032 Ga0207657_1000003246 109
404 3300025920 Ga0207649_10000317 Ga0207649_100003178 109
405 3300025923 Ga0207681_10000091 Ga0207681_1000009146 109
406 3300025924 Ga0207694_10000541 Ga0207694_1000054126 109
407 3300025925 Ga0207650_10000113 Ga0207650_1000011374 109
408 3300025926 Ga0207659_10000026 Ga0207659_1000002664 109
409 3300025927 Ga0207687_10000953 Ga0207687_100009534 109
410 3300025931 Ga0207644_10000229 Ga0207644_1000022925 109
411 3300025932 Ga0207690_10001164 Ga0207690_1000116411 109
412 3300025933 Ga0207706_10000021 Ga0207706_1000002195 109
413 3300025935 Ga0207709_10081358 Ga0207709_100813581 109
414 3300025936 Ga0207670_10000055 Ga0207670_1000005550 109
415 3300025937 Ga0207669_10000108 Ga0207669_1000010825 109
416 3300025938 Ga0207704_10000122 Ga0207704_1000012216 109
417 3300025940 Ga0207691_10000008 Ga0207691_1000000889 109
418 3300025941 Ga0207711_10000037 Ga0207711_1000003764 109
419 3300025942 Ga0207689_10000001 Ga0207689_10000001185 109
420 3300025944 Ga0207661_10001929 Ga0207661_100019293 109
421 3300025945 Ga0207679_10000076 Ga0207679_1000007650 109
422 3300025949 Ga0207667_10000897 Ga0207667_1000089716 109
423 3300025960 Ga0207651_10000022 Ga0207651_1000002225 109
424 3300025961 Ga0207712_10000166 Ga0207712_1000016615 109
425 3300025972 Ga0207668_10000320 Ga0207668_1000032025 109
426 3300025981 Ga0207640_10000123 Ga0207640_1000012333 109
427 3300025986 Ga0207658_10000234 Ga0207658_100002348 109
428 3300026023 Ga0207677_10000031 Ga0207677_1000003170 109
429 3300026035 Ga0207703_10000068 Ga0207703_1000006846 109
430 3300026041 Ga0207639_10008421 Ga0207639_100084214 109
431 3300026067 Ga0207678_10000639 Ga0207678_1000063927 109
432 3300026075 Ga0207708_10016736 Ga0207708_100167363 109
433 3300026078 Ga0207702_10007670 Ga0207702_100076708 109
434 3300026088 Ga0207641_10000324 Ga0207641_1000032438 109
435 3300026089 Ga0207648_10000004 Ga0207648_10000004184 109
436 3300026095 Ga0207676_10000122 Ga0207676_1000012217 109
437 3300026116 Ga0207674_10000088 Ga0207674_1000008811 109
438 3300026118 Ga0207675_100000003 Ga0207675_10000000384 109
439 3300026121 Ga0207683_10000054 Ga0207683_1000005433 109
440 3300026142 Ga0207698_10010068 Ga0207698_100100685 109
441 3300028379 Ga0268266_10000172 Ga0268266_1000017246 109
442 3300028380 Ga0268265_10000076 Ga0268265_1000007675 109
443 3300028381 Ga0268264_10000203 Ga0268264_1000020333 109
444 3300048903 Ga0496100_1079638 Ga0496100_1079638_100_429 109
445 3300048904 Ga0496101_0414046 Ga0496101_0414046_494_823 109
446 3300048905 Ga0496102_0002715 Ga0496102_0002715_12052_12381 109
447 3300048906 Ga0496103_0014431 Ga0496103_0014431_3647_3976 109
448 3300048907 Ga0496104_0958386 Ga0496104_0958386_274_603 109
449 3300048909 Ga0496106_0008714 Ga0496106_0008714_5366_5695 109
450 3300048910 Ga0496107_0039419 Ga0496107_0039419_2270_2599 109
451 3300048911 Ga0496108_0024906 Ga0496108_0024906_4039_4368 109
452 3300048912 Ga0496109_0064405 Ga0496109_0064405_705_1034 109
453 3300048913 Ga0496110_0293328 Ga0496110_0293328_359_688 109
454 3300048915 Ga0496112_0000099 Ga0496112_0000099_24549_24878 109
455 3300048916 Ga0496113_0268479 Ga0496113_0268479_1014_1343 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

16

63

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

16

62

0.97

PF12840

HTH_20

Helix-turn-helix domain

14

64

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9396 4 88
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9276 22 73
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9269 4 80
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9264 19 74
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.922 6 105
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9796 18 73 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9707 16 72 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9504 27 73 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9447 12 73 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9405 5 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2T7N934-F1-model_v4 Transcriptional regulator 0.9924 6 90 GO:0003700
AF-A0A3Q9B8T7-F1-model_v4 deleted 0.985 6 88
AF-A0A7V8YLT6-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9838 4 90 GO:0003700
AF-A0A499V473-F1-model_v4 HTH arsR-type domain-containing protein 0.9838 6 81 GO:0003700
AF-A0A1C6B492-F1-model_v4 HTH-type transcriptional repressor AseR 0.9832 7 89 GO:0003700

Feature Viewer

pLDDT pTM Quality
91.99 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map