F447299

General Info

Members Datasets Scaffolds Average Seq Length
453 258 906 129

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885080285|2885082682
Length 121
Sequence LDHLVLTTRDKAACIDFYTRVLGMRLETFGAGRHAFRFGAQKINLHEHGKEFLPKAALPTPGSLDLCFIAAVPLDAFIARLASLGVAIEEGPVARTGANWPIRSIYLRDPDHNLIEVSERA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
228 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
229 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
230 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
231 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
232 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
233 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
240 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10199679 3300005295 Bacteria 1317
2 Ga0065707_10309781 3300005295 Bacteria 986
3 Ga0070676_10107586 3300005328 Bacteria 1732
4 Ga0070676_10111284 3300005328 Bacteria 1705
5 Ga0070690_100002266 3300005330 Bacteria 10303
6 Ga0070680_100000721 3300005336 Bacteria 22998
7 Ga0070680_100462681 3300005336 Bacteria 1084
8 Ga0070680_101439771 3300005336 Bacteria 597
9 Ga0070682_100002017 3300005337 Bacteria 11348
10 Ga0068868_100004853 3300005338 Bacteria 9443
11 Ga0070689_100076695 3300005340 Bacteria 2619
12 Ga0070689_100498782 3300005340 Bacteria 1042
13 Ga0070691_10008100 3300005341 Bacteria 4812
14 Ga0070687_100000778 3300005343 Bacteria 10608
15 Ga0070687_100501490 3300005343 Bacteria 817
16 Ga0070668_100048031 3300005347 Bacteria 3282
17 Ga0070669_100006224 3300005353 Bacteria 8618
18 Ga0070669_100096761 3300005353 Bacteria 2221
19 Ga0070675_100045100 3300005354 Bacteria 3607
20 Ga0070675_100155725 3300005354 Bacteria 1962
21 Ga0070675_101208989 3300005354 Bacteria 696
22 Ga0070671_100257372 3300005355 Bacteria 1483
23 Ga0070674_100124925 3300005356 Bacteria 1909
24 Ga0070673_100228042 3300005364 Bacteria 1615
25 Ga0070701_10001015 3300005438 Bacteria 10219
26 Ga0070701_10057292 3300005438 Bacteria 2042
27 Ga0070711_100790487 3300005439 Bacteria 804
28 Ga0070705_100000157 3300005440 Bacteria 40183
29 Ga0070705_100019927 3300005440 Bacteria 3538
30 Ga0070705_100247742 3300005440 Bacteria 1249
31 Ga0070700_100018997 3300005441 Bacteria 3962
32 Ga0070700_100231715 3300005441 Bacteria 1315
33 Ga0070700_100593515 3300005441 Bacteria 867
34 Ga0070694_100001988 3300005444 Bacteria 12142
35 Ga0070694_100267974 3300005444 Bacteria 1298
36 Ga0070678_101156559 3300005456 Bacteria 716
37 Ga0070678_101599075 3300005456 Bacteria 612
38 Ga0070681_10081689 3300005458 Bacteria 3188
39 Ga0070681_10798166 3300005458 Bacteria 861
40 Ga0068867_100001912 3300005459 Bacteria 14499
41 Ga0068867_100004756 3300005459 Bacteria 9561
42 Ga0068867_100954345 3300005459 Bacteria 775
43 Ga0070685_10221476 3300005466 Bacteria 1240
44 Ga0070685_11528625 3300005466 Bacteria 515
45 Ga0070706_100036115 3300005467 Bacteria 4563
46 Ga0070699_100117449 3300005518 Bacteria 2338
47 Ga0070679_100027265 3300005530 Bacteria 5620
48 Ga0070679_101332407 3300005530 Bacteria 664
49 Ga0070684_101406661 3300005535 Bacteria 657
50 Ga0070697_100036453 3300005536 Bacteria 3973
51 Ga0070672_100602141 3300005543 Bacteria 957
52 Ga0070686_100000463 3300005544 Bacteria 24565
53 Ga0070695_100000269 3300005545 Bacteria 26219
54 Ga0070695_101234252 3300005545 Bacteria 616
55 Ga0070696_100000099 3300005546 Bacteria 43704
56 Ga0070696_100078622 3300005546 Bacteria 2332
57 Ga0070696_100128397 3300005546 Bacteria 1842
58 Ga0070696_101170439 3300005546 Bacteria 649
59 Ga0070693_100000073 3300005547 Bacteria 41317
