F447391

General Info

Members Datasets Scaffolds Average Seq Length
454 371 908 365

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10000210|Ga0163161_1000021017
Length 423
Sequence MKPGSRIAPSPPGGGLGWGHAAYPLPAARSALLAPIPAFPQRGKEQSPAHSKKTNNMSAISCHNIIKRYGETQVVHAFDLDVADNEFVVFLGPSGCGKSTILRMLAGLEDISGGDLHIGGRRVNNLPPQERGIAMVFQNYALYPHMTVRDNIAFGLKRLKVPRAEIDSRIKEVSDTLGLERYLQRKPAELSGGQQQRVAIARAMIKTPKVFLFDEPLSNLDAKLRNHMRIEIAKLHQTLKTTTVYVTHDQHEAMTLADRIVLLRDGRIEQVGSPKEIFERPRSAFVAGFIGTPPMNLVEMSVKDEGSHFELRGRGGVVHVNARRFALEGRERVTLGIRPAHLQVDTNSGRDGGFSGEVQLVEYLGNEVLVSFGGDDNEISALVPSAQSPRLHERVSFVADPEQVHLFDIDTGASLRVDRAPLH

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
84 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
85 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
86 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
87 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
100 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
160 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
168 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
169 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
176 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
177 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
178 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
184 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
185 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
186 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
187 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
188 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
189 2512875024
190 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
191 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
192 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
193 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
194 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
195 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
196 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
197 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
198 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
199 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
200 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
201 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
202 2643221557 Ensifer sp. Root558 Isolate Unclassified
203 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
204 2643221609 Acidovorax sp. Root217 Isolate Unclassified
205 2643221610 Ensifer sp. Root74 Isolate Unclassified
206 2643221611 Acidovorax sp. Root219 Isolate Unclassified
207 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
208 2643221668 Ensifer sp. Root423 Isolate Unclassified
209 2643221675 Ensifer sp. Root1298 Isolate Unclassified
210 2643221680 Ensifer sp. Root1312 Isolate Unclassified
211 2643221723 Ensifer sp. Root278 Isolate Unclassified
212 2643221726 Ensifer sp. Root954 Isolate Unclassified
213 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
214 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
215 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
216 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
217 2738543012 Acidovorax sp. CF301 Isolate Unclassified
218 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
219 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
220 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
221 2791355256 Rhizobium sp. M10 Isolate Nodule
222 2791355262 Rhizobium sp. M1 Isolate Nodule
223 2816332133 Acidovorax radicis 2721A Isolate Unclassified
224 2818991446 Variovorax sp. 1180 Isolate Unclassified
225 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
226 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
227 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
228 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
229 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
230 2842677519 Variovorax sp. R-72495 Isolate Unclassified
231 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
232 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
233 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
234 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
235 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
236 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
237 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
238 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
239 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
240 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
241 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
242 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
243 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
244 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
245 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
246 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
247 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
248 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
249 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
250 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
251 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
252 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
253 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
254 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
255 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
