F447333

General Info

Members Datasets Scaffolds Average Seq Length
454 198 908 225

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10142711|Ga0070709_101427113
Length 255
Sequence MPASRDQGADGTIHPIAPADTAPENAPATADATPAAFAVDHAFHRPELLRQALTHRSYGSPNNERLEFVGDAVLDCVIALSLFERFPAMPEGDLSRARAHLVNRDTLAQVARRIGLADAVRLGEGEVRSGGAHRASILADALEAVFGAVFLDAGYDAARLAIEAAYADVLRDADPSVLGKDPKTRLQEWLQARRLPVPEYAIVGTTGEAHAQQFAVECRIADLGIVATGSGASRRVAEQDAALRAIEALKATPRG

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
163 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
164 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
165 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
166 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
167 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
168 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
169 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
170 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
171 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.32
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10142711 3300005434 Bacteria 1647
2 Ga0070658_10242418 3300005327 Bacteria 1528
3 Ga0070658_10397265 3300005327 Bacteria 1184
4 Ga0070676_10021807 3300005328 Bacteria 3587
5 Ga0070676_10052202 3300005328 Bacteria 2403
6 Ga0070676_10098884 3300005328 Bacteria 1799
7 Ga0070683_100016213 3300005329 Bacteria 6565
8 Ga0070683_100462332 3300005329 Bacteria 1211
9 Ga0070690_100228233 3300005330 Bacteria 1308
10 Ga0070670_100029222 3300005331 Bacteria 4743
11 Ga0070670_100062297 3300005331 Bacteria 3203
12 Ga0070670_100197936 3300005331 Bacteria 1745
13 Ga0070677_10084077 3300005333 Bacteria 1369
14 Ga0068869_100378868 3300005334 Bacteria 1159
15 Ga0070680_100122495 3300005336 Bacteria 2171
16 Ga0070680_100176671 3300005336 Bacteria 1798
17 Ga0070680_100326428 3300005336 Bacteria 1303
18 Ga0070680_100635660 3300005336 Bacteria 917
19 Ga0070682_100085981 3300005337 Bacteria 2047
20 Ga0070660_100008372 3300005339 Bacteria 7230
21 Ga0070660_100014412 3300005339 Bacteria 5693
22 Ga0070660_100036902 3300005339 Bacteria 3704
23 Ga0070660_100270163 3300005339 Bacteria 1390
24 Ga0070661_100001117 3300005344 Bacteria 18832
25 Ga0070661_100003926 3300005344 Bacteria 10231
26 Ga0070661_100009677 3300005344 Bacteria 6682
27 Ga0070661_100012543 3300005344 Bacteria 5930
28 Ga0070661_100024043 3300005344 Bacteria 4371
29 Ga0070661_100037958 3300005344 Bacteria 3506
30 Ga0070661_100076708 3300005344 Bacteria 2463
31 Ga0070692_10088618 3300005345 Bacteria 1679
32 Ga0070668_100014595 3300005347 Bacteria 5872
33 Ga0070668_100032341 3300005347 Bacteria 3981
34 Ga0070668_100145489 3300005347 Bacteria 1913
35 Ga0070669_100045023 3300005353 Bacteria 3215
36 Ga0070669_100147989 3300005353 Bacteria 1815
37 Ga0070669_100452651 3300005353 Bacteria 1058
38 Ga0070675_100007118 3300005354 Bacteria 8615
39 Ga0070671_100001808 3300005355 Bacteria 16265
40 Ga0070671_100001980 3300005355 Bacteria 15715
41 Ga0070671_100023636 3300005355 Bacteria 5031
42 Ga0070671_100084732 3300005355 Bacteria 2651
43 Ga0070671_100107618 3300005355 Bacteria 2341
44 Ga0070671_100128068 3300005355 Bacteria 2137
45 Ga0070671_100261634 3300005355 Bacteria 1470
46 Ga0070674_100003810 3300005356 Bacteria 8524
47 Ga0070674_100078623 3300005356 Bacteria 2351
48 Ga0070674_100237568 3300005356 Bacteria 1425
49 Ga0070673_100007452 3300005364 Bacteria 7217
50 Ga0070659_100010091 3300005366 Bacteria 6953
51 Ga0070659_100018311 3300005366 Bacteria 5285
52 Ga0070659_100025398 3300005366 Bacteria 4549
53 Ga0070659_100027022 3300005366 Bacteria 4418
54 Ga0070659_100027216 3300005366 Bacteria 4403
55 Ga0070659_100130808 3300005366 Bacteria 2038
56 Ga0070659_100165760 3300005366 Bacteria 1808
57 Ga0070667_100026761 3300005367 Bacteria 4799
58 Ga0070667_100032112 3300005367 Bacteria 4378
59 Ga0070667_100058795 3300005367 Bacteria 3251
60 Ga0070667_100086393 3300005367 Bacteria 2691
61 Ga0070667_100095817 3300005367 Bacteria 2559
62 Ga0070709_10001962 3300005434 Bacteria 11211
63 Ga0070709_10214763 3300005434 Bacteria 1369
64 Ga0070714_100008331 3300005435 Bacteria 8088
65 Ga0070714_100021200 3300005435 Bacteria 5314
66 Ga0070714_100365954 3300005435 Bacteria 1357
67 Ga0070713_100286384 3300005436 Bacteria 1513
68 Ga0070710_10052818 3300005437 Bacteria 2287
69 Ga0070711_100214786 3300005439 Bacteria 1492
70 Ga0070708_100037750 3300005445 Bacteria 4218
71 Ga0070663_100004128 3300005455 Bacteria 8487
72 Ga0070663_100073223 3300005455 Bacteria 2498
73 Ga0070663_100266349 3300005455 Bacteria 1361
74 Ga0070663_100341152 3300005455 Bacteria 1210
75 Ga0070678_100012230 3300005456 Bacteria 5326
76 Ga0070678_100129296 3300005456 Bacteria 2004
77 Ga0070678_100136520 3300005456 Bacteria 1956
78 Ga0070662_100000231 3300005457 Bacteria 32882
