F447366

General Info

Members Datasets Scaffolds Average Seq Length
454 153 442 117

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10168218|Ga0099794_101682183
Length 121
Sequence MPRVKSNVARLKRKNKVMKLAKGYWGGRSKLWKAAKESVERAQKYAYRDRRRKKGDFRRLWITRINAAARLHELTYGRFMNGLRKAGVTVNRKILADLAVRDPVAFAQLAEVAKQAPPPTR

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
3 2831426010 Nostoc sp. 106C Isolate Unclassified
4 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
5 2849660919 Nostoc sp. T09 Isolate Unclassified
6 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
7 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
8 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
9 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
104 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
105 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
108 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
109 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
110 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
150 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
151 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
152 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
153 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.21
Metatranscriptomes 8.15
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 1.54
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10487266 3300005289 Bacteria 677
2 Ga0065707_10001702 3300005295 Bacteria 7485
3 Ga0065707_10128557 3300005295 Bacteria 1963
4 Ga0065707_10603304 3300005295 Bacteria 689
5 Ga0070680_100085827 3300005336 Bacteria 2601
6 Ga0070680_100398548 3300005336 Bacteria 1173
7 Ga0070691_10561081 3300005341 Bacteria 668
8 Ga0070687_100035538 3300005343 Bacteria 2475
9 Ga0070692_10034063 3300005345 Bacteria 2570
10 Ga0070703_10010620 3300005406 Bacteria 2596
11 Ga0070703_10010689 3300005406 Bacteria 2588
12 Ga0070703_10085390 3300005406 Unclassified 1084
13 Ga0070703_10350852 3300005406 Bacteria 629
14 Ga0070709_10002412 3300005434 Bacteria 10128
15 Ga0070709_10057272 3300005434 Bacteria 2468
16 Ga0070709_10146828 3300005434 Bacteria 1626
17 Ga0070714_100120869 3300005435 Bacteria 2330
18 Ga0070713_100141639 3300005436 Bacteria 2131
19 Ga0070713_100247215 3300005436 Bacteria 1626
20 Ga0070701_10001843 3300005438 Bacteria 8029
21 Ga0070711_100000466 3300005439 Bacteria 21169
22 Ga0070705_100072691 3300005440 Bacteria 2084
23 Ga0070705_100214555 3300005440 Bacteria 1329
24 Ga0070705_100485500 3300005440 Bacteria 934
25 Ga0070705_100521768 3300005440 Bacteria 905
26 Ga0070700_100144922 3300005441 Bacteria 1618
27 Ga0070694_100003097 3300005444 Bacteria 9899
28 Ga0070694_100035006 3300005444 Bacteria 3316
29 Ga0070694_100096351 3300005444 Bacteria 2085
30 Ga0070694_100480803 3300005444 Bacteria 985
31 Ga0070694_100690138 3300005444 Bacteria 829
32 Ga0070694_100762708 3300005444 Bacteria 791
33 Ga0070694_101944288 3300005444 Bacteria 502
34 Ga0070708_100001912 3300005445 Bacteria 16029
35 Ga0070708_100042312 3300005445 Bacteria 3998
36 Ga0070708_100107478 3300005445 Bacteria 2561
37 Ga0070708_100123418 3300005445 Bacteria 2391
38 Ga0070708_100211359 3300005445 Bacteria 1818
39 Ga0070708_100311951 3300005445 Bacteria 1481
40 Ga0070708_100365274 3300005445 Bacteria 1360
41 Ga0070708_100974059 3300005445 Bacteria 795
42 Ga0070708_101485594 3300005445 Bacteria 631
43 Ga0070663_100700751 3300005455 Bacteria 861
44 Ga0068867_100232782 3300005459 Bacteria 1490
45 Ga0070706_100003511 3300005467 Bacteria 15410
46 Ga0070706_100007900 3300005467 Bacteria 9934
47 Ga0070706_100027110 3300005467 Bacteria 5272
48 Ga0070706_100034131 3300005467 Bacteria 4697
49 Ga0070706_100139786 3300005467 Bacteria 2260
50 Ga0070706_100548439 3300005467 Bacteria 1075
51 Ga0070707_100044232 3300005468 Bacteria 4262
52 Ga0070707_100060977 3300005468 Bacteria 3617
53 Ga0070707_100072874 3300005468 Bacteria 3311
54 Ga0070707_100117207 3300005468 Bacteria 2585
55 Ga0070707_100438943 3300005468 Bacteria 1266
56 Ga0070707_100449342 3300005468 Bacteria 1249
57 Ga0070707_100878867 3300005468 Bacteria 861
58 Ga0070707_100958796 3300005468 Bacteria 820
59 Ga0070707_101835444 3300005468 Bacteria 573
60 Ga0070698_100000416 3300005471 Bacteria 45414
61 Ga0070698_100048093 3300005471 Bacteria 4358
62 Ga0070698_100296885 3300005471 Bacteria 1547
63 Ga0070698_100304400 3300005471 Bacteria 1525
64 Ga0070699_100010664 3300005518 Bacteria 7953
65 Ga0070699_100013305 3300005518 Bacteria 7096
66 Ga0070699_100042082 3300005518 Bacteria 3952
67 Ga0070699_100054171 3300005518 Bacteria 3472
68 Ga0070699_100167452 3300005518 Bacteria 1947
69 Ga0070699_100173212 3300005518 Bacteria 1913
70 Ga0070699_100344020 3300005518 Bacteria 1342
71 Ga0070699_100480363 3300005518 Bacteria 1128
72 Ga0070679_100442343 3300005530 Unclassified 1245
73 Ga0070697_100049685 3300005536 Bacteria 3404
74 Ga0070697_100240511 3300005536 Bacteria 1546
75 Ga0070697_100342187 3300005536 Bacteria 1291
76 Ga0070695_100028089 3300005545 Bacteria 3489
77 Ga0070695_100035587 3300005545 Bacteria 3128
78 Ga0070695_100104886 3300005545 Bacteria 1909
79 Ga0070696_100071808 3300005546 Bacteria 2436
80 Ga0070696_100138800 3300005546 Bacteria 1774
81 Ga0070696_100331658 3300005546 Bacteria 1173
82 Ga0070696_100338390 3300005546 Bacteria 1162
83 Ga0070696_100538865 3300005546 Bacteria 934
84 Ga0070696_101276059 3300005546 Bacteria 623
85 Ga0070696_101893209 3300005546 Unclassified 516
86 Ga0070693_100299299 3300005547 Unclassified 1084
87 Ga0070704_100007259 3300005549 Bacteria 6592
88 Ga0070704_100192752 3300005549 Bacteria 1639
89 Ga0070704_100282679 3300005549 Bacteria 1375
90 Ga0070704_100345991 3300005549 Bacteria 1253
91 Ga0070704_101497885 3300005549 Bacteria 620
92 Ga0070702_100227511 3300005615 Bacteria 1251
93 Ga0070702_100378911 3300005615 Bacteria 1005
94 Ga0068861_100593766 3300005719 Unclassified 1015
95 Ga0070715_10234621 3300006163 Bacteria 951
96 Ga0070716_100000833 3300006173 Bacteria 13306
97 Ga0070712_100845247 3300006175 Bacteria 787
98 Ga0075428_100072133 3300006844 Bacteria 3773
99 Ga0075428_100708033 3300006844 Bacteria 1073
100 Ga0075428_101472602 3300006844 Bacteria 714
101 Ga0075430_100415956 3300006846 Bacteria 1110
102 Ga0075430_101710854 3300006846 Bacteria 516
103 Ga0075431_100161292 3300006847 Bacteria 2305
104 Ga0075431_100304256 3300006847 Bacteria 1610
105 Ga0075433_10000946 3300006852 Bacteria 20505
106 Ga0075433_10012213 3300006852 Bacteria 6927