256 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
257 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
258 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
259 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
260 2885198086 Variovorax sp. 679 Isolate Unclassified
261 2885211737 Variovorax sp. 553 Isolate Unclassified
262 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
263 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
264 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
265 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
266 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
267 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
268 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
269 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
270 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
271 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
272 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
273 2899924645 Variovorax sp. 369 Isolate Unclassified
274 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
275 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
276 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
277 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
278 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
279 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
280 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
281 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
282 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
283 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
284 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
285 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
286 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
287 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
288 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
289 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
290 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
291 2928037797 Variovorax sp. 1126 Isolate Unclassified
292 2928044640 Variovorax sp. 1128 Isolate Unclassified
293 2928051484 Variovorax sp. 1133 Isolate Unclassified
294 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
295 2928070936 Variovorax gossypii 1167 Isolate Unclassified
296 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
297 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
298 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
299 2936381700 Rhizobium chutanense C16 Isolate Unclassified
300 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
301 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
302 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
303 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
304 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
305 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
306 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
307 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
308 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
309 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
310 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
311 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
312 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
313 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
314 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
315 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
316 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
317 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
318 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
319 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
320 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
321 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
322 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
323 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
324 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
325 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
326 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
327 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
328 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
329 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
330 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
331 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
332 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
333 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
334 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
335 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
336 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
337 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
338 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
339 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
340 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
341 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
342 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
343 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
344 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
345 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
346 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
347 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
348 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