79 Ga0070662_100406967 3300005457 Bacteria 1124
80 Ga0070681_10001167 3300005458 Bacteria 22682
81 Ga0070681_10001697 3300005458 Bacteria 19691
82 Ga0070681_10015999 3300005458 Bacteria 7479
83 Ga0070681_10046933 3300005458 Bacteria 4318
84 Ga0070681_10105687 3300005458 Bacteria 2757
85 Ga0070681_10374851 3300005458 Bacteria 1334
86 Ga0068867_100058879 3300005459 Bacteria 2846
87 Ga0068867_100390719 3300005459 Bacteria 1171
88 Ga0070699_100093409 3300005518 Bacteria 2632
89 Ga0070679_100033573 3300005530 Bacteria 5081
90 Ga0070679_100055491 3300005530 Bacteria 3944
91 Ga0070679_100132269 3300005530 Bacteria 2476
92 Ga0070679_100299173 3300005530 Bacteria 1560
93 Ga0070684_100006951 3300005535 Bacteria 8790
94 Ga0070684_100016618 3300005535 Bacteria 6018
95 Ga0068853_100019246 3300005539 Bacteria 5658
96 Ga0068853_100052395 3300005539 Bacteria 3516
97 Ga0068853_100129391 3300005539 Bacteria 2259
98 Ga0068853_100214397 3300005539 Bacteria 1756
99 Ga0068853_100282219 3300005539 Bacteria 1531
100 Ga0070672_100182930 3300005543 Bacteria 1747
101 Ga0070672_100348090 3300005543 Bacteria 1263
102 Ga0070693_100037731 3300005547 Bacteria 2696
103 Ga0070693_100341584 3300005547 Bacteria 1022
104 Ga0070665_100021679 3300005548 Bacteria 6460
105 Ga0070665_100520819 3300005548 Bacteria 1201
106 Ga0068855_100003881 3300005563 Bacteria 18269
107 Ga0068855_100133982 3300005563 Bacteria 2827
108 Ga0068855_100357932 3300005563 Bacteria 1606
109 Ga0070664_100001613 3300005564 Bacteria 18043
110 Ga0070664_100001653 3300005564 Bacteria 17820
111 Ga0070664_100006016 3300005564 Bacteria 9809
112 Ga0070664_100051878 3300005564 Bacteria 3473
113 Ga0070664_100099768 3300005564 Bacteria 2524
114 Ga0070664_100659058 3300005564 Bacteria 973
115 Ga0068857_100001618 3300005577 Bacteria 18074
116 Ga0068857_100122755 3300005577 Bacteria 2340
117 Ga0068857_100206446 3300005577 Bacteria 1792
118 Ga0068854_100043770 3300005578 Bacteria 3175
119 Ga0068854_100062340 3300005578 Bacteria 2703
120 Ga0068854_100077976 3300005578 Bacteria 2439
121 Ga0068854_100118518 3300005578 Bacteria 2006
122 Ga0068854_100199905 3300005578 Bacteria 1570
123 Ga0068854_100252975 3300005578 Bacteria 1407
124 Ga0068856_100000352 3300005614 Bacteria 50157
125 Ga0068856_100002212 3300005614 Bacteria 20140
126 Ga0068856_100010244 3300005614 Bacteria 9112
127 Ga0068856_100023580 3300005614 Bacteria 5983
128 Ga0068856_100248445 3300005614 Bacteria 1794
129 Ga0068852_100000773 3300005616 Bacteria 21097
130 Ga0068852_100005811 3300005616 Bacteria 8858
131 Ga0068852_100025659 3300005616 Bacteria 4778
132 Ga0068852_100039439 3300005616 Bacteria 3976
133 Ga0068852_100042009 3300005616 Bacteria 3869
134 Ga0068852_100165547 3300005616 Bacteria 2069
135 Ga0068852_100957574 3300005616 Bacteria 874
136 Ga0068859_100134105 3300005617 Bacteria 2548
137 Ga0068864_100096107 3300005618 Bacteria 2621
138 Ga0068864_100168951 3300005618 Bacteria 1993
139 Ga0068861_100074201 3300005719 Bacteria 2645
140 Ga0068851_10001455 3300005834 Bacteria 10374
141 Ga0068851_10004826 3300005834 Bacteria 6103
142 Ga0068851_10125367 3300005834 Bacteria 1384
143 Ga0068851_10300372 3300005834 Bacteria 923
144 Ga0068858_100004907 3300005842 Bacteria 13110
145 Ga0068858_100158868 3300005842 Bacteria 2128
146 Ga0068858_100295897 3300005842 Bacteria 1543
147 Ga0068860_100136940 3300005843 Bacteria 2352
148 Ga0068860_100664179 3300005843 Bacteria 1050
149 Ga0068860_100766625 3300005843 Bacteria 977
150 Ga0068862_100216148 3300005844 Bacteria 1734
151 Ga0068862_100398473 3300005844 Bacteria 1287
152 Ga0070717_10201470 3300006028 Bacteria 1743
153 Ga0068871_100182068 3300006358 Bacteria 1806
154 Ga0075428_100000288 3300006844 Bacteria 49479
155 Ga0075430_100067389 3300006846 Bacteria 3005
156 Ga0075431_100004522 3300006847 Bacteria 13657
157 Ga0075433_10306428 3300006852 Bacteria 1406
158 Ga0075434_100413299 3300006871 Bacteria 1370
159 Ga0075429_100002497 3300006880 Bacteria 15470
160 Ga0075429_100027450 3300006880 Bacteria 4942
161 Ga0068865_100063473 3300006881 Bacteria 2596
162 Ga0068865_100402863 3300006881 Bacteria 1121
163 Ga0068865_100588151 3300006881 Bacteria 939
164 Ga0097620_100134116 3300006931 Bacteria 2548
165 Ga0105240_10006454 3300009093 Bacteria 17236
166 Ga0105240_10022277 3300009093 Bacteria 8403
167 Ga0105240_10027454 3300009093 Bacteria 7450
168 Ga0111539_10000383 3300009094 Bacteria 54556
169 Ga0111539_10480443 3300009094 Bacteria 1447
170 Ga0105247_10243029 3300009101 Bacteria 1227
171 Ga0114129_10502978 3300009147 Bacteria 1583
172 Ga0105243_10779568 3300009148 Bacteria 940
173 Ga0105241_10008892 3300009174 Bacteria 7387
174 Ga0105242_10048600 3300009176 Bacteria 3448
175 Ga0105248_10031881 3300009177 Bacteria 5889
176 Ga0105248_10082056 3300009177 Bacteria 3624