107 Ga0075433_10207593 3300006852 Bacteria 1741
108 Ga0075433_10222011 3300006852 Bacteria 1678
109 Ga0075433_10547301 3300006852 Bacteria 1018
110 Ga0075433_10671142 3300006852 Bacteria 908
111 Ga0075434_100017892 3300006871 Bacteria 6836
112 Ga0075434_100063169 3300006871 Bacteria 3686
113 Ga0075434_100110214 3300006871 Bacteria 2763
114 Ga0075434_100316051 3300006871 Bacteria 1582
115 Ga0075434_100342334 3300006871 Bacteria 1516
116 Ga0075434_100378950 3300006871 Bacteria 1435
117 Ga0075434_100421663 3300006871 Bacteria 1355
118 Ga0075434_100661839 3300006871 Bacteria 1062
119 Ga0075436_100000724 3300006914 Bacteria 21850
120 Ga0075436_100020245 3300006914 Bacteria 4566
121 Ga0075436_100021129 3300006914 Bacteria 4466
122 Ga0075436_100048460 3300006914 Bacteria 2931
123 Ga0075436_100128836 3300006914 Bacteria 1774
124 Ga0075436_100305135 3300006914 Bacteria 1141
125 Ga0075436_100592009 3300006914 Bacteria 816
126 Ga0075435_100027526 3300007076 Bacteria 4449
127 Ga0075435_100042270 3300007076 Bacteria 3646
128 Ga0075435_100063230 3300007076 Bacteria 3005
129 Ga0075435_100127538 3300007076 Bacteria 2127
130 Ga0075435_100415931 3300007076 Bacteria 1158
131 Ga0075435_100800048 3300007076 Bacteria 821
132 Ga0099794_10019423 3300007265 Bacteria 3061
133 Ga0099794_10042505 3300007265 Bacteria 2167
134 Ga0099794_10138625 3300007265 Bacteria 1231
135 Ga0099794_10168218 3300007265 Bacteria 1117
136 Ga0099794_10223949 3300007265 Bacteria 967
137 Ga0099794_10318714 3300007265 Bacteria 806
138 Ga0099795_10074263 3300007788 Bacteria 1289
139 Ga0099795_10331361 3300007788 Bacteria 676
140 Ga0105251_10505974 3300009011 Unclassified 565
141 Ga0111539_10521482 3300009094 Bacteria 1384
142 Ga0114129_10124105 3300009147 Bacteria 3551
143 Ga0114129_10353240 3300009147 Bacteria 1947
144 Ga0114129_10365044 3300009147 Bacteria 1910
145 Ga0105242_10608603 3300009176 Bacteria 1056
146 Ga0105248_11871847 3300009177 Bacteria 681
147 Ga0099796_10222393 3300010159 Bacteria 774
148 Ga0209566_100113 3300025225 Bacteria 109893
149 Ga0207653_10000333 3300025885 Bacteria 24834
150 Ga0207653_10010048 3300025885 Bacteria 2951
151 Ga0207685_10053815 3300025905 Bacteria 1565
152 Ga0207685_10176384 3300025905 Bacteria 987
153 Ga0207699_10005787 3300025906 Bacteria 5946
154 Ga0207699_10046333 3300025906 Bacteria 2543
155 Ga0207699_10529162 3300025906 Bacteria 853
156 Ga0207684_10012760 3300025910 Bacteria 7287
157 Ga0207684_10015791 3300025910 Bacteria 6494
158 Ga0207684_10119077 3300025910 Bacteria 2263
159 Ga0207684_10231720 3300025910 Bacteria 1593
160 Ga0207684_10491548 3300025910 Bacteria 1052
161 Ga0207684_10641265 3300025910 Bacteria 905
162 Ga0207684_10963548 3300025910 Bacteria 715
163 Ga0207693_10304141 3300025915 Bacteria 1249
164 Ga0207663_10000556 3300025916 Bacteria 16472
165 Ga0207660_10104525 3300025917 Bacteria 2121
166 Ga0207660_10139308 3300025917 Bacteria 1854
167 Ga0207660_10194805 3300025917 Bacteria 1580
168 Ga0207662_10032449 3300025918 Bacteria 3040
169 Ga0207652_10418293 3300025921 Unclassified 1209
170 Ga0207646_10004203 3300025922 Bacteria 15766
171 Ga0207646_10021064 3300025922 Bacteria 6029
172 Ga0207646_10096705 3300025922 Bacteria 2646
173 Ga0207646_10163732 3300025922 Bacteria 2008
174 Ga0207646_10334028 3300025922 Bacteria 1369
175 Ga0207646_10359763 3300025922 Bacteria 1315
176 Ga0207646_10462778 3300025922 Bacteria 1144
177 Ga0207646_11036349 3300025922 Bacteria 724
178 Ga0207700_10315062 3300025928 Bacteria 1354
179 Ga0207700_10537536 3300025928 Bacteria 1036
180 Ga0207664_10425967 3300025929 Bacteria 1183
181 Ga0207686_10735040 3300025934 Bacteria 787
182 Ga0207670_10435867 3300025936 Bacteria 1054
183 Ga0207665_10001273 3300025939 Bacteria 17022
184 Ga0207708_10034526 3300026075 Bacteria 3846
185 Ga0207648_10803701 3300026089 Bacteria 875
186 Ga0207675_100610362 3300026118 Unclassified 1094
187 Ga0209588_1001900 3300027671 Bacteria 5586
188 Ga0209588_1004374 3300027671 Bacteria 3981
189 Ga0209588_1115643 3300027671 Bacteria 860
190 Ga0209588_1185906 3300027671 Bacteria 651
191 Ga0268264_11738946 3300028381 Bacteria 634
192 Ga0265338_10423252 3300028800 Bacteria 946
193 Ga0265324_10179974 3300029957 Unclassified 718
194 Ga0265327_10117854 3300031251 Unclassified 1262
195 Ga0265327_10249992 3300031251 Unclassified 790
196 Ga0265316_10413675 3300031344 Bacteria 970
197 Ga0307509_10455043 3300031507 Bacteria 973
198 Ga0316576_10010664 3300031727 Bacteria 5985
199 Ga0316576_10154617 3300031727 Bacteria 1729
200 Ga0316576_10582226 3300031727 Bacteria 818
201 Ga0316576_10827913 3300031727 Bacteria 665
202 Ga0316576_10845368 3300031727 Bacteria 657
203 Ga0316578_10289941 3300031728 Bacteria 979
204 Ga0316578_10378048 3300031728 Bacteria 841
205 Ga0316577_10070922 3300031733 Bacteria 1944
206 Ga0316577_10208218 3300031733 Bacteria 1105
207 Ga0316577_10515869 3300031733 Unclassified 679
208 Ga0316580_10217832 3300032139 Bacteria 589
209 Ga0316580_10279028 3300032139 Unclassified 518
210 Ga0316593_10004513 3300032168 Bacteria 3582
211 Ga0316593_10022482 3300032168 Bacteria 1981
212 Ga0316593_10047563 3300032168 Bacteria 1443
213 Ga0316593_10048381 3300032168 Bacteria 1431
214 Ga0316593_10051776 3300032168 Unclassified 1389
215 Ga0316593_10052750 3300032168 Unclassified 1377
216 Ga0316593_10083893 3300032168 Unclassified 1115
217 Ga0316593_10089570 3300032168 Bacteria 1082
218 Ga0316593_10093080 3300032168 Bacteria 1063
219 Ga0316593_10165215 3300032168 Bacteria 810
220 Ga0316593_10215056 3300032168 Bacteria 713
221 Ga0316592_1001236 3300033524 Bacteria 4033
222 Ga0316592_1002387 3300033524 Bacteria 3239
223 Ga0316592_1008478 3300033524 Bacteria 2034
224 Ga0316592_1015698 3300033524 Bacteria 1578
225 Ga0316592_1018789 3300033524 Bacteria 1459
226 Ga0316592_1034129 3300033524 Bacteria 1113
227 Ga0316592_1039549 3300033524 Bacteria 1042
228 Ga0316592_1113073 3300033524 Bacteria 628
229 Ga0316586_1030656 3300033527 Bacteria 920
230 Ga0316588_1009326 3300033528 Bacteria 2045
231 Ga0316588_1020653 3300033528 Bacteria 1493
232 Ga0316588_1035338 3300033528 Bacteria 1184
233 Ga0316588_1082844 3300033528 Unclassified 795
234 Ga0316588_1151084 3300033528 Unclassified 596
235 Ga0316587_1004138 3300033529 Bacteria 2090
236 Ga0316596_1000599 3300033541 Bacteria 6357
237 Ga0316596_1001565 3300033541 Bacteria 4665
238 Ga0316596_1013933 3300033541 Bacteria 1988
239 Ga0316596_1020637 3300033541 Unclassified 1677
240 Ga0316596_1023730 3300033541 Bacteria 1572