349 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
350 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
351 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
352 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
353 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
354 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
355 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
356 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
357 2996893221 Rhizobium sp. R635 Isolate Nodule
358 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
359 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
360 3004167301 Mesorhizobium loti 582 Isolate Unclassified
361 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
362 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
363 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
364 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
365 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
366 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
367 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
368 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
369 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
370 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
371 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.05
Metatranscriptomes 0
Isolates 42.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.55
Nodule 25.99
Rhizoplane 1.98
Rhizosphere 30.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10000210 3300017792 Bacteria 53340
2 JGI24740J21852_10029322 3300001979 Bacteria 1807
3 JGI24740J21852_10029472 3300001979 Bacteria 1802
4 JGI24740J21852_10045154 3300001979 Bacteria 1302
5 JGI25152J39213_1003267 3300002773 Bacteria 5611
6 JGI25159J45721_1000030 3300002987 Bacteria 102429
7 JGI25151J46595_10006535 3300003187 Bacteria 5844
8 JGI25151J46595_10041770 3300003187 Bacteria 1661
9 JGI25165J46597_1000386 3300003214 Bacteria 47494
10 JGI25153J46596_10000067 3300003215 Bacteria 118869
11 JGI25153J46596_10008381 3300003215 Bacteria 4946
12 JGI25160J50197_1000075 3300003354 Bacteria 102429
13 JGI25161J50226_1000225 3300003374 Bacteria 34725
14 Ga0055542_1000052 3300003762 Bacteria 173583
15 Ga0055542_1000325 3300003762 Bacteria 50660
16 Ga0055526_1002641 3300003771 Bacteria 11971
17 Ga0055526_1013380 3300003771 Bacteria 3477
18 Ga0055537_1005328 3300003773 Bacteria 3472
19 Ga0055524_1000960 3300003775 Bacteria 18186
20 Ga0055536_1001366 3300003781 Bacteria 14839
21 Ga0055536_1001858 3300003781 Bacteria 12328
22 Ga0055528_1000219 3300003790 Bacteria 48163
23 Ga0055528_1011656 3300003790 Bacteria 3472
24 Ga0055530_10001570 3300003791 Bacteria 16363
25 Ga0055540_1018288 3300003792 Bacteria 1923
26 Ga0055540_1024691 3300003792 Bacteria 1486
27 Ga0055543_1000168 3300004625 Bacteria 54974
28 Ga0055543_1002602 3300004625 Bacteria 5836
29 Ga0065165_1000206 3300005262 Bacteria 102467
30 Ga0065165_1001023 3300005262 Bacteria 33959
31 Ga0065165_1002306 3300005262 Bacteria 16715
32 Ga0070682_100078437 3300005337 Bacteria 2130
33 Ga0068868_100006611 3300005338 Bacteria 8219
34 Ga0070660_100031524 3300005339 Bacteria 3982
35 Ga0070692_10100391 3300005345 Bacteria 1585
36 Ga0070694_100048865 3300005444 Bacteria 2847
37 Ga0068867_100035248 3300005459 Bacteria 3628
38 Ga0070685_10105682 3300005466 Bacteria 1726
39 Ga0070698_100042516 3300005471 Bacteria 4662
40 Ga0068853_100123636 3300005539 Bacteria 2310
41 Ga0068853_100261083 3300005539 Bacteria 1592
42 Ga0068855_100223096 3300005563 Bacteria 2112
43 Ga0068854_100041778 3300005578 Bacteria 3241
44 Ga0068862_100015769 3300005844 Bacteria 6279
45 Ga0081538_10011280 3300005981 Bacteria 7250
46 Ga0075364_10054307 3300006051 Bacteria 2620
47 Ga0075364_10149830 3300006051 Bacteria 1572
48 Ga0075367_10013864 3300006178 Bacteria 4348
49 Ga0075367_10025035 3300006178 Bacteria 3371
50 Ga0075433_10034877 3300006852 Bacteria 4324
51 Ga0075429_100049508 3300006880 Bacteria 3654
52 Ga0111539_10000255 3300009094 Bacteria 63936
53 Ga0105243_10000273 3300009148 Bacteria 57562
54 Ga0105241_10390460 3300009174 Bacteria 1218
55 Ga0105237_10016689 3300009545 Bacteria 7623
56 Ga0105238_10005082 3300009551 Bacteria 13006
57 Ga0105239_10140680 3300010375 Bacteria 2689
58 Ga0157371_10119827 3300013102 Bacteria 1871
59 Ga0157370_10005581 3300013104 Bacteria 14091
60 Ga0171463_1002 3300013249 Bacteria 1274851
61 Ga0163162_10079791 3300013306 Bacteria 3339
62 Ga0163163_10156543 3300014325 Bacteria 2323
63 Ga0183363_1258 3300015690 Bacteria 8754
64 Ga0213872_10024493 3300021361 Bacteria 2776
65 Ga0209436_100338 3300025208 Bacteria 21276
66 Ga0209436_104955 3300025208 Bacteria 3184
67 Ga0209147_101139 3300025229 Bacteria 10922
68 Ga0209258_100009 3300025242 Bacteria 996276
69 Ga0207425_1000189 3300025245 Bacteria 50055
70 Ga0209148_1000007 3300025254 Bacteria 1592273
71 Ga0209148_1000136 3300025254 Bacteria 169088
72 Ga0209759_1000350 3300025256 Bacteria 60056
73 Ga0209129_1000083 3300025258 Bacteria 183270
74 Ga0209233_1000306 3300025261 Bacteria 58173
75 Ga0209565_1000424 3300025263 Bacteria 34091
76 Ga0209565_1002701 3300025263 Bacteria 6191
77 Ga0209455_1000085 3300025272 Bacteria 247601
78 Ga0209673_1000054 3300025273 Bacteria 279116
79 Ga0209673_1000089 3300025273 Bacteria 202240
80 Ga0209673_1001010 3300025273 Bacteria 34091
81 Ga0209130_1000154 3300025284 Bacteria 102645
82 Ga0209130_1000463 3300025284 Bacteria 42235