177 Ga0105248_10783161 3300009177 Bacteria 1076
178 Ga0105237_10976417 3300009545 Bacteria 854
179 Ga0105238_10002047 3300009551 Bacteria 20346
180 Ga0105238_10016725 3300009551 Bacteria 7432
181 Ga0105238_10394878 3300009551 Bacteria 1376
182 Ga0157373_10002035 3300013100 Bacteria 15324
183 Ga0157373_10004347 3300013100 Bacteria 10669
184 Ga0157373_10020991 3300013100 Bacteria 4741
185 Ga0157371_10002076 3300013102 Bacteria 19624
186 Ga0157370_10004541 3300013104 Bacteria 15900
187 Ga0157370_10008639 3300013104 Bacteria 10961
188 Ga0157370_10009020 3300013104 Bacteria 10704
189 Ga0157370_10055776 3300013104 Bacteria 3762
190 Ga0157370_10081387 3300013104 Bacteria 3047
191 Ga0157370_10092201 3300013104 Bacteria 2844
192 Ga0157370_10232494 3300013104 Bacteria 1706
193 Ga0157370_10232805 3300013104 Bacteria 1705
194 Ga0157369_10002386 3300013105 Bacteria 22557
195 Ga0157369_10033327 3300013105 Bacteria 5661
196 Ga0157369_10042950 3300013105 Bacteria 4929
197 Ga0157369_10158752 3300013105 Bacteria 2387
198 Ga0157369_10792921 3300013105 Bacteria 973
199 Ga0157374_10037309 3300013296 Bacteria 4460
200 Ga0157378_10060540 3300013297 Bacteria 3378
201 Ga0157378_10086985 3300013297 Bacteria 2834
202 Ga0157378_10566172 3300013297 Bacteria 1144
203 Ga0163162_10594379 3300013306 Bacteria 1233
204 Ga0163162_10699755 3300013306 Bacteria 1135
205 Ga0157372_10000868 3300013307 Bacteria 32826
206 Ga0157372_10019933 3300013307 Bacteria 7229
207 Ga0157372_10039738 3300013307 Bacteria 5193
208 Ga0157372_10080809 3300013307 Bacteria 3679
209 Ga0157372_10148857 3300013307 Bacteria 2701
210 Ga0157372_10188652 3300013307 Bacteria 2387
211 Ga0157372_10195171 3300013307 Bacteria 2345
212 Ga0157372_10524776 3300013307 Bacteria 1380
213 Ga0157375_10041809 3300013308 Bacteria 4430
214 Ga0157375_10181655 3300013308 Bacteria 2255
215 Ga0157375_10227364 3300013308 Bacteria 2024
216 Ga0157375_11004290 3300013308 Bacteria 974
217 Ga0157380_10011341 3300014326 Bacteria 6438
218 Ga0157380_10022368 3300014326 Bacteria 4758
219 Ga0157379_10009433 3300014968 Bacteria 8502
220 Ga0157379_10274049 3300014968 Bacteria 1535
221 Ga0157376_10546284 3300014969 Bacteria 1146
222 Ga0163161_10028041 3300017792 Bacteria 3997
223 Ga0163161_10576360 3300017792 Bacteria 925
224 Ga0206356_10708143 3300020070 Bacteria 2961
225 Ga0206354_11165693 3300020081 Bacteria 1194
226 Ga0206353_11046937 3300020082 Bacteria 1390
227 Ga0207656_10015078 3300025321 Bacteria 2987
228 Ga0207656_10020774 3300025321 Bacteria 2613
229 Ga0207656_10056816 3300025321 Bacteria 1707
230 Ga0207688_10315021 3300025901 Bacteria 959
231 Ga0207699_10002503 3300025906 Bacteria 8679
232 Ga0207699_10116184 3300025906 Bacteria 1723
233 Ga0207645_10025298 3300025907 Bacteria 3841
234 Ga0207645_10064004 3300025907 Bacteria 2350
235 Ga0207645_10166292 3300025907 Bacteria 1444
236 Ga0207705_10079161 3300025909 Bacteria 2393
237 Ga0207705_10130350 3300025909 Bacteria 1871
238 Ga0207705_10283233 3300025909 Bacteria 1269
239 Ga0207654_10022758 3300025911 Bacteria 3348
240 Ga0207654_10141632 3300025911 Bacteria 1534
241 Ga0207707_10001968 3300025912 Bacteria 18649
242 Ga0207707_10002953 3300025912 Bacteria 15142
243 Ga0207707_10007126 3300025912 Bacteria 9741
244 Ga0207707_10085530 3300025912 Bacteria 2755
245 Ga0207695_10008152 3300025913 Bacteria 13173
246 Ga0207695_10051058 3300025913 Bacteria 4345
247 Ga0207695_10497445 3300025913 Bacteria 1101
248 Ga0207671_10066280 3300025914 Bacteria 2687
249 Ga0207663_10112154 3300025916 Bacteria 1852
250 Ga0207663_10232627 3300025916 Bacteria 1347
251 Ga0207660_10016235 3300025917 Bacteria 4927
252 Ga0207660_10044661 3300025917 Bacteria 3117
253 Ga0207660_10280937 3300025917 Bacteria 1321
254 Ga0207657_10000102 3300025919 Bacteria 82096
255 Ga0207657_10002428 3300025919 Bacteria 20129
256 Ga0207649_10002170 3300025920 Bacteria 11096
257 Ga0207649_10002990 3300025920 Bacteria 9310
258 Ga0207649_10076251 3300025920 Bacteria 2157
259 Ga0207649_10081247 3300025920 Bacteria 2098
260 Ga0207649_10478747 3300025920 Bacteria 944
261 Ga0207652_10057299 3300025921 Bacteria 3355
262 Ga0207652_10083494 3300025921 Bacteria 2797
263 Ga0207681_10034490 3300025923 Bacteria 3328
264 Ga0207681_10074309 3300025923 Bacteria 2381
265 Ga0207681_10241395 3300025923 Bacteria 1406
266 Ga0207681_10403837 3300025923 Bacteria 1104
267 Ga0207694_10001672 3300025924 Bacteria 18592
268 Ga0207694_10034094 3300025924 Bacteria 3902
269 Ga0207650_10019612 3300025925 Bacteria 4754
270 Ga0207700_10000209 3300025928 Bacteria 35041
271 Ga0207700_10282833 3300025928 Bacteria 1427
272 Ga0207664_10008485 3300025929 Bacteria 7171
273 Ga0207664_10118805 3300025929 Bacteria 2209
274 Ga0207664_10351802 3300025929 Bacteria 1304
275 Ga0207664_10407987 3300025929 Bacteria 1209
276 Ga0207644_10008797 3300025931 Bacteria 6608