241 Ga0316596_1028088 3300033541 Bacteria 1453
242 Ga0316596_1029358 3300033541 Unclassified 1423
243 Ga0316596_1031283 3300033541 Bacteria 1382
244 Ga0316596_1035844 3300033541 Bacteria 1296
245 Ga0316596_1076711 3300033541 Bacteria 897
246 Ga0316596_1087554 3300033541 Unclassified 839
247 Ga0373932_0079127 3300035112 Bacteria 1035
248 Ga0373953_0220421 3300035117 Bacteria 822
249 Ga0373954_0482314 3300035118 Bacteria 614
250 Ga0373954_0696110 3300035118 Bacteria 504
251 Ga0373956_0247342 3300035119 Bacteria 848
252 Ga0316574_0008420 3300035398 Bacteria 5725
253 Ga0316574_0045215 3300035398 Bacteria 2726
254 Ga0316574_0286529 3300035398 Bacteria 1049
255 Ga0316574_0532025 3300035398 Bacteria 731
256 Ga0316574_0727424 3300035398 Bacteria 607
257 Ga0316574_0852460 3300035398 Bacteria 553
258 Ga0373933_0224128 3300035724 Bacteria 1207
259 Ga0373937_0465758 3300036401 Bacteria 1200
260 Ga0316582_0048546 3300036647 Bacteria 2684
261 Ga0316582_0136489 3300036647 Bacteria 1651
262 Ga0316582_0634284 3300036647 Bacteria 735
263 Ga0316584_0064252 3300036712 Bacteria 2748
264 Ga0316584_0199920 3300036712 Bacteria 1475
265 Ga0316584_0538047 3300036712 Bacteria 817
266 Ga0400484_27126 3300038725 Bacteria 1118
267 Ga0400490_02528 3300038726 Bacteria 1112
268 Ga0400488_54121 3300038741 Bacteria 2660
269 Ga0242420_018127 3300038996 Bacteria 1237
270 Ga0242420_065021 3300038996 Bacteria 733
271 Ga0400483_025368 3300039062 Bacteria 10003
272 Ga0400483_047173 3300039062 Bacteria 1510
273 Ga0400483_130835 3300039062 Bacteria 1200
274 Ga0400483_236848 3300039062 Bacteria 1419
275 Ga0400489_18718 3300039093 Bacteria 9448
276 Ga0400489_29617 3300039093 Bacteria 1351
277 Ga0400487_66491 3300039110 Bacteria 2033
278 Ga0451795_0977824 3300041456 Bacteria 2168
279 Ga0451837_0839968 3300041494 Bacteria 911
280 Ga0451577_0000035 3300042876 Bacteria 373467
281 Ga0451577_0001455 3300042876 Bacteria 31470
282 Ga0451577_0005950 3300042876 Bacteria 12301
283 Ga0451577_0014478 3300042876 Bacteria 7353
284 Ga0451577_0019300 3300042876 Bacteria 6270
285 Ga0451577_0080646 3300042876 Unclassified 2902
286 Ga0451577_0084759 3300042876 Bacteria 2827
287 Ga0451577_0134032 3300042876 Bacteria 2223
288 Ga0451577_0159139 3300042876 Bacteria 2033
289 Ga0451577_0204370 3300042876 Bacteria 1783
290 Ga0451577_0331332 3300042876 Bacteria 1381
291 Ga0451577_0347994 3300042876 Bacteria 1344
292 Ga0451577_0388643 3300042876 Bacteria 1266
293 Ga0451577_0542091 3300042876 Bacteria 1056
294 Ga0451577_0555635 3300042876 Unclassified 1042
295 Ga0451577_0747300 3300042876 Bacteria 885
296 Ga0451577_0965553 3300042876 Bacteria 766
297 Ga0451577_1174854 3300042876 Bacteria 685
298 Ga0451577_1801651 3300042876 Bacteria 537
299 Ga0453683_0000002 3300044673 Bacteria 1244396
300 Ga0453683_0000048 3300044673 Bacteria 207480
301 Ga0453683_0000058 3300044673 Bacteria 189089
302 Ga0453683_0000067 3300044673 Bacteria 164438
303 Ga0453683_0000236 3300044673 Bacteria 73105
304 Ga0453683_0001452 3300044673 Bacteria 20459
305 Ga0453683_0005568 3300044673 Bacteria 8764
306 Ga0453683_0071704 3300044673 Bacteria 2168
307 Ga0453683_0090358 3300044673 Bacteria 1919
308 Ga0453683_0108030 3300044673 Bacteria 1749
309 Ga0453683_0138214 3300044673 Bacteria 1537
310 Ga0453683_0156947 3300044673 Unclassified 1439
311 Ga0453683_0227008 3300044673 Bacteria 1188
312 Ga0453683_0392527 3300044673 Unclassified 894
313 Ga0453683_0553790 3300044673 Bacteria 748
314 Ga0453683_1027339 3300044673 Unclassified 548
315 Ga0453684_0000097 3300044712 Bacteria 377772
316 Ga0453684_0000209 3300044712 Bacteria 255543
317 Ga0453684_0002386 3300044712 Bacteria 45826
318 Ga0453684_0004226 3300044712 Bacteria 30795
319 Ga0453684_0010758 3300044712 Bacteria 15539
320 Ga0453684_0012581 3300044712 Bacteria 13925
321 Ga0453684_0014570 3300044712 Bacteria 12555
322 Ga0453684_0018024 3300044712 Bacteria 10871
323 Ga0453684_0022329 3300044712 Bacteria 9394
324 Ga0453684_0023712 3300044712 Bacteria 9014
325 Ga0453684_0044199 3300044712 Bacteria 5968
326 Ga0453684_0058214 3300044712 Bacteria 4993
327 Ga0453684_0072732 3300044712 Bacteria 4338
328 Ga0453684_0098443 3300044712 Bacteria 3585
329 Ga0453684_0120292 3300044712 Bacteria 3172
330 Ga0453684_0149751 3300044712 Bacteria 2774
331 Ga0453684_0168607 3300044712 Bacteria 2582
332 Ga0453684_0187591 3300044712 Bacteria 2421
333 Ga0453684_0199780 3300044712 Bacteria 2331
334 Ga0453684_0250687 3300044712 Bacteria 2033
335 Ga0453684_0322073 3300044712 Unclassified 1750
336 Ga0453684_0375999 3300044712 Bacteria 1596
337 Ga0453684_0472163 3300044712 Bacteria 1393
338 Ga0453684_0681084 3300044712 Bacteria 1119
339 Ga0453684_0725997 3300044712 Bacteria 1077
340 Ga0453684_1936874 3300044712 Bacteria 595
341 Ga0453684_2214541 3300044712 Bacteria 548
342 Ga0453684_2304211 3300044712 Bacteria 535
343 Ga0451576_0000303 3300045051 Bacteria 119347
344 Ga0451576_0002682 3300045051 Bacteria 25918
345 Ga0451576_0003254 3300045051 Bacteria 22530
346 Ga0451576_0018762 3300045051 Bacteria 7564
347 Ga0451576_0042237 3300045051 Bacteria 4814
348 Ga0451576_0043831 3300045051 Bacteria 4719
349 Ga0451576_0062713 3300045051 Bacteria 3875
350 Ga0451576_0117799 3300045051 Bacteria 2765
351 Ga0451576_0150441 3300045051 Bacteria 2428
352 Ga0451576_0156599 3300045051 Bacteria 2376
353 Ga0451576_0205827 3300045051 Bacteria 2055
354 Ga0451576_0246543 3300045051 Bacteria 1867
355 Ga0451576_0297974 3300045051 Bacteria 1686
356 Ga0451576_0304431 3300045051 Bacteria 1667
357 Ga0451576_0441201 3300045051 Bacteria 1366
358 Ga0451576_0463643 3300045051 Bacteria 1330
359 Ga0451576_0600709 3300045051 Bacteria 1156
360 Ga0451576_0610053 3300045051 Bacteria 1147
361 Ga0451576_0890415 3300045051 Bacteria 934
362 Ga0451576_0976953 3300045051 Bacteria 888
363 Ga0451576_1205331 3300045051 Bacteria 790
364 Ga0451576_1266413 3300045051 Bacteria 769
365 Ga0451576_1465437 3300045051 Bacteria 709
366 Ga0451576_1524791 3300045051 Bacteria 694
367 Ga0451576_2547845 3300045051 Bacteria 522
368 Ga0495639_0445751 3300046475 Bacteria 657
369 Ga0495606_0408003 3300046507 Bacteria 706
370 Ga0495644_0221739 3300046523 Unclassified 731
371 Ga0495663_0075972 3300046525 Bacteria 1076
372 Ga0495642_0227139 3300046528 Unclassified 815
373 Ga0495598_0009203 3300046537 Bacteria 2327
374 Ga0495598_0402985 3300046537 Bacteria 535
375 Ga0495621_0020976 3300046539 Bacteria 2150
376 Ga0495621_0065263 3300046539 Bacteria 1330
377 Ga0495622_0522153 3300046557 Bacteria 507