83 Ga0209130_1000653 3300025284 Bacteria 31846
84 Ga0209675_1000422 3300025291 Bacteria 34124
85 Ga0209675_1000534 3300025291 Bacteria 27862
86 Ga0209675_1001947 3300025291 Bacteria 11148
87 Ga0209676_1000004 3300025292 Bacteria 1138360
88 Ga0209676_1000269 3300025292 Bacteria 108375
89 Ga0209676_1000293 3300025292 Bacteria 101210
90 Ga0209676_1001353 3300025292 Bacteria 24341
91 Ga0209676_1002491 3300025292 Bacteria 12918
92 Ga0209025_1000032 3300025294 Bacteria 416141
93 Ga0209025_1000133 3300025294 Bacteria 195885
94 Ga0209025_1000692 3300025294 Bacteria 57604
95 Ga0209025_1002147 3300025294 Bacteria 22059
96 Ga0209025_1026864 3300025294 Bacteria 2874
97 Ga0209564_1000025 3300025295 Bacteria 520535
98 Ga0209564_1000323 3300025295 Bacteria 93122
99 Ga0209564_1000332 3300025295 Bacteria 91674
100 Ga0209564_1006866 3300025295 Bacteria 6005
101 Ga0209758_1000132 3300025297 Bacteria 183273
102 Ga0209758_1000284 3300025297 Bacteria 100315
103 Ga0209758_1005290 3300025297 Bacteria 10083
104 Ga0209050_1000002 3300025298 Bacteria 1792849
105 Ga0209256_1000073 3300025299 Bacteria 237553
106 Ga0209256_1000375 3300025299 Bacteria 71601
107 Ga0209256_1000385 3300025299 Bacteria 70163
108 Ga0209256_1000907 3300025299 Bacteria 36321
109 Ga0209256_1008531 3300025299 Bacteria 4727
110 Ga0207426_1000286 3300025302 Bacteria 102853
111 Ga0207426_1000323 3300025302 Bacteria 91662
112 Ga0207426_1000517 3300025302 Bacteria 56285
113 Ga0209051_1000002 3300025303 Bacteria 1631846
114 Ga0209051_1000130 3300025303 Bacteria 141656
115 Ga0209051_1002181 3300025303 Bacteria 14496
116 Ga0209051_1008232 3300025303 Bacteria 5554
117 Ga0209051_1027573 3300025303 Bacteria 2260
118 Ga0209257_1000002 3300025304 Bacteria 1767052
119 Ga0209257_1011414 3300025304 Bacteria 4280
120 Ga0209257_1017249 3300025304 Bacteria 2857
121 Ga0207705_10075043 3300025909 Bacteria 2455
122 Ga0207695_10299960 3300025913 Bacteria 1498
123 Ga0207671_10012570 3300025914 Bacteria 6798
124 Ga0207694_10008431 3300025924 Bacteria 7779
125 Ga0207709_10000435 3300025935 Bacteria 39552
126 Ga0207709_10077838 3300025935 Bacteria 2127
127 Ga0207667_10351264 3300025949 Bacteria 1504
128 Ga0207639_10041108 3300026041 Bacteria 3457
129 Ga0207702_10379094 3300026078 Bacteria 1360
130 Ga0207698_10180694 3300026142 Bacteria 1869
131 Ga0207428_10008302 3300027907 Bacteria 9386
132 Ga0268265_10045400 3300028380 Bacteria 3278
133 Ga0314311_1059424 3300030733 Bacteria 12684
134 Ga0316178_1155164 3300030735 Bacteria 4417
135 Ga0316180_1073528 3300030736 Bacteria 3973
136 Ga0316183_1022889 3300030742 Bacteria 4277
137 Ga0316182_1179756 3300030745 Bacteria 8830
138 Ga0307513_10094091 3300031456 Bacteria 3043
139 Ga0307509_10047734 3300031507 Bacteria 4604
140 Ga0307508_10000141 3300031616 Bacteria 85739
141 Ga0307406_10034804 3300031901 Bacteria 3093
142 Ga0307412_10017809 3300031911 Bacteria 4258
143 Ga0307416_100279373 3300032002 Bacteria 1645
144 Ga0373949_0000165 3300035090 Bacteria 25128
145 Ga0373937_0088749 3300036401 Bacteria 2863
146 Ga0395905_0004486 3300037471 Bacteria 14482
147 Ga0395905_0017799 3300037471 Bacteria 6750
148 Ga0395901_0115089 3300038443 Bacteria 2825
149 Ga0395901_0152023 3300038443 Bacteria 2432
150 Ga0436361_0691237 3300039447 Bacteria 8011
151 Ga0450920_001097 3300042122 Bacteria 4418
152 Ga0450918_000028 3300042531 Bacteria 30240
153 Ga0466972_0056996 3300044658 Bacteria 1877
154 Ga0453683_0001704 3300044673 Bacteria 18282
155 Ga0466965_0016446 3300044683 Bacteria 3521
156 Ga0466961_0009090 3300044693 Bacteria 6332
157 Ga0466971_0027646 3300044719 Bacteria 2541
158 Ga0451576_0005405 3300045051 Bacteria 16037
159 Ga0466958_0017949 3300045836 Bacteria 4100
160 Ga0466967_0016087 3300045976 Bacteria 5886
161 Ga0495627_003596 3300046453 Bacteria 6757
162 Ga0495638_0077019 3300046460 Bacteria 2031
163 Ga0495638_0143566 3300046460 Bacteria 1390
164 Ga0495610_0001005 3300046512 Bacteria 26004
165 Ga0495616_0000899 3300046513 Bacteria 21469
166 Ga0495631_0000744 3300046518 Bacteria 20929
167 Ga0495637_0001189 3300046520 Bacteria 15841
168 Ga0495637_0020004 3300046520 Bacteria 3084
169 Ga0495654_0044425 3300046530 Bacteria 2198
170 Ga0495668_0052406 3300046616 Bacteria 2258
171 Ga0495625_0105545 3300046660 Bacteria 1930
172 Ga0495625_0131524 3300046660 Bacteria 1695
173 Ga0495625_0164493 3300046660 Bacteria 1484
174 Ga0495588_0016936 3300046674 Bacteria 3531
175 Ga0495658_0031398 3300046683 Bacteria 2893
176 Ga0495670_0041363 3300046691 Bacteria 2299
177 Ga0495671_0003348 3300046692 Bacteria 9888
178 Ga0495686_0001765 3300047472 Bacteria 22120
179 Ga0495593_0010853 3300047673 Bacteria 5252
180 Ga0495602_0067709 3300048088 Bacteria 3070
181 Ga0495614_0009485 3300048089 Bacteria 4303
182 Ga0496102_0098236 3300048905 Bacteria 2717
183 Ga0496103_0152795 3300048906 Bacteria 1479
184 Ga0496108_0016093 3300048911 Bacteria 6097
185 Ga0496116_0105996 3300048919 Bacteria 1666
186 Ga0496117_0001262 3300048920 Bacteria 37592
187 Ga0496117_0020710 3300048920 Bacteria 5353
188 Ga0496118_0003663 3300048921 Bacteria 19078
189 Ga0496120_0001375 3300048923 Bacteria 29703
190 Ga0496121_0062930 3300048924 Bacteria 3036
191 Ga0496121_0119898 3300048924 Bacteria 1988
192 Ga0496121_0245342 3300048924 Bacteria 1245
193 Ga0496122_0080347 3300048925 Bacteria 2274
194 Ga0496123_0000018 3300048926 Bacteria 404553
195 Ga0496123_0000105 3300048926 Bacteria 167806