277 Ga0207644_10019242 3300025931 Bacteria 4629
278 Ga0207644_10033502 3300025931 Bacteria 3590
279 Ga0207644_10130709 3300025931 Bacteria 1922
280 Ga0207644_10400452 3300025931 Bacteria 1122
281 Ga0207690_10041228 3300025932 Bacteria 3024
282 Ga0207690_10091333 3300025932 Bacteria 2152
283 Ga0207690_10243970 3300025932 Bacteria 1385
284 Ga0207706_10000095 3300025933 Bacteria 92378
285 Ga0207706_10053287 3300025933 Bacteria 3572
286 Ga0207686_10015936 3300025934 Bacteria 4212
287 Ga0207670_10227243 3300025936 Bacteria 1432
288 Ga0207669_10003118 3300025937 Bacteria 7142
289 Ga0207669_10060235 3300025937 Bacteria 2326
290 Ga0207669_10406363 3300025937 Bacteria 1068
291 Ga0207669_10477990 3300025937 Bacteria 993
292 Ga0207704_10122151 3300025938 Bacteria 1785
293 Ga0207691_10004183 3300025940 Bacteria 14017
294 Ga0207691_10013184 3300025940 Bacteria 7914
295 Ga0207691_10041073 3300025940 Bacteria 4273
296 Ga0207691_10092021 3300025940 Bacteria 2716
297 Ga0207711_10023627 3300025941 Bacteria 5147
298 Ga0207711_10467907 3300025941 Bacteria 1174
299 Ga0207661_10119981 3300025944 Bacteria 2237
300 Ga0207679_10006518 3300025945 Bacteria 7381
301 Ga0207679_10013121 3300025945 Bacteria 5426
302 Ga0207679_10016676 3300025945 Bacteria 4879
303 Ga0207679_10047357 3300025945 Bacteria 3123
304 Ga0207679_10060496 3300025945 Bacteria 2815
305 Ga0207679_10215352 3300025945 Bacteria 1613
306 Ga0207679_10662632 3300025945 Bacteria 945
307 Ga0207667_10000233 3300025949 Bacteria 77272
308 Ga0207667_10018851 3300025949 Bacteria 7724
309 Ga0207667_10025679 3300025949 Bacteria 6445
310 Ga0207667_10160032 3300025949 Bacteria 2316
311 Ga0207651_10066244 3300025960 Bacteria 2537
312 Ga0207651_10190489 3300025960 Bacteria 1635
313 Ga0207668_10011243 3300025972 Bacteria 5433
314 Ga0207668_10069015 3300025972 Bacteria 2515
315 Ga0207668_10088569 3300025972 Bacteria 2267
316 Ga0207640_10048142 3300025981 Bacteria 2754
317 Ga0207640_10149117 3300025981 Bacteria 1716
318 Ga0207658_10013773 3300025986 Bacteria 5533
319 Ga0207658_10029552 3300025986 Bacteria 3872
320 Ga0207658_10111323 3300025986 Bacteria 2165
321 Ga0207658_10356324 3300025986 Bacteria 1275
322 Ga0207677_10154892 3300026023 Bacteria 1773
323 Ga0207703_10041259 3300026035 Bacteria 3696
324 Ga0207639_10042399 3300026041 Bacteria 3410
325 Ga0207639_10098955 3300026041 Bacteria 2352
326 Ga0207678_10002265 3300026067 Bacteria 17417
327 Ga0207678_10038834 3300026067 Bacteria 4134
328 Ga0207678_10057487 3300026067 Bacteria 3347
329 Ga0207678_10263112 3300026067 Bacteria 1478
330 Ga0207702_10000597 3300026078 Bacteria 39958
331 Ga0207702_10002061 3300026078 Bacteria 19456
332 Ga0207702_10003655 3300026078 Bacteria 13933
333 Ga0207702_10195900 3300026078 Bacteria 1870
334 Ga0207702_10249382 3300026078 Bacteria 1667
335 Ga0207702_10324660 3300026078 Bacteria 1467
336 Ga0207641_10473035 3300026088 Bacteria 1214
337 Ga0207648_10023595 3300026089 Bacteria 5508
338 Ga0207648_10052446 3300026089 Bacteria 3566
339 Ga0207648_10069065 3300026089 Bacteria 3079
340 Ga0207648_10208969 3300026089 Bacteria 1732
341 Ga0207648_10409041 3300026089 Bacteria 1230
342 Ga0207676_10032738 3300026095 Bacteria 3921
343 Ga0207674_10001568 3300026116 Bacteria 29439
344 Ga0207674_10002723 3300026116 Bacteria 22045
345 Ga0207675_100089670 3300026118 Bacteria 2890
346 Ga0207675_100106712 3300026118 Bacteria 2640
347 Ga0207683_10005585 3300026121 Bacteria 10781
348 Ga0207683_10132197 3300026121 Bacteria 2245
349 Ga0207683_10174637 3300026121 Bacteria 1947
350 Ga0207683_10252457 3300026121 Bacteria 1610
351 Ga0207683_10424943 3300026121 Bacteria 1224
352 Ga0207698_10002317 3300026142 Bacteria 11278
353 Ga0207698_10009337 3300026142 Bacteria 6250
354 Ga0207698_10054793 3300026142 Bacteria 3069
355 Ga0209983_1009950 3300027665 Bacteria 1943
356 Ga0209971_1003476 3300027682 Bacteria 3735
357 Ga0209971_1006531 3300027682 Bacteria 2757
358 Ga0209974_10001787 3300027876 Bacteria 7838
359 Ga0209974_10007961 3300027876 Bacteria 3634
360 Ga0207428_10013631 3300027907 Bacteria 7092
361 Ga0268266_10014494 3300028379 Bacteria 6775
362 Ga0268266_10081933 3300028379 Bacteria 2814
363 Ga0268265_10112539 3300028380 Bacteria 2225
364 Ga0268264_10277988 3300028381 Bacteria 1567
365 Ga0268264_10356153 3300028381 Bacteria 1394
366 Ga0268264_10653262 3300028381 Bacteria 1041
367 Ga0307408_100055103 3300031548 Bacteria 2877
368 Ga0307408_100118222 3300031548 Bacteria 2049
369 Ga0316578_10152792 3300031728 Bacteria 1391
370 Ga0307405_10000478 3300031731 Bacteria 15024
371 Ga0307405_10006485 3300031731 Bacteria 5759
372 Ga0307405_10244589 3300031731 Bacteria 1331
373 Ga0307413_10000634 3300031824 Bacteria 11867
374 Ga0307413_10000671 3300031824 Bacteria 11682
375 Ga0307410_10007937 3300031852 Bacteria 5851