378 Ga0495656_0000017 3300046615 Bacteria 121976
379 Ga0495658_0492648 3300046683 Bacteria 784
380 Ga0495669_0345691 3300046684 Unclassified 719
381 Ga0495604_0169698 3300047317 Bacteria 1536
382 Ga0495636_0038442 3300047318 Bacteria 1980
383 Ga0495636_0252289 3300047318 Bacteria 816
384 Ga0495636_0670658 3300047318 Bacteria 510
385 Ga0495677_0198860 3300047445 Unclassified 779
386 Ga0495615_0038452 3300048090 Bacteria 1183
387 Ga0495615_0076649 3300048090 Bacteria 910
388 Ga0496101_0202221 3300048904 Bacteria 1536
389 Ga0496102_1423774 3300048905 Bacteria 612
390 Ga0496110_0389240 3300048913 Unclassified 1271
391 Ga0496111_0582119 3300048914 Bacteria 820
392 Ga0496112_0041441 3300048915 Bacteria 4506
393 Ga0496113_0398671 3300048916 Bacteria 1105
394 Ga0501034_0279795 3300049571 Bacteria 1608
395 Ga0501034_0795461 3300049571 Bacteria 839
396 Ga0501034_1589164 3300049571 Bacteria 527
397 Ga0501068_0090973 3300049584 Bacteria 1883
398 Ga0501071_0800179 3300049587 Bacteria 727
399 Ga0501076_0765279 3300049592 Bacteria 797
400 Ga0501044_0995721 3300049823 Bacteria 710
401 nmdc:mga05p37_119906_c1 3300050507 Bacteria 3232
402 nmdc:mga05p37_1515570_c1 3300050507 Bacteria 667
403 nmdc:mga05p37_475500_c1 3300050507 Bacteria 1441
404 nmdc:mga0qj67_145091_c1 3300050509 Bacteria 1924
405 nmdc:mga0qj67_789213_c1 3300050509 Bacteria 752
406 nmdc:mga06r32_1178273_c1 3300050510 Bacteria 713
407 nmdc:mga06r32_38358_c1 3300050510 Bacteria 4539
408 nmdc:mga06r32_463257_c1 3300050510 Bacteria 1246
409 nmdc:mga06r32_698871_c1 3300050510 Bacteria 980
410 nmdc:mga0n895_1180009_c1 3300050512 Bacteria 740
411 nmdc:mga0n895_133176_c1 3300050512 Bacteria 2512
412 nmdc:mga0n895_1944162_c1 3300050512 Bacteria 547
413 nmdc:mga0n895_21697_c1 3300050512 Bacteria 6010
414 nmdc:mga0n895_226305_c1 3300050512 Bacteria 1899
415 nmdc:mga0n895_3234_c1 3300050512 Bacteria 13055
416 nmdc:mga0n895_386174_c1 3300050512 Bacteria 1416
417 nmdc:mga0n895_52641_c1 3300050512 Bacteria 3997
418 nmdc:mga0rr50_1002451_c1 3300050513 Bacteria 712
419 nmdc:mga0rr50_132016_c1 3300050513 Bacteria 2001
420 nmdc:mga0rr50_146591_c1 3300050513 Bacteria 1904
421 nmdc:mga0rr50_1677859_c1 3300050513 Bacteria 536
422 nmdc:mga0rr50_276453_c1 3300050513 Bacteria 1401
423 nmdc:mga0rr50_40716_c1 3300050513 Bacteria 3380
424 nmdc:mga0rr50_527794_c1 3300050513 Bacteria 1005
425 nmdc:mga0rr50_53414_c1 3300050513 Bacteria 3006
426 nmdc:mga08x19_106249_c1 3300050514 Bacteria 1868
427 nmdc:mga08x19_108161_c1 3300050514 Bacteria 1852
428 nmdc:mga08x19_1185667_c1 3300050514 Bacteria 541
429 nmdc:mga08x19_159446_c1 3300050514 Bacteria 1532
430 nmdc:mga08x19_170353_c1 3300050514 Bacteria 1483
431 nmdc:mga08x19_17199_c1 3300050514 Bacteria 4421
432 nmdc:mga08x19_251389_c1 3300050514 Bacteria 1220
433 nmdc:mga08x19_47965_c1 3300050514 Bacteria 2735
434 nmdc:mga08x19_627816_c1 3300050514 Bacteria 762
435 nmdc:mga08x19_90347_c1 3300050514 Bacteria 2021
436 nmdc:mga08x19_91899_c1 3300050514 Bacteria 2004
437 nmdc:mga0a205_112266_c1 3300050515 Bacteria 2625
438 nmdc:mga0a205_429358_c1 3300050515 Bacteria 1183
439 nmdc:mga0a205_77592_c1 3300050515 Bacteria 3210
440 nmdc:mga0a205_823_c1 3300050515 Bacteria 25240
441 Ga0500639_105220 3300053163 Bacteria 1382
442 Ga0500567_206002 3300053723 Bacteria 648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038726 Ga0400490_02528 Ga0400490_02528_174_476 98
2 3300038741 Ga0400488_54121 Ga0400488_54121_998_1300 98
3 3300039110 Ga0400487_66491 Ga0400487_66491_1536_1838 98
4 3300044712 Ga0453684_2214541 Ga0453684_2214541_121_465 99
5 3300048914 Ga0496111_0582119 Ga0496111_0582119_411_755 99
6 3300005445 Ga0070708_100123418 Ga0070708_1001234183 109
7 3300006846 Ga0075430_101710854 Ga0075430_1017108541 109
8 3300010159 Ga0099796_10222393 Ga0099796_102223932 109
9 3300041494 Ga0451837_0839968 Ga0451837_0839968_485_814 109
10 3300042876 Ga0451577_0084759 Ga0451577_0084759_896_1240 109
11 3300045051 Ga0451576_2547845 Ga0451576_2547845_41_385 109
12 3300033524 Ga0316592_1015698 Ga0316592_10156983 112
13 3300036647 Ga0316582_0048546 Ga0316582_0048546_1161_1517 112
14 3300036712 Ga0316584_0199920 Ga0316584_0199920_239_595 112
15 iso_pu_bacteria 2617270889 2617913249 113
16 iso_pu_bacteria 2738541299 2738838278 113
17 iso_pu_bacteria 2831426010 2831431307 113
18 iso_pu_bacteria 2848694841 2848699625 113
19 iso_pu_bacteria 2849660919 2849668072 113
20 iso_pu_bacteria 2886627955 2886629831 113
21 iso_pu_bacteria 2913844669 2913845305 113
22 iso_pu_bacteria 2913939268 2913942375 113
23 iso_pu_bacteria 3006969106 3006971926 113
24 iso_pu_bacteria 642555144 642603893 113
25 iso_pu_bacteria 8002317523 8002324610 113
26 iso_pu_bacteria 8046991243 8046991760 113
27 3300028800 Ga0265338_10423252 Ga0265338_104232521 114
28 3300035398 Ga0316574_0532025 Ga0316574_0532025_327_674 114
29 3300035398 Ga0316574_0852460 Ga0316574_0852460_42_389 114
30 3300042876 Ga0451577_0965553 Ga0451577_0965553_256_600 114
31 3300046537 Ga0495598_0009203 Ga0495598_0009203_109_453 114
32 3300046537 Ga0495598_0402985 Ga0495598_0402985_144_488 114
33 3300046539 Ga0495621_0065263 Ga0495621_0065263_175_519 114
34 3300047318 Ga0495636_0038442 Ga0495636_0038442_1170_1514 114
35 3300048090 Ga0495615_0038452 Ga0495615_0038452_641_985 114
36 3300048913 Ga0496110_0389240 Ga0496110_0389240_294_638 114
37 3300049571 Ga0501034_1589164 Ga0501034_1589164_58_402 114
38 3300049823 Ga0501044_0995721 Ga0501044_0995721_227_571 114
39 3300005455 Ga0070663_100700751 Ga0070663_1007007512 115
40 3300005467 Ga0070706_100003511 Ga0070706_1000035119 115
41 3300031733 Ga0316577_10070922 Ga0316577_100709223 115
42 3300031733 Ga0316577_10208218 Ga0316577_102082182 115
43 3300031733 Ga0316577_10515869 Ga0316577_105158691 115
44 3300032168 Ga0316593_10048381 Ga0316593_100483811 115
45 3300032168 Ga0316593_10051776 Ga0316593_100517763 115
46 3300032168 Ga0316593_10052750 Ga0316593_100527502 115
47 3300032168 Ga0316593_10083893 Ga0316593_100838933 115
48 3300033541 Ga0316596_1029358 Ga0316596_10293583 115
49 3300033541 Ga0316596_1031283 Ga0316596_10312833 115
50 3300033541 Ga0316596_1035844 Ga0316596_10358441 115
51 3300036647 Ga0316582_0634284 Ga0316582_0634284_287_634 115
52 3300036712 Ga0316584_0064252 Ga0316584_0064252_401_748 115
53 3300036712 Ga0316584_0538047 Ga0316584_0538047_236_583 115
54 3300042876 Ga0451577_0204370 Ga0451577_0204370_440_787 115
55 3300046615 Ga0495656_0000017 Ga0495656_0000017_109864_110211 115
56 3300048090 Ga0495615_0076649 Ga0495615_0076649_396_743 115