196 Ga0496124_0003217 3300048927 Bacteria 20178
197 Ga0496125_0000575 3300048928 Bacteria 62850
198 Ga0496125_0011264 3300048928 Bacteria 8963
199 Ga0496125_0081079 3300048928 Bacteria 2481
200 Ga0496126_0001062 3300048929 Bacteria 46308
201 Ga0496126_0019191 3300048929 Bacteria 6739
202 Ga0495678_016432 3300049459 Bacteria 3385
203 Ga0501032_0034775 3300049569 Bacteria 3447
204 Ga0501034_0000945 3300049571 Bacteria 42097
205 Ga0501036_0147954 3300049572 Bacteria 1981
206 Ga0501037_0296003 3300049573 Bacteria 1125
207 Ga0501038_0043154 3300049574 Bacteria 3923
208 Ga0501043_0016998 3300049579 Bacteria 5703
209 Ga0501043_0033887 3300049579 Bacteria 4018
210 Ga0501047_0007237 3300049581 Bacteria 10431
211 Ga0501047_0044081 3300049581 Bacteria 4308
212 Ga0501073_0008591 3300049589 Bacteria 7569
213 Ga0501073_0063552 3300049589 Bacteria 2575
214 Ga0501073_0120173 3300049589 Bacteria 1821
215 Ga0501077_0035540 3300049593 Bacteria 3172
216 Ga0501080_0051918 3300049742 Bacteria 3816
217 Ga0501080_0059089 3300049742 Bacteria 3569
218 Ga0501083_0111506 3300049744 Bacteria 1798
219 Ga0501035_0038045 3300049822 Bacteria 4356
220 Ga0501035_0165182 3300049822 Bacteria 1915
221 Ga0501044_0006491 3300049823 Bacteria 12920
222 Ga0501044_0271308 3300049823 Bacteria 1632
223 nmdc:mga0yw44_28323_c1 3300050492 Bacteria 3221
224 nmdc:mga0yw44_88467_c1 3300050492 Bacteria 1953
225 nmdc:mga06z11_18213_c1 3300050494 Bacteria 3203
226 nmdc:mga06z11_42245_c1 3300050494 Bacteria 2286
227 nmdc:mga09592_9613_c1 3300050508 Bacteria 7855
228 nmdc:mga06r32_244883_c1 3300050510 Bacteria 1780
229 nmdc:mga08y16_3779_c1 3300050511 Bacteria 15769
230 nmdc:mga0a205_42874_c1 3300050515 Bacteria 4361
231 Ga0500610_0001217 3300053079 Bacteria 8580
232 Ga0500610_0004025 3300053079 Bacteria 5758
233 Ga0500578_0114981 3300053086 Bacteria 1694
234 Ga0500643_016254 3300053087 Bacteria 2525
235 Ga0500644_0021346 3300053088 Bacteria 1939
236 Ga0500651_0000261 3300053093 Bacteria 31479
237 Ga0500641_0002879 3300053096 Bacteria 6100
238 Ga0500571_000749 3300053110 Bacteria 13702
239 Ga0500593_003166 3300053117 Bacteria 6168
240 Ga0500597_054607 3300053120 Bacteria 1707
241 Ga0500607_000368 3300053121 Bacteria 43100
242 Ga0500608_008058 3300053122 Bacteria 4402
243 Ga0500642_0000490 3300053130 Bacteria 12206
244 Ga0500655_001576 3300053133 Bacteria 4316
245 Ga0500658_0001620 3300053134 Bacteria 8983
246 Ga0500658_0001826 3300053134 Bacteria 8390
247 Ga0500658_0009413 3300053134 Bacteria 3604
248 Ga0500568_0005408 3300053139 Bacteria 6602
249 Ga0500616_0004153 3300053153 Bacteria 10452
250 Ga0500616_0011444 3300053153 Bacteria 5237
251 Ga0500634_0006662 3300053161 Bacteria 5612
252 Ga0500634_0023439 3300053161 Bacteria 3355
253 Ga0500639_023852 3300053163 Bacteria 3234
254 Ga0500609_002793 3300053731 Bacteria 2487
255 Ga0500565_000210 3300053734 Bacteria 2885
256 Ga0501084_0020490 3300054114 Bacteria 5515
257 Ga0501082_0026608 3300060353 Bacteria 4986
258 Ga0466962_0040058 3300061719 Bacteria 2243
259 Ga0530510_0084355 3300061734 Bacteria 2314
260 2503198572 2503198000 Bacteria 6884444
261 2509117532 2508501123 Bacteria 6283661
262 2509393445 2509276022 Bacteria 6200534
263 2510314892 2510065059 Bacteria 6847884
264 2511389900 2511231027 Bacteria 5013807
265 2511391352 2511231027 Bacteria 5013807
266 2512933993 2512875016 Bacteria 6529530
267 2512962249 2512875024 Bacteria 7195110
268 2513610739 2513237090 Bacteria 7096802
269 2514037087 2513237164 Bacteria 7563725
270 2566036506 2565956521 Bacteria 4468993
271 2585200492 2582581294 Bacteria 6626667
272 2588520105 2588253730 Bacteria 6881675
273 2599622878 2599185214 Bacteria 8209958
274 2599671357 2599185226 Bacteria 8233575
275 2599679606 2599185227 Bacteria 8246414
276 2599691622 2599185229 Bacteria 8216126
277 2599935335 2599185301 Bacteria 6161860
278 2600193861 2599185352 Bacteria 7228948
279 2616555959 2615840698 Bacteria 7319877
280 2643805280 2643221557 Bacteria 7184309
281 2643983625 2643221595 Bacteria 6565519
282 2644062455 2643221609 Bacteria 6756331
283 2644064124 2643221610 Bacteria 7480339
284 2644076515 2643221611 Bacteria 6820941
285 2644157266 2643221627 Bacteria 6761570
286 2644375730 2643221668 Bacteria 7306521
287 2644415956 2643221675 Bacteria 7473456
288 2644448997 2643221680 Bacteria 7473610
289 2644674228 2643221723 Bacteria 7095460
290 2644686479 2643221726 Bacteria 7455827
291 2649119416 2648501241 Bacteria 5312320
292 2652974716 2651869818 Bacteria 5864031
293 2694628052 2693429783 Bacteria 7019804
294 2694641091 2693429784 Bacteria 7241525
295 2739245468 2738543012 Bacteria 7115078
296 2770195495 2767802442 Bacteria 5747986
297 2776270570 2775506902 Bacteria 6208009
298 2776281509 2775506904 Bacteria 5954060
299 2793295920 2791355256 Bacteria 6798008
300 2793336306 2791355262 Bacteria 6774204
301 2816474831 2816332133 Bacteria 7249298
302 2819602324 2818991446 Bacteria 7757362
303 2819682942 2818991461 Bacteria 7026071
304 2831265710 2831265667 Bacteria 7184833
305 2838056425 2838054893 Bacteria 7451788
306 2838077603 2838074704 Bacteria 6785777
307 2840767352 2840764183 Bacteria 6358399
308 2842681849 2842677519 Bacteria 5615038
309 2842872003 2842871566 Bacteria 4827117
310 2842875628 2842871566 Bacteria 4827117
311 2856321100 2856320880 Bacteria 7263508
312 2856352801 2856349417 Bacteria 6230045
313 2856363683 2856356410 Bacteria 6297484
314 2856370064 2856364286 Bacteria 6939991