376 Ga0307410_10015789 3300031852 Bacteria 4487
377 Ga0307410_10154491 3300031852 Bacteria 1712
378 Ga0307410_10488755 3300031852 Bacteria 1011
379 Ga0307410_10505026 3300031852 Bacteria 995
380 Ga0307406_10008598 3300031901 Bacteria 5699
381 Ga0307406_10010659 3300031901 Bacteria 5191
382 Ga0307406_10102113 3300031901 Bacteria 1956
383 Ga0307407_10002854 3300031903 Bacteria 6913
384 Ga0307407_10026799 3300031903 Bacteria 3057
385 Ga0307407_10075669 3300031903 Bacteria 2019
386 Ga0307412_10000834 3300031911 Bacteria 17697
387 Ga0307412_10369085 3300031911 Bacteria 1158
388 Ga0307409_100006853 3300031995 Bacteria 6750
389 Ga0307409_100007793 3300031995 Bacteria 6441
390 Ga0307416_100045872 3300032002 Bacteria 3444
391 Ga0307416_100623864 3300032002 Bacteria 1160
392 Ga0307414_10012709 3300032004 Bacteria 4991
393 Ga0307411_10000781 3300032005 Bacteria 11792
394 Ga0307411_10009199 3300032005 Bacteria 5176
395 Ga0307411_10015577 3300032005 Bacteria 4276
396 Ga0307415_100000471 3300032126 Bacteria 17381
397 Ga0307415_100008495 3300032126 Bacteria 5697
398 Ga0316574_0018192 3300035398 Bacteria 4126
399 Ga0373924_0004887 3300035410 Bacteria 4710
400 Ga0373937_0090645 3300036401 Bacteria 2831
401 Ga0373937_0097664 3300036401 Bacteria 2725
402 Ga0395900_0358927 3300037418 Bacteria 1429
403 Ga0395898_0066378 3300037466 Bacteria 3496
404 Ga0395905_0043100 3300037471 Bacteria 4234
405 Ga0395901_0050453 3300038443 Bacteria 4323
406 Ga0400484_07038 3300038725 Bacteria 4444
407 Ga0400484_21678 3300038725 Bacteria 7894
408 Ga0400490_00449 3300038726 Bacteria 27925
409 Ga0400490_26783 3300038726 Bacteria 21112
410 Ga0400490_34427 3300038726 Bacteria 54087
411 Ga0400491_00394 3300038727 Bacteria 1625
412 Ga0400485_20855 3300038735 Bacteria 1846
413 Ga0400488_31037 3300038741 Bacteria 7571
414 Ga0400488_33436 3300038741 Bacteria 3141
415 Ga0400486_21673 3300038742 Bacteria 7962
416 Ga0400483_058042 3300039062 Bacteria 1407
417 Ga0400483_127740 3300039062 Bacteria 14794
418 Ga0400483_186510 3300039062 Bacteria 5147
419 Ga0400483_246600 3300039062 Bacteria 15045
420 Ga0400483_291810 3300039062 Bacteria 8832
421 Ga0400489_75927 3300039093 Bacteria 24329
422 Ga0400487_04871 3300039110 Bacteria 21360
423 Ga0451798_0939029 3300041458 Bacteria 1070
424 Ga0439435_0009441 3300042436 Bacteria 2289
425 Ga0451577_0207198 3300042876 Bacteria 1771
426 Ga0453684_0452531 3300044712 Bacteria 1429
427 Ga0495628_0224231 3300046516 Bacteria 1411
428 Ga0495621_0125441 3300046539 Bacteria 995
429 Ga0495658_0177118 3300046683 Bacteria 1322
430 Ga0496103_0035782 3300048906 Bacteria 3040
431 Ga0496104_0450997 3300048907 Bacteria 1198
432 Ga0496106_0003923 3300048909 Bacteria 11109
433 Ga0496110_0397411 3300048913 Bacteria 1257
434 Ga0496112_0003817 3300048915 Bacteria 12593
435 Ga0501039_0578923 3300049575 Bacteria 880
436 Ga0501042_0311384 3300049578 Bacteria 1137
437 Ga0501047_0134853 3300049581 Bacteria 2349
438 Ga0501067_0060716 3300049583 Bacteria 2092
439 Ga0501070_0007253 3300049586 Bacteria 9411
440 Ga0501072_0012223 3300049588 Bacteria 6561
441 Ga0501073_0025326 3300049589 Bacteria 4256
442 Ga0501075_0294087 3300049591 Bacteria 1237
443 Ga0501080_0001862 3300049742 Bacteria 18118
444 nmdc:mga05p37_435889_c1 3300050507 Bacteria 1521
445 nmdc:mga09592_28355_c1 3300050508 Bacteria 4651
446 nmdc:mga09592_7571_c1 3300050508 Bacteria 8832
447 nmdc:mga0qj67_10899_c1 3300050509 Bacteria 6800
448 nmdc:mga06r32_13802_c1 3300050510 Bacteria 7328
449 nmdc:mga08y16_581923_c1 3300050511 Bacteria 1130
450 nmdc:mga08y16_660950_c1 3300050511 Bacteria 1048
451 nmdc:mga08y16_834_c1 3300050511 Bacteria 29611
452 nmdc:mga0a205_184552_c1 3300050515 Bacteria 1979
453 Ga0530510_0173470 3300061734 Bacteria 1598
454 Ga0530510_0496649 3300061734 Bacteria 925
455 Ga0070709_10142711
456 Ga0070658_10242418
457 Ga0070658_10397265
458 Ga0070676_10021807
459 Ga0070676_10052202
460 Ga0070676_10098884
461 Ga0070683_100016213
462 Ga0070683_100462332
463 Ga0070690_100228233
464 Ga0070670_100029222
465 Ga0070670_100062297
466 Ga0070670_100197936
467 Ga0070677_10084077
468 Ga0068869_100378868
469 Ga0070680_100122495
470 Ga0070680_100176671
471 Ga0070680_100326428
472 Ga0070680_100635660
473 Ga0070682_100085981
474 Ga0070660_100008372
475 Ga0070660_100014412
476 Ga0070660_100036902
477 Ga0070660_100270163
478 Ga0070661_100001117
479 Ga0070661_100003926
480 Ga0070661_100009677
481 Ga0070661_100012543
482 Ga0070661_100024043
483 Ga0070661_100037958
484 Ga0070661_100076708
485 Ga0070692_10088618
486 Ga0070668_100014595
487 Ga0070668_100032341
488 Ga0070668_100145489
489 Ga0070669_100045023
490 Ga0070669_100147989
491 Ga0070669_100452651
492 Ga0070675_100007118
493 Ga0070671_100001808
494 Ga0070671_100001980
495 Ga0070671_100023636
496 Ga0070671_100084732
497 Ga0070671_100107618