57 3300048904 Ga0496101_0202221 Ga0496101_0202221_105_452 115
58 3300048905 Ga0496102_1423774 Ga0496102_1423774_122_469 115
59 3300048915 Ga0496112_0041441 Ga0496112_0041441_4111_4458 115
60 3300048916 Ga0496113_0398671 Ga0496113_0398671_429_776 115
61 3300031727 Ga0316576_10827913 Ga0316576_108279131 116
62 3300031727 Ga0316576_10845368 Ga0316576_108453682 116
63 3300031728 Ga0316578_10378048 Ga0316578_103780482 116
64 3300032139 Ga0316580_10279028 Ga0316580_102790281 116
65 3300032168 Ga0316593_10004513 Ga0316593_100045136 116
66 3300032168 Ga0316593_10022482 Ga0316593_100224824 116
67 3300032168 Ga0316593_10047563 Ga0316593_100475633 116
68 3300032168 Ga0316593_10093080 Ga0316593_100930802 116
69 3300032168 Ga0316593_10165215 Ga0316593_101652152 116
70 3300032168 Ga0316593_10215056 Ga0316593_102150562 116
71 3300033524 Ga0316592_1008478 Ga0316592_10084782 116
72 3300033524 Ga0316592_1039549 Ga0316592_10395492 116
73 3300033528 Ga0316588_1020653 Ga0316588_10206532 116
74 3300033528 Ga0316588_1035338 Ga0316588_10353382 116
75 3300033529 Ga0316587_1004138 Ga0316587_10041383 116
76 3300033541 Ga0316596_1001565 Ga0316596_10015653 116
77 3300033541 Ga0316596_1023730 Ga0316596_10237301 116
78 3300033541 Ga0316596_1076711 Ga0316596_10767112 116
79 3300033541 Ga0316596_1087554 Ga0316596_10875542 116
80 3300038725 Ga0400484_27126 Ga0400484_27126_733_1083 116
81 3300039062 Ga0400483_025368 Ga0400483_025368_524_874 116
82 3300039062 Ga0400483_130835 Ga0400483_130835_200_550 116
83 3300039062 Ga0400483_236848 Ga0400483_236848_575_925 116
84 3300039093 Ga0400489_18718 Ga0400489_18718_5368_5718 116
85 3300039093 Ga0400489_29617 Ga0400489_29617_620_970 116
86 3300042876 Ga0451577_0005950 Ga0451577_0005950_6551_6901 116
87 3300042876 Ga0451577_0555635 Ga0451577_0555635_549_899 116
88 3300044673 Ga0453683_0553790 Ga0453683_0553790_264_614 116
89 3300044712 Ga0453684_0014570 Ga0453684_0014570_6550_6900 116
90 3300045051 Ga0451576_0205827 Ga0451576_0205827_473_823 116
91 3300046557 Ga0495622_0522153 Ga0495622_0522153_77_427 116
92 3300005289 Ga0065704_10487266 Ga0065704_104872661 117
93 3300005295 Ga0065707_10001702 Ga0065707_100017024 117
94 3300005295 Ga0065707_10128557 Ga0065707_101285574 117
95 3300005295 Ga0065707_10603304 Ga0065707_106033041 117
96 3300005336 Ga0070680_100085827 Ga0070680_1000858275 117
97 3300005336 Ga0070680_100398548 Ga0070680_1003985482 117
98 3300005341 Ga0070691_10561081 Ga0070691_105610812 117
99 3300005343 Ga0070687_100035538 Ga0070687_1000355383 117
100 3300005345 Ga0070692_10034063 Ga0070692_100340631 117
101 3300005406 Ga0070703_10010620 Ga0070703_100106204 117
102 3300005406 Ga0070703_10010689 Ga0070703_100106892 117
103 3300005406 Ga0070703_10085390 Ga0070703_100853902 117
104 3300005406 Ga0070703_10350852 Ga0070703_103508522 117
105 3300005434 Ga0070709_10002412 Ga0070709_100024126 117
106 3300005434 Ga0070709_10057272 Ga0070709_100572722 117
107 3300005434 Ga0070709_10146828 Ga0070709_101468281 117
108 3300005435 Ga0070714_100120869 Ga0070714_1001208693 117
109 3300005436 Ga0070713_100141639 Ga0070713_1001416392 117
110 3300005436 Ga0070713_100247215 Ga0070713_1002472152 117
111 3300005438 Ga0070701_10001843 Ga0070701_100018434 117
112 3300005439 Ga0070711_100000466 Ga0070711_10000046616 117
113 3300005440 Ga0070705_100072691 Ga0070705_1000726912 117
114 3300005440 Ga0070705_100214555 Ga0070705_1002145552 117
115 3300005440 Ga0070705_100485500 Ga0070705_1004855002 117
116 3300005440 Ga0070705_100521768 Ga0070705_1005217682 117
117 3300005441 Ga0070700_100144922 Ga0070700_1001449222 117
118 3300005444 Ga0070694_100003097 Ga0070694_1000030974 117
119 3300005444 Ga0070694_100035006 Ga0070694_1000350065 117
120 3300005444 Ga0070694_100096351 Ga0070694_1000963512 117
121 3300005444 Ga0070694_100480803 Ga0070694_1004808033 117
122 3300005444 Ga0070694_100690138 Ga0070694_1006901383 117
123 3300005444 Ga0070694_100762708 Ga0070694_1007627081 117
124 3300005444 Ga0070694_101944288 Ga0070694_1019442881 117
125 3300005445 Ga0070708_100001912 Ga0070708_1000019126 117
126 3300005445 Ga0070708_100042312 Ga0070708_1000423123 117
127 3300005445 Ga0070708_100107478 Ga0070708_1001074782 117
128 3300005445 Ga0070708_100211359 Ga0070708_1002113593 117
129 3300005445 Ga0070708_100311951 Ga0070708_1003119512 117
130 3300005445 Ga0070708_100365274 Ga0070708_1003652742 117
131 3300005445 Ga0070708_100974059 Ga0070708_1009740592 117
132 3300005445 Ga0070708_101485594 Ga0070708_1014855941 117
133 3300005459 Ga0068867_100232782 Ga0068867_1002327823 117
134 3300005467 Ga0070706_100007900 Ga0070706_1000079003 117
135 3300005467 Ga0070706_100027110 Ga0070706_1000271106 117
136 3300005467 Ga0070706_100034131 Ga0070706_1000341314 117
137 3300005467 Ga0070706_100139786 Ga0070706_1001397863 117
138 3300005467 Ga0070706_100548439 Ga0070706_1005484393 117
139 3300005468 Ga0070707_100044232 Ga0070707_1000442326 117
140 3300005468 Ga0070707_100060977 Ga0070707_1000609773 117
141 3300005468 Ga0070707_100072874 Ga0070707_1000728742 117
142 3300005468 Ga0070707_100117207 Ga0070707_1001172072 117
143 3300005468 Ga0070707_100438943 Ga0070707_1004389433 117
144 3300005468 Ga0070707_100449342 Ga0070707_1004493422 117
145 3300005468 Ga0070707_100878867 Ga0070707_1008788672 117
146 3300005468 Ga0070707_100958796 Ga0070707_1009587962 117
147 3300005468 Ga0070707_101835444 Ga0070707_1018354442 117
148 3300005471 Ga0070698_100000416 Ga0070698_10000041611 117
149 3300005471 Ga0070698_100048093 Ga0070698_1000480933 117
150 3300005471 Ga0070698_100296885 Ga0070698_1002968853 117
151 3300005471 Ga0070698_100304400 Ga0070698_1003044002 117
152 3300005518 Ga0070699_100010664 Ga0070699_1000106642 117
153 3300005518 Ga0070699_100013305 Ga0070699_1000133051 117
154 3300005518 Ga0070699_100042082 Ga0070699_1000420823 117
155 3300005518 Ga0070699_100054171 Ga0070699_1000541713 117
156 3300005518 Ga0070699_100167452 Ga0070699_1001674524 117
157 3300005518 Ga0070699_100173212 Ga0070699_1001732122 117
158 3300005518 Ga0070699_100344020 Ga0070699_1003440203 117
159 3300005518 Ga0070699_100480363 Ga0070699_1004803632 117
160 3300005530 Ga0070679_100442343 Ga0070679_1004423432 117
161 3300005536 Ga0070697_100049685 Ga0070697_1000496852 117
162 3300005536 Ga0070697_100240511 Ga0070697_1002405112 117
163 3300005536 Ga0070697_100342187 Ga0070697_1003421872 117
164 3300005545 Ga0070695_100028089 Ga0070695_1000280893 117
165 3300005545 Ga0070695_100035587 Ga0070695_1000355876 117