315 2857352753 2857349434 Bacteria 7926032
316 2869284584 2869278585 Bacteria 7077053
317 2869290861 2869285874 Bacteria 6901219
318 2871433143 2871429161 Bacteria 6547891
319 2871491216 2871488783 Bacteria 6929816
320 2871502218 2871495908 Bacteria 6935695
321 2874143097 2874139085 Bacteria 7021506
322 2874153696 2874146452 Bacteria 7533118
323 2874160961 2874155637 Bacteria 6724144
324 2876363751 2876363079 Bacteria 6544991
325 2876373394 2876369609 Bacteria 6807521
326 2876385608 2876377896 Bacteria 6565995
327 2876397215 2876392853 Bacteria 6660880
328 2876419001 2876413966 Bacteria 6831344
329 2878740832 2878738818 Bacteria 7136951
330 2878750756 2878745973 Bacteria 6867388
331 2878755635 2878753008 Bacteria 6922523
332 2878766109 2878760144 Bacteria 6823465
333 2878773310 2878767105 Bacteria 6898628
334 2881159118 2881155292 Bacteria 6461656
335 2881164803 2881161766 Bacteria 7127907
336 2881860913 2881853255 Bacteria 6698367
337 2881862346 2881861095 Bacteria 7128710
338 2882912938 2882912400 Bacteria 6801539
339 2885203296 2885198086 Bacteria 7212419
340 2885217354 2885211737 Bacteria 7212420
341 2885306643 2885305155 Bacteria 7348390
342 2885324262 2885318864 Bacteria 6729568
343 2885328450 2885326080 Bacteria 7134805
344 2885337578 2885334103 Bacteria 7216818
345 2885349974 2885342637 Bacteria 7011821
346 2885356455 2885350715 Bacteria 6787678
347 2888343203 2888337043 Bacteria 6629336
348 2888352936 2888350351 Bacteria 7372807
349 2889014706 2889010040 Bacteria 6749192
350 2889020304 2889016732 Bacteria 6700763
351 2891376815 2891373044 Bacteria 5202277
352 2899930602 2899924645 Bacteria 7487985
353 2903454165 2903448605 Bacteria 7357801
354 2903496363 2903492973 Bacteria 13473544
355 2903498900 2903492973 Bacteria 13473544
356 2903523189 2903521522 Bacteria 6525694
357 2903529228 2903528002 Bacteria 6586099
358 2903547155 2903540706 Bacteria 7062119
359 2904546959 2904541872 Bacteria 8915136
360 2904663969 2904659560 Bacteria 6685615
361 2906313681 2906308376 Bacteria 6841989
362 2906326390 2906321335 Bacteria 6579571
363 2919084970 2919079590 Bacteria 5946433
364 2920827586 2920822456 Bacteria 6897201
365 2922130950 2922130491 Bacteria 7173936
366 2922192089 2922185730 Bacteria 7113964
367 2924724919 2924718760 Bacteria 6331356
368 2924766724 2924762789 Bacteria 6561353
369 2924778433 2924776078 Bacteria 7492003
370 2924785615 2924784321 Bacteria 7416538
371 2928039716 2928037797 Bacteria 7273642
372 2928044679 2928044640 Bacteria 7271509
373 2928052477 2928051484 Bacteria 7773759
374 2928064858 2928064002 Bacteria 7419480
375 2928074668 2928070936 Bacteria 8062541
376 2928087190 2928084124 Bacteria 7159212
377 2928523927 2928521798 Bacteria 4960112
378 2929164431 2929160207 Bacteria 9075316
379 2936382590 2936381700 Bacteria 7006523
380 2937820014 2937813078 Bacteria 7783518
381 2937848969 2937848649 Bacteria 6983481
382 2937880013 2937877337 Bacteria 7246526
383 2937881474 2937877337 Bacteria 7246526
384 2937980051 2937972304 Bacteria 7532020
385 2938001018 2937994558 Bacteria 7036190
386 2938020500 2938014810 Bacteria 6700592
387 2945910869 2945909444 Bacteria 7065066
388 2945946733 2945945610 Bacteria 5951079
389 2945986890 2945984333 Bacteria 7358892
390 2954012871 2954011201 Bacteria 4762601
391 2958041560 2958034702 Bacteria 6989922
392 2958048263 2958041894 Bacteria 13082850
393 2958058098 2958041894 Bacteria 13082850
394 2958069452 2958064165 Bacteria 7158582
395 2958086077 2958084443 Bacteria 7312792
396 2958087969 2958084443 Bacteria 7312792
397 2958099446 2958092219 Bacteria 6861151
398 2958107711 2958100919 Bacteria 6800575
399 2958135261 2958130278 Bacteria 6897202
400 2958147388 2958144490 Bacteria 6677056
401 2958171284 2958165035 Bacteria 6906348
402 2958176394 2958172287 Bacteria 6716688
403 2958184290 2958179912 Bacteria 6874908
404 2961082345 2961077736 Bacteria 7079850
405 2961118891 2961114664 Bacteria 6680456
406 2961128682 2961127735 Bacteria 7196641
407 2961169725 2961163497 Bacteria 6901077
408 2961176431 2961170736 Bacteria 7072258
409 2963645210 2963644680 Bacteria 6530403
410 2965024485 2965018300 Bacteria 6883036
411 2965121855 2965119406 Bacteria 6956431
412 2967998824 2967996073 Bacteria 6787468
413 2968007605 2968003550 Bacteria 6929263
414 2968023086 2968016561 Bacteria 7022047
415 2968089891 2968083720 Bacteria 7351627
416 2968115108 2968110612 Bacteria 6814636
417 2968122095 2968117919 Bacteria 6536078
418 2968178117 2968171901 Bacteria 6894245
419 2970475670 2970469710 Bacteria 6969209
420 2970492458 2970489779 Bacteria 6517260
421 2970509102 2970503327 Bacteria 7099517
422 2970560963 2970554993 Bacteria 6814252
423 2970599196 2970593180 Bacteria 7073582
424 2977824853 2977821940 Bacteria 6906439
425 2977831002 2977828996 Bacteria 7007971
426 2977850442 2977843712 Bacteria 6753583
427 2977865951 2977864932 Bacteria 7534097
428 2977925613 2977922695 Bacteria 6956781
429 2977946762 2977942078 Bacteria 7570577
430 2977974465 2977971508 Bacteria 7472917
431 2977988490 2977986579 Bacteria 6581278
432 2979750920 2979742915 Bacteria 7301278
433 2979813781 2979808191 Bacteria 7179355
434 2987641346 2987636660 Bacteria 8088555
435 2987654009 2987652177 Bacteria 6969023
436 2987665949 2987659509 Bacteria 6966464
437 2987667653 2987666974 Bacteria 6509233
438 2989350780 2989349275 Bacteria 6349068
439 2996355707 2996348954 Bacteria 7239054