498 Ga0070671_100128068
499 Ga0070671_100261634
500 Ga0070674_100003810
501 Ga0070674_100078623
502 Ga0070674_100237568
503 Ga0070673_100007452
504 Ga0070659_100010091
505 Ga0070659_100018311
506 Ga0070659_100025398
507 Ga0070659_100027022
508 Ga0070659_100027216
509 Ga0070659_100130808
510 Ga0070659_100165760
511 Ga0070667_100026761
512 Ga0070667_100032112
513 Ga0070667_100058795
514 Ga0070667_100086393
515 Ga0070667_100095817
516 Ga0070709_10001962
517 Ga0070709_10214763
518 Ga0070714_100008331
519 Ga0070714_100021200
520 Ga0070714_100365954
521 Ga0070713_100286384
522 Ga0070710_10052818
523 Ga0070711_100214786
524 Ga0070708_100037750
525 Ga0070663_100004128
526 Ga0070663_100073223
527 Ga0070663_100266349
528 Ga0070663_100341152
529 Ga0070678_100012230
530 Ga0070678_100129296
531 Ga0070678_100136520
532 Ga0070662_100000231
533 Ga0070662_100406967
534 Ga0070681_10001167
535 Ga0070681_10001697
536 Ga0070681_10015999
537 Ga0070681_10046933
538 Ga0070681_10105687
539 Ga0070681_10374851
540 Ga0068867_100058879
541 Ga0068867_100390719
542 Ga0070699_100093409
543 Ga0070679_100033573
544 Ga0070679_100055491
545 Ga0070679_100132269
546 Ga0070679_100299173
547 Ga0070684_100006951
548 Ga0070684_100016618
549 Ga0068853_100019246
550 Ga0068853_100052395
551 Ga0068853_100129391
552 Ga0068853_100214397
553 Ga0068853_100282219
554 Ga0070672_100182930
555 Ga0070672_100348090
556 Ga0070693_100037731
557 Ga0070693_100341584
558 Ga0070665_100021679
559 Ga0070665_100520819
560 Ga0068855_100003881
561 Ga0068855_100133982
562 Ga0068855_100357932
563 Ga0070664_100001613
564 Ga0070664_100001653
565 Ga0070664_100006016
566 Ga0070664_100051878
567 Ga0070664_100099768
568 Ga0070664_100659058
569 Ga0068857_100001618
570 Ga0068857_100122755
571 Ga0068857_100206446
572 Ga0068854_100043770
573 Ga0068854_100062340
574 Ga0068854_100077976
575 Ga0068854_100118518
576 Ga0068854_100199905
577 Ga0068854_100252975
578 Ga0068856_100000352
579 Ga0068856_100002212
580 Ga0068856_100010244
581 Ga0068856_100023580
582 Ga0068856_100248445
583 Ga0068852_100000773
584 Ga0068852_100005811
585 Ga0068852_100025659
586 Ga0068852_100039439
587 Ga0068852_100042009
588 Ga0068852_100165547
589 Ga0068852_100957574
590 Ga0068859_100134105
591 Ga0068864_100096107
592 Ga0068864_100168951
593 Ga0068861_100074201
594 Ga0068851_10001455
595 Ga0068851_10004826
596 Ga0068851_10125367
597 Ga0068851_10300372
598 Ga0068858_100004907
599 Ga0068858_100158868
600 Ga0068858_100295897
601 Ga0068860_100136940
602 Ga0068860_100664179
603 Ga0068860_100766625
604 Ga0068862_100216148
605 Ga0068862_100398473
606 Ga0070717_10201470
607 Ga0068871_100182068
608 Ga0075428_100000288
609 Ga0075430_100067389
610 Ga0075431_100004522
611 Ga0075433_10306428
612 Ga0075434_100413299
613 Ga0075429_100002497
614 Ga0075429_100027450
615 Ga0068865_100063473
616 Ga0068865_100402863
617 Ga0068865_100588151
618 Ga0097620_100134116
619 Ga0105240_10006454
620 Ga0105240_10022277
621 Ga0105240_10027454
622 Ga0111539_10000383
623 Ga0111539_10480443
624 Ga0105247_10243029
625 Ga0114129_10502978
626 Ga0105243_10779568
627 Ga0105241_10008892
628 Ga0105242_10048600
629 Ga0105248_10031881
630 Ga0105248_10082056
631 Ga0105248_10783161
632 Ga0105237_10976417
633 Ga0105238_10002047
634 Ga0105238_10016725
635 Ga0105238_10394878
636 Ga0157373_10002035
637 Ga0157373_10004347
638 Ga0157373_10020991
639 Ga0157371_10002076
640 Ga0157370_10004541
641 Ga0157370_10008639
642 Ga0157370_10009020
643 Ga0157370_10055776
644 Ga0157370_10081387
645 Ga0157370_10092201
646 Ga0157370_10232494
647 Ga0157370_10232805
648 Ga0157369_10002386
649 Ga0157369_10033327
650 Ga0157369_10042950
651 Ga0157369_10158752
652 Ga0157369_10792921
653 Ga0157374_10037309
654 Ga0157378_10060540
655 Ga0157378_10086985
656 Ga0157378_10566172
657 Ga0163162_10594379
658 Ga0163162_10699755
659 Ga0157372_10000868
660 Ga0157372_10019933
661 Ga0157372_10039738
662 Ga0157372_10080809
663 Ga0157372_10148857
664 Ga0157372_10188652
665 Ga0157372_10195171
666 Ga0157372_10524776
667 Ga0157375_10041809
668 Ga0157375_10181655
669 Ga0157375_10227364
670 Ga0157375_11004290
671 Ga0157380_10011341
672 Ga0157380_10022368
673 Ga0157379_10009433
674 Ga0157379_10274049
675 Ga0157376_10546284
676 Ga0163161_10028041
677 Ga0163161_10576360
678 Ga0206356_10708143
679 Ga0206354_11165693
680 Ga0206353_11046937
681 Ga0207656_10015078
682 Ga0207656_10020774
683 Ga0207656_10056816
684 Ga0207688_10315021
685 Ga0207699_10002503
686 Ga0207699_10116184
687 Ga0207645_10025298
688 Ga0207645_10064004
689 Ga0207645_10166292
690 Ga0207705_10079161
691 Ga0207705_10130350
692 Ga0207705_10283233
693 Ga0207654_10022758
694 Ga0207654_10141632
695 Ga0207707_10001968
696 Ga0207707_10002953
697 Ga0207707_10007126
698 Ga0207707_10085530
699 Ga0207695_10008152
700 Ga0207695_10051058
701 Ga0207695_10497445