166 3300005545 Ga0070695_100104886 Ga0070695_1001048862 117
167 3300005546 Ga0070696_100071808 Ga0070696_1000718082 117
168 3300005546 Ga0070696_100138800 Ga0070696_1001388003 117
169 3300005546 Ga0070696_100331658 Ga0070696_1003316582 117
170 3300005546 Ga0070696_100338390 Ga0070696_1003383902 117
171 3300005546 Ga0070696_100538865 Ga0070696_1005388652 117
172 3300005546 Ga0070696_101276059 Ga0070696_1012760592 117
173 3300005546 Ga0070696_101893209 Ga0070696_1018932091 117
174 3300005547 Ga0070693_100299299 Ga0070693_1002992992 117
175 3300005549 Ga0070704_100007259 Ga0070704_1000072592 117
176 3300005549 Ga0070704_100192752 Ga0070704_1001927523 117
177 3300005549 Ga0070704_100282679 Ga0070704_1002826792 117
178 3300005549 Ga0070704_100345991 Ga0070704_1003459913 117
179 3300005549 Ga0070704_101497885 Ga0070704_1014978851 117
180 3300005615 Ga0070702_100227511 Ga0070702_1002275111 117
181 3300005615 Ga0070702_100378911 Ga0070702_1003789113 117
182 3300005719 Ga0068861_100593766 Ga0068861_1005937663 117
183 3300006163 Ga0070715_10234621 Ga0070715_102346212 117
184 3300006173 Ga0070716_100000833 Ga0070716_1000008338 117
185 3300006175 Ga0070712_100845247 Ga0070712_1008452472 117
186 3300006844 Ga0075428_100072133 Ga0075428_1000721333 117
187 3300006844 Ga0075428_100708033 Ga0075428_1007080332 117
188 3300006844 Ga0075428_101472602 Ga0075428_1014726022 117
189 3300006846 Ga0075430_100415956 Ga0075430_1004159562 117
190 3300006847 Ga0075431_100161292 Ga0075431_1001612924 117
191 3300006847 Ga0075431_100304256 Ga0075431_1003042562 117
192 3300006852 Ga0075433_10000946 Ga0075433_1000094612 117
193 3300006852 Ga0075433_10012213 Ga0075433_100122137 117
194 3300006852 Ga0075433_10207593 Ga0075433_102075931 117
195 3300006852 Ga0075433_10222011 Ga0075433_102220112 117
196 3300006852 Ga0075433_10547301 Ga0075433_105473012 117
197 3300006852 Ga0075433_10671142 Ga0075433_106711422 117
198 3300006871 Ga0075434_100017892 Ga0075434_1000178923 117
199 3300006871 Ga0075434_100063169 Ga0075434_1000631692 117
200 3300006871 Ga0075434_100110214 Ga0075434_1001102142 117
201 3300006871 Ga0075434_100316051 Ga0075434_1003160514 117
202 3300006871 Ga0075434_100342334 Ga0075434_1003423342 117
203 3300006871 Ga0075434_100378950 Ga0075434_1003789502 117
204 3300006871 Ga0075434_100421663 Ga0075434_1004216632 117
205 3300006871 Ga0075434_100661839 Ga0075434_1006618392 117
206 3300006914 Ga0075436_100000724 Ga0075436_10000072416 117
207 3300006914 Ga0075436_100020245 Ga0075436_1000202451 117
208 3300006914 Ga0075436_100021129 Ga0075436_1000211295 117
209 3300006914 Ga0075436_100048460 Ga0075436_1000484603 117
210 3300006914 Ga0075436_100128836 Ga0075436_1001288363 117
211 3300006914 Ga0075436_100305135 Ga0075436_1003051353 117
212 3300006914 Ga0075436_100592009 Ga0075436_1005920092 117
213 3300007076 Ga0075435_100027526 Ga0075435_1000275265 117
214 3300007076 Ga0075435_100042270 Ga0075435_1000422705 117
215 3300007076 Ga0075435_100063230 Ga0075435_1000632303 117
216 3300007076 Ga0075435_100127538 Ga0075435_1001275383 117
217 3300007076 Ga0075435_100415931 Ga0075435_1004159312 117
218 3300007076 Ga0075435_100800048 Ga0075435_1008000483 117
219 3300007265 Ga0099794_10019423 Ga0099794_100194234 117
220 3300007265 Ga0099794_10042505 Ga0099794_100425053 117
221 3300007265 Ga0099794_10138625 Ga0099794_101386252 117
222 3300007265 Ga0099794_10168218 Ga0099794_101682183 117
223 3300007265 Ga0099794_10223949 Ga0099794_102239492 117
224 3300007265 Ga0099794_10318714 Ga0099794_103187142 117
225 3300007788 Ga0099795_10074263 Ga0099795_100742633 117
226 3300007788 Ga0099795_10331361 Ga0099795_103313611 117
227 3300009011 Ga0105251_10505974 Ga0105251_105059741 117
228 3300009094 Ga0111539_10521482 Ga0111539_105214823 117
229 3300009147 Ga0114129_10124105 Ga0114129_101241053 117
230 3300009147 Ga0114129_10353240 Ga0114129_103532402 117
231 3300009147 Ga0114129_10365044 Ga0114129_103650441 117
232 3300009176 Ga0105242_10608603 Ga0105242_106086033 117
233 3300009177 Ga0105248_11871847 Ga0105248_118718472 117
234 3300025225 Ga0209566_100113 Ga0209566_10011369 117
235 3300025885 Ga0207653_10000333 Ga0207653_1000033313 117
236 3300025885 Ga0207653_10010048 Ga0207653_100100483 117
237 3300025905 Ga0207685_10053815 Ga0207685_100538153 117
238 3300025905 Ga0207685_10176384 Ga0207685_101763842 117
239 3300025906 Ga0207699_10005787 Ga0207699_100057874 117
240 3300025906 Ga0207699_10046333 Ga0207699_100463333 117
241 3300025906 Ga0207699_10529162 Ga0207699_105291623 117
242 3300025910 Ga0207684_10012760 Ga0207684_100127603 117
243 3300025910 Ga0207684_10015791 Ga0207684_100157916 117
244 3300025910 Ga0207684_10119077 Ga0207684_101190772 117
245 3300025910 Ga0207684_10231720 Ga0207684_102317202 117
246 3300025910 Ga0207684_10491548 Ga0207684_104915483 117
247 3300025910 Ga0207684_10641265 Ga0207684_106412652 117
248 3300025910 Ga0207684_10963548 Ga0207684_109635482 117
249 3300025915 Ga0207693_10304141 Ga0207693_103041412 117
250 3300025916 Ga0207663_10000556 Ga0207663_1000055616 117
251 3300025917 Ga0207660_10104525 Ga0207660_101045253 117
252 3300025917 Ga0207660_10139308 Ga0207660_101393083 117
253 3300025917 Ga0207660_10194805 Ga0207660_101948052 117
254 3300025918 Ga0207662_10032449 Ga0207662_100324494 117
255 3300025921 Ga0207652_10418293 Ga0207652_104182933 117
256 3300025922 Ga0207646_10004203 Ga0207646_1000420313 117
257 3300025922 Ga0207646_10021064 Ga0207646_100210642 117
258 3300025922 Ga0207646_10096705 Ga0207646_100967054 117
259 3300025922 Ga0207646_10163732 Ga0207646_101637324 117
260 3300025922 Ga0207646_10334028 Ga0207646_103340282 117
261 3300025922 Ga0207646_10359763 Ga0207646_103597632 117
262 3300025922 Ga0207646_10462778 Ga0207646_104627782 117
263 3300025922 Ga0207646_11036349 Ga0207646_110363492 117
264 3300025928 Ga0207700_10315062 Ga0207700_103150623 117
265 3300025928 Ga0207700_10537536 Ga0207700_105375363 117
266 3300025929 Ga0207664_10425967 Ga0207664_104259672 117
267 3300025934 Ga0207686_10735040 Ga0207686_107350403 117
268 3300025936 Ga0207670_10435867 Ga0207670_104358672 117
269 3300025939 Ga0207665_10001273 Ga0207665_1000127313 117
270 3300026075 Ga0207708_10034526 Ga0207708_100345264 117
271 3300026089 Ga0207648_10803701 Ga0207648_108037013 117
272 3300026118 Ga0207675_100610362 Ga0207675_1006103622 117
273 3300027671 Ga0209588_1001900 Ga0209588_10019003 117
274 3300027671 Ga0209588_1004374 Ga0209588_10043743 117
275 3300027671 Ga0209588_1115643 Ga0209588_11156432 117