440 2996894791 2996893221 Bacteria 5823108
441 3000137222 3000135777 Bacteria 6891109
442 3002145718 3002141150 Bacteria 5254435
443 3004173128 3004167301 Bacteria 8330599
444 3004194972 3004188549 Bacteria 6952365
445 3004210152 3004203850 Bacteria 7307914
446 3004217145 3004211236 Bacteria 7417683
447 3004225262 3004218560 Bacteria 7421728
448 3004282133 3004275668 Bacteria 7114440
449 3004337465 3004334049 Bacteria 8449246
450 637077145 637000159 Bacteria 7596297
451 8004377216 8004374579 Bacteria 6898112
452 8004393150 8004387939 Bacteria 7049250
453 8004644111 8004640170 Bacteria 6723001
454 8004719937 8004714634 Bacteria 6776161
455 Ga0163161_10000210
456 JGI24740J21852_10029322
457 JGI24740J21852_10029472
458 JGI24740J21852_10045154
459 JGI25152J39213_1003267
460 JGI25159J45721_1000030
461 JGI25151J46595_10006535
462 JGI25151J46595_10041770
463 JGI25165J46597_1000386
464 JGI25153J46596_10000067
465 JGI25153J46596_10008381
466 JGI25160J50197_1000075
467 JGI25161J50226_1000225
468 Ga0055542_1000052
469 Ga0055542_1000325
470 Ga0055526_1002641
471 Ga0055526_1013380
472 Ga0055537_1005328
473 Ga0055524_1000960
474 Ga0055536_1001366
475 Ga0055536_1001858
476 Ga0055528_1000219
477 Ga0055528_1011656
478 Ga0055530_10001570
479 Ga0055540_1018288
480 Ga0055540_1024691
481 Ga0055543_1000168
482 Ga0055543_1002602
483 Ga0065165_1000206
484 Ga0065165_1001023
485 Ga0065165_1002306
486 Ga0070682_100078437
487 Ga0068868_100006611
488 Ga0070660_100031524
489 Ga0070692_10100391
490 Ga0070694_100048865
491 Ga0068867_100035248
492 Ga0070685_10105682
493 Ga0070698_100042516
494 Ga0068853_100123636
495 Ga0068853_100261083
496 Ga0068855_100223096
497 Ga0068854_100041778
498 Ga0068862_100015769
499 Ga0081538_10011280
500 Ga0075364_10054307
501 Ga0075364_10149830
502 Ga0075367_10013864
503 Ga0075367_10025035
504 Ga0075433_10034877
505 Ga0075429_100049508
506 Ga0111539_10000255
507 Ga0105243_10000273
508 Ga0105241_10390460
509 Ga0105237_10016689
510 Ga0105238_10005082
511 Ga0105239_10140680
512 Ga0157371_10119827
513 Ga0157370_10005581
514 Ga0171463_1002
515 Ga0163162_10079791
516 Ga0163163_10156543
517 Ga0183363_1258
518 Ga0213872_10024493
519 Ga0209436_100338
520 Ga0209436_104955
521 Ga0209147_101139
522 Ga0209258_100009
523 Ga0207425_1000189
524 Ga0209148_1000007
525 Ga0209148_1000136
526 Ga0209759_1000350
527 Ga0209129_1000083
528 Ga0209233_1000306
529 Ga0209565_1000424
530 Ga0209565_1002701
531 Ga0209455_1000085
532 Ga0209673_1000054
533 Ga0209673_1000089
534 Ga0209673_1001010
535 Ga0209130_1000154
536 Ga0209130_1000463
537 Ga0209130_1000653
538 Ga0209675_1000422
539 Ga0209675_1000534
540 Ga0209675_1001947
541 Ga0209676_1000004
542 Ga0209676_1000269
543 Ga0209676_1000293
544 Ga0209676_1001353
545 Ga0209676_1002491
546 Ga0209025_1000032
547 Ga0209025_1000133
548 Ga0209025_1000692
549 Ga0209025_1002147
550 Ga0209025_1026864
551 Ga0209564_1000025
552 Ga0209564_1000323
553 Ga0209564_1000332
554 Ga0209564_1006866
555 Ga0209758_1000132
556 Ga0209758_1000284
557 Ga0209758_1005290
558 Ga0209050_1000002
559 Ga0209256_1000073
560 Ga0209256_1000375
561 Ga0209256_1000385
562 Ga0209256_1000907
563 Ga0209256_1008531
564 Ga0207426_1000286
565 Ga0207426_1000323
566 Ga0207426_1000517
567 Ga0209051_1000002
568 Ga0209051_1000130
569 Ga0209051_1002181
570 Ga0209051_1008232
571 Ga0209051_1027573
572 Ga0209257_1000002
573 Ga0209257_1011414
574 Ga0209257_1017249
575 Ga0207705_10075043
576 Ga0207695_10299960
577 Ga0207671_10012570
578 Ga0207694_10008431
579 Ga0207709_10000435
580 Ga0207709_10077838
581 Ga0207667_10351264
582 Ga0207639_10041108
583 Ga0207702_10379094
584 Ga0207698_10180694
585 Ga0207428_10008302
586 Ga0268265_10045400
587 Ga0314311_1059424
588 Ga0316178_1155164
589 Ga0316180_1073528
590 Ga0316183_1022889
591 Ga0316182_1179756
592 Ga0307513_10094091
593 Ga0307509_10047734
594 Ga0307508_10000141
595 Ga0307406_10034804
596 Ga0307412_10017809
597 Ga0307416_100279373
598 Ga0373949_0000165
599 Ga0373937_0088749
600 Ga0395905_0004486
601 Ga0395905_0017799
602 Ga0395901_0115089
603 Ga0395901_0152023
604 Ga0436361_0691237
605 Ga0450920_001097
606 Ga0450918_000028
607 Ga0466972_0056996
608 Ga0453683_0001704
609 Ga0466965_0016446
610 Ga0466961_0009090
611 Ga0466971_0027646
612 Ga0451576_0005405
613 Ga0466958_0017949
614 Ga0466967_0016087
615 Ga0495627_003596
616 Ga0495638_0077019
617 Ga0495638_0143566
618 Ga0495610_0001005
619 Ga0495616_0000899
620 Ga0495631_0000744
621 Ga0495637_0001189
622 Ga0495637_0020004
623 Ga0495654_0044425
624 Ga0495668_0052406
625 Ga0495625_0105545
626 Ga0495625_0131524
627 Ga0495625_0164493
628 Ga0495588_0016936
629 Ga0495658_0031398
630 Ga0495670_0041363
631 Ga0495671_0003348
632 Ga0495686_0001765
633 Ga0495593_0010853
634 Ga0495602_0067709
635 Ga0495614_0009485
636 Ga0496102_0098236
637 Ga0496103_0152795
638 Ga0496108_0016093
639 Ga0496116_0105996
640 Ga0496117_0001262
641 Ga0496117_0020710
642 Ga0496118_0003663
643 Ga0496120_0001375
644 Ga0496121_0062930
645 Ga0496121_0119898
646 Ga0496121_0245342
647 Ga0496122_0080347
648 Ga0496123_0000018
649 Ga0496123_0000105
650 Ga0496124_0003217
651 Ga0496125_0000575
652 Ga0496125_0011264
653 Ga0496125_0081079
654 Ga0496126_0001062
655 Ga0496126_0019191
656 Ga0495678_016432
657 Ga0501032_0034775
658 Ga0501034_0000945
659 Ga0501036_0147954
660 Ga0501037_0296003
661 Ga0501038_0043154
662 Ga0501043_0016998
663 Ga0501043_0033887
664 Ga0501047_0007237
665 Ga0501047_0044081