702 Ga0207671_10066280
703 Ga0207663_10112154
704 Ga0207663_10232627
705 Ga0207660_10016235
706 Ga0207660_10044661
707 Ga0207660_10280937
708 Ga0207657_10000102
709 Ga0207657_10002428
710 Ga0207649_10002170
711 Ga0207649_10002990
712 Ga0207649_10076251
713 Ga0207649_10081247
714 Ga0207649_10478747
715 Ga0207652_10057299
716 Ga0207652_10083494
717 Ga0207681_10034490
718 Ga0207681_10074309
719 Ga0207681_10241395
720 Ga0207681_10403837
721 Ga0207694_10001672
722 Ga0207694_10034094
723 Ga0207650_10019612
724 Ga0207700_10000209
725 Ga0207700_10282833
726 Ga0207664_10008485
727 Ga0207664_10118805
728 Ga0207664_10351802
729 Ga0207664_10407987
730 Ga0207644_10008797
731 Ga0207644_10019242
732 Ga0207644_10033502
733 Ga0207644_10130709
734 Ga0207644_10400452
735 Ga0207690_10041228
736 Ga0207690_10091333
737 Ga0207690_10243970
738 Ga0207706_10000095
739 Ga0207706_10053287
740 Ga0207686_10015936
741 Ga0207670_10227243
742 Ga0207669_10003118
743 Ga0207669_10060235
744 Ga0207669_10406363
745 Ga0207669_10477990
746 Ga0207704_10122151
747 Ga0207691_10004183
748 Ga0207691_10013184
749 Ga0207691_10041073
750 Ga0207691_10092021
751 Ga0207711_10023627
752 Ga0207711_10467907
753 Ga0207661_10119981
754 Ga0207679_10006518
755 Ga0207679_10013121
756 Ga0207679_10016676
757 Ga0207679_10047357
758 Ga0207679_10060496
759 Ga0207679_10215352
760 Ga0207679_10662632
761 Ga0207667_10000233
762 Ga0207667_10018851
763 Ga0207667_10025679
764 Ga0207667_10160032
765 Ga0207651_10066244
766 Ga0207651_10190489
767 Ga0207668_10011243
768 Ga0207668_10069015
769 Ga0207668_10088569
770 Ga0207640_10048142
771 Ga0207640_10149117
772 Ga0207658_10013773
773 Ga0207658_10029552
774 Ga0207658_10111323
775 Ga0207658_10356324
776 Ga0207677_10154892
777 Ga0207703_10041259
778 Ga0207639_10042399
779 Ga0207639_10098955
780 Ga0207678_10002265
781 Ga0207678_10038834
782 Ga0207678_10057487
783 Ga0207678_10263112
784 Ga0207702_10000597
785 Ga0207702_10002061
786 Ga0207702_10003655
787 Ga0207702_10195900
788 Ga0207702_10249382
789 Ga0207702_10324660
790 Ga0207641_10473035
791 Ga0207648_10023595
792 Ga0207648_10052446
793 Ga0207648_10069065
794 Ga0207648_10208969
795 Ga0207648_10409041
796 Ga0207676_10032738
797 Ga0207674_10001568
798 Ga0207674_10002723
799 Ga0207675_100089670
800 Ga0207675_100106712
801 Ga0207683_10005585
802 Ga0207683_10132197
803 Ga0207683_10174637
804 Ga0207683_10252457
805 Ga0207683_10424943
806 Ga0207698_10002317
807 Ga0207698_10009337
808 Ga0207698_10054793
809 Ga0209983_1009950
810 Ga0209971_1003476
811 Ga0209971_1006531
812 Ga0209974_10001787
813 Ga0209974_10007961
814 Ga0207428_10013631
815 Ga0268266_10014494
816 Ga0268266_10081933
817 Ga0268265_10112539
818 Ga0268264_10277988
819 Ga0268264_10356153
820 Ga0268264_10653262
821 Ga0307408_100055103
822 Ga0307408_100118222
823 Ga0316578_10152792
824 Ga0307405_10000478
825 Ga0307405_10006485
826 Ga0307405_10244589
827 Ga0307413_10000634
828 Ga0307413_10000671
829 Ga0307410_10007937
830 Ga0307410_10015789
831 Ga0307410_10154491
832 Ga0307410_10488755
833 Ga0307410_10505026
834 Ga0307406_10008598
835 Ga0307406_10010659
836 Ga0307406_10102113
837 Ga0307407_10002854
838 Ga0307407_10026799
839 Ga0307407_10075669
840 Ga0307412_10000834
841 Ga0307412_10369085
842 Ga0307409_100006853
843 Ga0307409_100007793
844 Ga0307416_100045872
845 Ga0307416_100623864
846 Ga0307414_10012709
847 Ga0307411_10000781
848 Ga0307411_10009199
849 Ga0307411_10015577
850 Ga0307415_100000471
851 Ga0307415_100008495
852 Ga0316574_0018192
853 Ga0373924_0004887
854 Ga0373937_0090645
855 Ga0373937_0097664
856 Ga0395900_0358927
857 Ga0395898_0066378
858 Ga0395905_0043100
859 Ga0395901_0050453
860 Ga0400484_07038
861 Ga0400484_21678
862 Ga0400490_00449
863 Ga0400490_26783
864 Ga0400490_34427
865 Ga0400491_00394
866 Ga0400485_20855
867 Ga0400488_31037
868 Ga0400488_33436
869 Ga0400486_21673
870 Ga0400483_058042
871 Ga0400483_127740
872 Ga0400483_186510
873 Ga0400483_246600
874 Ga0400483_291810
875 Ga0400489_75927
876 Ga0400487_04871
877 Ga0451798_0939029
878 Ga0439435_0009441
879 Ga0451577_0207198
880 Ga0453684_0452531
881 Ga0495628_0224231
882 Ga0495621_0125441
883 Ga0495658_0177118
884 Ga0496103_0035782
885 Ga0496104_0450997
886 Ga0496106_0003923
887 Ga0496110_0397411
888 Ga0496112_0003817
889 Ga0501039_0578923
890 Ga0501042_0311384
891 Ga0501047_0134853
892 Ga0501067_0060716
893 Ga0501070_0007253
894 Ga0501072_0012223
895 Ga0501073_0025326
896 Ga0501075_0294087
897 Ga0501080_0001862
898 nmdc:mga05p37_435889_c1
899 nmdc:mga09592_28355_c1
900 nmdc:mga09592_7571_c1
901 nmdc:mga0qj67_10899_c1
902 nmdc:mga06r32_13802_c1
903 nmdc:mga08y16_581923_c1
904 nmdc:mga08y16_660950_c1
905 nmdc:mga08y16_834_c1
906 nmdc:mga0a205_184552_c1
907 Ga0530510_0173470
908 Ga0530510_0496649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00636