276 3300027671 Ga0209588_1185906 Ga0209588_11859062 117
277 3300028381 Ga0268264_11738946 Ga0268264_117389461 117
278 3300029957 Ga0265324_10179974 Ga0265324_101799741 117
279 3300031251 Ga0265327_10117854 Ga0265327_101178542 117
280 3300031251 Ga0265327_10249992 Ga0265327_102499922 117
281 3300031344 Ga0265316_10413675 Ga0265316_104136752 117
282 3300031507 Ga0307509_10455043 Ga0307509_104550432 117
283 3300031727 Ga0316576_10010664 Ga0316576_100106645 117
284 3300031727 Ga0316576_10154617 Ga0316576_101546172 117
285 3300031727 Ga0316576_10582226 Ga0316576_105822262 117
286 3300031728 Ga0316578_10289941 Ga0316578_102899412 117
287 3300032139 Ga0316580_10217832 Ga0316580_102178321 117
288 3300032168 Ga0316593_10089570 Ga0316593_100895703 117
289 3300033524 Ga0316592_1001236 Ga0316592_10012362 117
290 3300033524 Ga0316592_1002387 Ga0316592_10023872 117
291 3300033524 Ga0316592_1018789 Ga0316592_10187893 117
292 3300033524 Ga0316592_1034129 Ga0316592_10341293 117
293 3300033524 Ga0316592_1113073 Ga0316592_11130731 117
294 3300033527 Ga0316586_1030656 Ga0316586_10306562 117
295 3300033528 Ga0316588_1009326 Ga0316588_10093264 117
296 3300033528 Ga0316588_1082844 Ga0316588_10828442 117
297 3300033528 Ga0316588_1151084 Ga0316588_11510842 117
298 3300033541 Ga0316596_1000599 Ga0316596_10005996 117
299 3300033541 Ga0316596_1013933 Ga0316596_10139333 117
300 3300033541 Ga0316596_1020637 Ga0316596_10206372 117
301 3300033541 Ga0316596_1028088 Ga0316596_10280883 117
302 3300035112 Ga0373932_0079127 Ga0373932_0079127_228_581 117
303 3300035117 Ga0373953_0220421 Ga0373953_0220421_349_702 117
304 3300035118 Ga0373954_0482314 Ga0373954_0482314_93_446 117
305 3300035118 Ga0373954_0696110 Ga0373954_0696110_128_481 117
306 3300035119 Ga0373956_0247342 Ga0373956_0247342_93_446 117
307 3300035398 Ga0316574_0008420 Ga0316574_0008420_4508_4864 117
308 3300035398 Ga0316574_0045215 Ga0316574_0045215_1351_1707 117
309 3300035398 Ga0316574_0286529 Ga0316574_0286529_369_725 117
310 3300035398 Ga0316574_0727424 Ga0316574_0727424_24_380 117
311 3300035724 Ga0373933_0224128 Ga0373933_0224128_300_653 117
312 3300036401 Ga0373937_0465758 Ga0373937_0465758_449_802 117
313 3300036647 Ga0316582_0136489 Ga0316582_0136489_48_404 117
314 3300038996 Ga0242420_018127 Ga0242420_018127_293_646 117
315 3300038996 Ga0242420_065021 Ga0242420_065021_354_707 117
316 3300039062 Ga0400483_047173 Ga0400483_047173_1017_1373 117
317 3300041456 Ga0451795_0977824 Ga0451795_0977824_138_491 117
318 3300042876 Ga0451577_0000035 Ga0451577_0000035_44168_44521 117
319 3300042876 Ga0451577_0001455 Ga0451577_0001455_19295_19648 117
320 3300042876 Ga0451577_0014478 Ga0451577_0014478_4799_5155 117
321 3300042876 Ga0451577_0019300 Ga0451577_0019300_5766_6119 117
322 3300042876 Ga0451577_0080646 Ga0451577_0080646_107_460 117
323 3300042876 Ga0451577_0134032 Ga0451577_0134032_530_883 117
324 3300042876 Ga0451577_0159139 Ga0451577_0159139_1197_1550 117
325 3300042876 Ga0451577_0331332 Ga0451577_0331332_52_405 117
326 3300042876 Ga0451577_0347994 Ga0451577_0347994_580_933 117
327 3300042876 Ga0451577_0388643 Ga0451577_0388643_339_692 117
328 3300042876 Ga0451577_0542091 Ga0451577_0542091_151_504 117
329 3300042876 Ga0451577_0747300 Ga0451577_0747300_74_427 117
330 3300042876 Ga0451577_1174854 Ga0451577_1174854_186_539 117
331 3300042876 Ga0451577_1801651 Ga0451577_1801651_45_398 117
332 3300044673 Ga0453683_0000002 Ga0453683_0000002_444537_444890 117
333 3300044673 Ga0453683_0000048 Ga0453683_0000048_142996_143349 117
334 3300044673 Ga0453683_0000058 Ga0453683_0000058_151584_151937 117
335 3300044673 Ga0453683_0000067 Ga0453683_0000067_8347_8700 117
336 3300044673 Ga0453683_0000236 Ga0453683_0000236_23787_24140 117
337 3300044673 Ga0453683_0001452 Ga0453683_0001452_8573_8926 117
338 3300044673 Ga0453683_0005568 Ga0453683_0005568_113_466 117
339 3300044673 Ga0453683_0071704 Ga0453683_0071704_629_982 117
340 3300044673 Ga0453683_0090358 Ga0453683_0090358_906_1259 117
341 3300044673 Ga0453683_0108030 Ga0453683_0108030_1036_1389 117
342 3300044673 Ga0453683_0138214 Ga0453683_0138214_677_1030 117
343 3300044673 Ga0453683_0156947 Ga0453683_0156947_123_479 117
344 3300044673 Ga0453683_0227008 Ga0453683_0227008_564_917 117
345 3300044673 Ga0453683_0392527 Ga0453683_0392527_30_383 117
346 3300044673 Ga0453683_1027339 Ga0453683_1027339_73_426 117
347 3300044712 Ga0453684_0000097 Ga0453684_0000097_44175_44528 117
348 3300044712 Ga0453684_0000209 Ga0453684_0000209_31537_31890 117
349 3300044712 Ga0453684_0002386 Ga0453684_0002386_16299_16652 117
350 3300044712 Ga0453684_0004226 Ga0453684_0004226_20454_20807 117
351 3300044712 Ga0453684_0010758 Ga0453684_0010758_226_579 117
352 3300044712 Ga0453684_0012581 Ga0453684_0012581_5358_5711 117
353 3300044712 Ga0453684_0018024 Ga0453684_0018024_10301_10654 117
354 3300044712 Ga0453684_0022329 Ga0453684_0022329_1227_1580 117
355 3300044712 Ga0453684_0023712 Ga0453684_0023712_5979_6332 117
356 3300044712 Ga0453684_0044199 Ga0453684_0044199_1610_1963 117
357 3300044712 Ga0453684_0058214 Ga0453684_0058214_3248_3601 117
358 3300044712 Ga0453684_0072732 Ga0453684_0072732_2845_3198 117
359 3300044712 Ga0453684_0098443 Ga0453684_0098443_2922_3275 117
360 3300044712 Ga0453684_0120292 Ga0453684_0120292_640_993 117
361 3300044712 Ga0453684_0149751 Ga0453684_0149751_1373_1726 117
362 3300044712 Ga0453684_0168607 Ga0453684_0168607_1471_1824 117
363 3300044712 Ga0453684_0187591 Ga0453684_0187591_847_1200 117
364 3300044712 Ga0453684_0199780 Ga0453684_0199780_1622_1978 117
365 3300044712 Ga0453684_0250687 Ga0453684_0250687_520_873 117
366 3300044712 Ga0453684_0322073 Ga0453684_0322073_1262_1618 117
367 3300044712 Ga0453684_0375999 Ga0453684_0375999_886_1239 117
368 3300044712 Ga0453684_0472163 Ga0453684_0472163_951_1304 117
369 3300044712 Ga0453684_0681084 Ga0453684_0681084_388_744 117
370 3300044712 Ga0453684_0725997 Ga0453684_0725997_460_813 117
371 3300044712 Ga0453684_1936874 Ga0453684_1936874_219_572 117
372 3300044712 Ga0453684_2304211 Ga0453684_2304211_48_401 117
373 3300045051 Ga0451576_0000303 Ga0451576_0000303_84594_84947 117
374 3300045051 Ga0451576_0002682 Ga0451576_0002682_20565_20918 117
375 3300045051 Ga0451576_0003254 Ga0451576_0003254_505_858 117
376 3300045051 Ga0451576_0018762 Ga0451576_0018762_6549_6908 117
377 3300045051 Ga0451576_0042237 Ga0451576_0042237_4032_4385 117
378 3300045051 Ga0451576_0043831 Ga0451576_0043831_39_392 117
379 3300045051 Ga0451576_0062713 Ga0451576_0062713_3446_3799 117