666 Ga0501073_0008591
667 Ga0501073_0063552
668 Ga0501073_0120173
669 Ga0501077_0035540
670 Ga0501080_0051918
671 Ga0501080_0059089
672 Ga0501083_0111506
673 Ga0501035_0038045
674 Ga0501035_0165182
675 Ga0501044_0006491
676 Ga0501044_0271308
677 nmdc:mga0yw44_28323_c1
678 nmdc:mga0yw44_88467_c1
679 nmdc:mga06z11_18213_c1
680 nmdc:mga06z11_42245_c1
681 nmdc:mga09592_9613_c1
682 nmdc:mga06r32_244883_c1
683 nmdc:mga08y16_3779_c1
684 nmdc:mga0a205_42874_c1
685 Ga0500610_0001217
686 Ga0500610_0004025
687 Ga0500578_0114981
688 Ga0500643_016254
689 Ga0500644_0021346
690 Ga0500651_0000261
691 Ga0500641_0002879
692 Ga0500571_000749
693 Ga0500593_003166
694 Ga0500597_054607
695 Ga0500607_000368
696 Ga0500608_008058
697 Ga0500642_0000490
698 Ga0500655_001576
699 Ga0500658_0001620
700 Ga0500658_0001826
701 Ga0500658_0009413
702 Ga0500568_0005408
703 Ga0500616_0004153
704 Ga0500616_0011444
705 Ga0500634_0006662
706 Ga0500634_0023439
707 Ga0500639_023852
708 Ga0500609_002793
709 Ga0500565_000210
710 Ga0501084_0020490
711 Ga0501082_0026608
712 Ga0466962_0040058
713 Ga0530510_0084355
714 2503198572
715 2509117532
716 2509393445
717 2510314892
718 2511389900
719 2511391352
720 2512933993
721 2512962249
722 2513610739
723 2514037087
724 2566036506
725 2585200492
726 2588520105
727 2599622878
728 2599671357
729 2599679606
730 2599691622
731 2599935335
732 2600193861
733 2616555959
734 2643805280
735 2643983625
736 2644062455
737 2644064124
738 2644076515
739 2644157266
740 2644375730
741 2644415956
742 2644448997
743 2644674228
744 2644686479
745 2649119416
746 2652974716
747 2694628052
748 2694641091
749 2739245468
750 2770195495
751 2776270570
752 2776281509
753 2793295920
754 2793336306
755 2816474831
756 2819602324
757 2819682942
758 2831265710
759 2838056425
760 2838077603
761 2840767352
762 2842681849
763 2842872003
764 2842875628
765 2856321100
766 2856352801
767 2856363683
768 2856370064
769 2857352753
770 2869284584
771 2869290861
772 2871433143
773 2871491216
774 2871502218
775 2874143097
776 2874153696
777 2874160961
778 2876363751
779 2876373394
780 2876385608
781 2876397215
782 2876419001
783 2878740832
784 2878750756
785 2878755635
786 2878766109
787 2878773310
788 2881159118
789 2881164803
790 2881860913
791 2881862346
792 2882912938
793 2885203296
794 2885217354
795 2885306643
796 2885324262
797 2885328450
798 2885337578
799 2885349974
800 2885356455
801 2888343203
802 2888352936
803 2889014706
804 2889020304
805 2891376815
806 2899930602
807 2903454165
808 2903496363
809 2903498900
810 2903523189
811 2903529228
812 2903547155
813 2904546959
814 2904663969
815 2906313681
816 2906326390
817 2919084970
818 2920827586
819 2922130950
820 2922192089
821 2924724919
822 2924766724
823 2924778433
824 2924785615
825 2928039716
826 2928044679
827 2928052477
828 2928064858
829 2928074668
830 2928087190
831 2928523927
832 2929164431
833 2936382590
834 2937820014
835 2937848969
836 2937880013
837 2937881474
838 2937980051
839 2938001018
840 2938020500
841 2945910869
842 2945946733
843 2945986890
844 2954012871
845 2958041560
846 2958048263
847 2958058098
848 2958069452
849 2958086077
850 2958087969
851 2958099446
852 2958107711
853 2958135261
854 2958147388
855 2958171284
856 2958176394
857 2958184290
858 2961082345
859 2961118891
860 2961128682
861 2961169725
862 2961176431
863 2963645210
864 2965024485
865 2965121855
866 2967998824
867 2968007605
868 2968023086
869 2968089891
870 2968115108
871 2968122095
872 2968178117
873 2970475670
874 2970492458
875 2970509102
876 2970560963
877 2970599196
878 2977824853
879 2977831002
880 2977850442
881 2977865951
882 2977925613
883 2977946762
884 2977974465
885 2977988490
886 2979750920
887 2979813781
888 2987641346
889 2987654009
890 2987665949
891 2987667653
892 2989350780
893 2996355707
894 2996894791
895 3000137222
896 3002145718
897 3004173128
898 3004194972
899 3004210152
900 3004217145
901 3004225262
902 3004282133
903 3004337465
904 637077145
905 8004377216
906 8004393150
907 8004644111
908 8004719937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

75

218

0.96

PF17912

OB_MalK

MalK OB fold domain

291

342

0.94

PF08402

TOBE_2

TOBE domain

335

407

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9514 20 250
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9422 19 234
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9407 20 250
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9396 21 234
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9391 19 232
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9869 21 233 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9836 19 234 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9703 19 234 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 21 233 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9641 21 252 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9913 18 216 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A382ZAC4-F1-model_v4 ABC transporter domain-containing protein 0.9886 21 227 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A848WQ45-F1-model_v4 ABC transporter ATP-binding protein 0.9877 19 252 GO:0005524
GO:0016887
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.987 21 238 GO:0005524
GO:0016887
GO:0055052
AF-A0A4Q3TF12-F1-model_v4 ABC transporter ATP-binding protein 0.9849 19 170 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060

Map