Ribonuclease_3

Ribonuclease III domain

64

154

0.97

PF14622

Ribonucleas_3_3

Ribonuclease-III-like

45

170

0.95

PF00035

dsrm

Double-stranded RNA binding motif

182

249

0.94

PF22935

RM44_endonuclase

Large ribosomal subunit protein mL44, endonuclease domain

59

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a11-assembly1.cif.gz_A-2 crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis 0.9678 10 143
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9485 11 137
3n3w-assembly1.cif.gz_B 2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9344 11 136
1rc5-assembly2.cif.gz_C crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution 0.9031 11 140
7w0f-assembly1.cif.gz_A dmdicer2-loqspd-dsrna post-dicing status 0.8964 11 142
ID Description Score Start End Superfamily
af_P0A7Y0_4_147_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9869 11 141 1.10.1520.10
2a11A00 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9678 10 143 1.10.1520.10
1o0wB01 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9396 12 141 1.10.1520.10
af_B6SGY5_35_174_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9364 11 137 1.10.1520.10
af_Q2FZ50_16_166_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9354 12 140 1.10.1520.10
ID Description Score Start End GO Terms
AF-A0A356E6B3-F1-model_v4 Ribonuclease III 0.9942 10 118 GO:0004525
GO:0006396
AF-A0A4Q6EIP2-F1-model_v4 Ribonuclease III 0.9921 11 138 GO:0003725
GO:0004525
GO:0006396
GO:0010468
AF-W7WWP8-F1-model_v4 deleted 0.9918 11 145
AF-A0A6L6EC33-F1-model_v4 deleted 0.9913 19 130
AF-A0A3D2DL54-F1-model_v4 Ribonuclease III (EC 3.1.26.3) 0.9883 11 128 GO:0003725
GO:0004525
GO:0006364
GO:0006397
GO:0010468

Map