380 3300045051 Ga0451576_0117799 Ga0451576_0117799_88_441 117
381 3300045051 Ga0451576_0150441 Ga0451576_0150441_631_984 117
382 3300045051 Ga0451576_0156599 Ga0451576_0156599_275_628 117
383 3300045051 Ga0451576_0246543 Ga0451576_0246543_883_1236 117
384 3300045051 Ga0451576_0297974 Ga0451576_0297974_724_1077 117
385 3300045051 Ga0451576_0304431 Ga0451576_0304431_270_623 117
386 3300045051 Ga0451576_0441201 Ga0451576_0441201_165_518 117
387 3300045051 Ga0451576_0463643 Ga0451576_0463643_374_727 117
388 3300045051 Ga0451576_0600709 Ga0451576_0600709_191_544 117
389 3300045051 Ga0451576_0610053 Ga0451576_0610053_195_548 117
390 3300045051 Ga0451576_0890415 Ga0451576_0890415_469_822 117
391 3300045051 Ga0451576_0976953 Ga0451576_0976953_84_437 117
392 3300045051 Ga0451576_1205331 Ga0451576_1205331_414_767 117
393 3300045051 Ga0451576_1266413 Ga0451576_1266413_288_641 117
394 3300045051 Ga0451576_1465437 Ga0451576_1465437_161_514 117
395 3300045051 Ga0451576_1524791 Ga0451576_1524791_227_580 117
396 3300046475 Ga0495639_0445751 Ga0495639_0445751_136_489 117
397 3300046507 Ga0495606_0408003 Ga0495606_0408003_249_608 117
398 3300046523 Ga0495644_0221739 Ga0495644_0221739_163_522 117
399 3300046525 Ga0495663_0075972 Ga0495663_0075972_508_861 117
400 3300046528 Ga0495642_0227139 Ga0495642_0227139_339_692 117
401 3300046539 Ga0495621_0020976 Ga0495621_0020976_857_1210 117
402 3300046683 Ga0495658_0492648 Ga0495658_0492648_117_470 117
403 3300046684 Ga0495669_0345691 Ga0495669_0345691_330_689 117
404 3300047317 Ga0495604_0169698 Ga0495604_0169698_494_847 117
405 3300047318 Ga0495636_0252289 Ga0495636_0252289_335_688 117
406 3300047318 Ga0495636_0670658 Ga0495636_0670658_100_459 117
407 3300047445 Ga0495677_0198860 Ga0495677_0198860_35_394 117
408 3300049571 Ga0501034_0279795 Ga0501034_0279795_1160_1513 117
409 3300049571 Ga0501034_0795461 Ga0501034_0795461_386_739 117
410 3300049584 Ga0501068_0090973 Ga0501068_0090973_974_1327 117
411 3300049587 Ga0501071_0800179 Ga0501071_0800179_48_407 117
412 3300049592 Ga0501076_0765279 Ga0501076_0765279_410_769 117
413 3300050507 nmdc:mga05p37_119906_c1 nmdc:mga05p37_119906_c1_624_977 117
414 3300050507 nmdc:mga05p37_1515570_c1 nmdc:mga05p37_1515570_c1_187_540 117
415 3300050507 nmdc:mga05p37_475500_c1 nmdc:mga05p37_475500_c1_50_403 117
416 3300050509 nmdc:mga0qj67_145091_c1 nmdc:mga0qj67_145091_c1_695_1048 117
417 3300050509 nmdc:mga0qj67_789213_c1 nmdc:mga0qj67_789213_c1_314_667 117
418 3300050510 nmdc:mga06r32_1178273_c1 nmdc:mga06r32_1178273_c1_216_575 117
419 3300050510 nmdc:mga06r32_38358_c1 nmdc:mga06r32_38358_c1_1190_1543 117
420 3300050510 nmdc:mga06r32_463257_c1 nmdc:mga06r32_463257_c1_840_1193 117
421 3300050510 nmdc:mga06r32_698871_c1 nmdc:mga06r32_698871_c1_561_914 117
422 3300050512 nmdc:mga0n895_1180009_c1 nmdc:mga0n895_1180009_c1_266_619 117
423 3300050512 nmdc:mga0n895_133176_c1 nmdc:mga0n895_133176_c1_1186_1539 117
424 3300050512 nmdc:mga0n895_1944162_c1 nmdc:mga0n895_1944162_c1_17_370 117
425 3300050512 nmdc:mga0n895_21697_c1 nmdc:mga0n895_21697_c1_622_975 117
426 3300050512 nmdc:mga0n895_226305_c1 nmdc:mga0n895_226305_c1_328_681 117
427 3300050512 nmdc:mga0n895_3234_c1 nmdc:mga0n895_3234_c1_7164_7517 117
428 3300050512 nmdc:mga0n895_386174_c1 nmdc:mga0n895_386174_c1_371_724 117
429 3300050512 nmdc:mga0n895_52641_c1 nmdc:mga0n895_52641_c1_3424_3777 117
430 3300050513 nmdc:mga0rr50_1002451_c1 nmdc:mga0rr50_1002451_c1_26_379 117
431 3300050513 nmdc:mga0rr50_132016_c1 nmdc:mga0rr50_132016_c1_718_1071 117
432 3300050513 nmdc:mga0rr50_146591_c1 nmdc:mga0rr50_146591_c1_863_1216 117
433 3300050513 nmdc:mga0rr50_1677859_c1 nmdc:mga0rr50_1677859_c1_160_513 117
434 3300050513 nmdc:mga0rr50_276453_c1 nmdc:mga0rr50_276453_c1_27_380 117
435 3300050513 nmdc:mga0rr50_40716_c1 nmdc:mga0rr50_40716_c1_1379_1732 117
436 3300050513 nmdc:mga0rr50_527794_c1 nmdc:mga0rr50_527794_c1_470_823 117
437 3300050513 nmdc:mga0rr50_53414_c1 nmdc:mga0rr50_53414_c1_1674_2027 117
438 3300050514 nmdc:mga08x19_106249_c1 nmdc:mga08x19_106249_c1_1094_1447 117
439 3300050514 nmdc:mga08x19_108161_c1 nmdc:mga08x19_108161_c1_80_433 117
440 3300050514 nmdc:mga08x19_1185667_c1 nmdc:mga08x19_1185667_c1_59_412 117
441 3300050514 nmdc:mga08x19_159446_c1 nmdc:mga08x19_159446_c1_119_472 117
442 3300050514 nmdc:mga08x19_170353_c1 nmdc:mga08x19_170353_c1_48_401 117
443 3300050514 nmdc:mga08x19_17199_c1 nmdc:mga08x19_17199_c1_2597_2950 117
444 3300050514 nmdc:mga08x19_251389_c1 nmdc:mga08x19_251389_c1_792_1145 117
445 3300050514 nmdc:mga08x19_47965_c1 nmdc:mga08x19_47965_c1_1385_1738 117
446 3300050514 nmdc:mga08x19_627816_c1 nmdc:mga08x19_627816_c1_159_518 117
447 3300050514 nmdc:mga08x19_90347_c1 nmdc:mga08x19_90347_c1_194_547 117
448 3300050514 nmdc:mga08x19_91899_c1 nmdc:mga08x19_91899_c1_1132_1485 117
449 3300050515 nmdc:mga0a205_112266_c1 nmdc:mga0a205_112266_c1_1096_1449 117
450 3300050515 nmdc:mga0a205_429358_c1 nmdc:mga0a205_429358_c1_510_863 117
451 3300050515 nmdc:mga0a205_77592_c1 nmdc:mga0a205_77592_c1_2435_2788 117
452 3300050515 nmdc:mga0a205_823_c1 nmdc:mga0a205_823_c1_495_848 117
453 3300053163 Ga0500639_105220 Ga0500639_105220_896_1249 117
454 3300053723 Ga0500567_206002 Ga0500567_206002_243_596 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8784 51 117
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8577 61 116
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8559 51 117
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.7968 61 116
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.7876 14 114
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9589 53 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8964 58 116 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8786 53 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8577 61 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.7968 61 116 1.10.1900.20
ID Description Score Start End GO Terms
AF-W4LHU2-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.012 64 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6EM08-F1-model_v4 deleted 1.007 57 116
AF-A0A7X7PKE9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.007 60 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.006 61 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A354QTS7-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.005 53 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.22 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map