60 Ga0070693_100113095 3300005547 Bacteria 1673
61 Ga0070704_100000023 3300005549 Bacteria 51399
62 Ga0070704_101015497 3300005549 Bacteria 751
63 Ga0070704_101115702 3300005549 Bacteria 717
64 Ga0070704_101125551 3300005549 Bacteria 714
65 Ga0068855_100024552 3300005563 Bacteria 7211
66 Ga0068854_100040320 3300005578 Bacteria 3295
67 Ga0068856_100024672 3300005614 Bacteria 5855
68 Ga0068856_100520327 3300005614 Bacteria 1211
69 Ga0070702_100000431 3300005615 Bacteria 14922
70 Ga0070702_100145708 3300005615 Bacteria 1514
71 Ga0068852_100470759 3300005616 Bacteria 1247
72 Ga0068859_100008340 3300005617 Bacteria 10499
73 Ga0068859_101766873 3300005617 Bacteria 683
74 Ga0068864_100390320 3300005618 Bacteria 1321
75 Ga0068866_10000066 3300005718 Bacteria 41226
76 Ga0068866_10058494 3300005718 Bacteria 1991
77 Ga0068861_100002311 3300005719 Bacteria 12385
78 Ga0068861_100003879 3300005719 Bacteria 9995
79 Ga0068861_100798461 3300005719 Bacteria 886
80 Ga0068861_101075747 3300005719 Bacteria 772
81 Ga0068863_100247180 3300005841 Bacteria 1722
82 Ga0068863_100834974 3300005841 Bacteria 920
83 Ga0068858_100006844 3300005842 Bacteria 11084
84 Ga0068860_100009194 3300005843 Bacteria 9821
85 Ga0068860_100141867 3300005843 Bacteria 2310
86 Ga0068860_100310658 3300005843 Bacteria 1546
87 Ga0068862_100004410 3300005844 Bacteria 11878
88 Ga0068862_100007495 3300005844 Bacteria 9042
89 Ga0068862_100668284 3300005844 Bacteria 1004
90 Ga0070715_10071949 3300006163 Bacteria 1547
91 Ga0070716_100262857 3300006173 Bacteria 1182
92 Ga0097621_100002382 3300006237 Bacteria 12887
93 Ga0075428_100000181 3300006844 Bacteria 58935
94 Ga0075428_101346871 3300006844 Bacteria 750
95 Ga0075430_100003428 3300006846 Bacteria 13254
96 Ga0075430_100251146 3300006846 Bacteria 1465
97 Ga0075430_100422112 3300006846 Bacteria 1101
98 Ga0075430_100760612 3300006846 Bacteria 798
99 Ga0075430_100902205 3300006846 Bacteria 728
100 Ga0075431_100092543 3300006847 Bacteria 3121
101 Ga0075431_100794353 3300006847 Bacteria 920
102 Ga0075431_101312145 3300006847 Bacteria 684
103 Ga0075433_10008488 3300006852 Bacteria 8198
104 Ga0075433_10315653 3300006852 Bacteria 1383
105 Ga0075434_100005182 3300006871 Bacteria 11834
106 Ga0075429_100000544 3300006880 Bacteria 28752
107 Ga0068865_100000102 3300006881 Bacteria 44224
108 Ga0068865_100087949 3300006881 Bacteria 2247
109 Ga0075436_100001501 3300006914 Bacteria 15919
110 Ga0097620_100008340 3300006931 Bacteria 10499
111 Ga0097620_101767122 3300006931 Bacteria 683
112 Ga0075435_100002107 3300007076 Bacteria 13088
113 Ga0099794_10069934 3300007265 Bacteria 1718
114 Ga0105240_11295772 3300009093 Bacteria 768
115 Ga0111539_10028346 3300009094 Bacteria 6833
116 Ga0111539_10041148 3300009094 Bacteria 5557
117 Ga0111539_10370014 3300009094 Bacteria 1668
118 Ga0111539_10565882 3300009094 Bacteria 1324
119 Ga0111539_11370691 3300009094 Bacteria 820
120 Ga0105245_10044418 3300009098 Bacteria 3966
121 Ga0114129_10000190 3300009147 Bacteria 69084
122 Ga0114129_10090171 3300009147 Bacteria 4250
123 Ga0114129_10755955 3300009147 Bacteria 1244
124 Ga0114129_11870450 3300009147 Bacteria 728
125 Ga0105243_10000706 3300009148 Bacteria 32176
126 Ga0105243_10034651 3300009148 Bacteria 3910
127 Ga0105241_10094622 3300009174 Bacteria 2363
128 Ga0105242_10000306 3300009176 Bacteria 39217
129 Ga0105248_11081108 3300009177 Bacteria 906
130 Ga0105237_10785664 3300009545 Bacteria 959
131 Ga0105249_10016658 3300009553 Bacteria 6523
132 Ga0105249_10026520 3300009553 Bacteria 5222
133 Ga0105249_11507192 3300009553 Bacteria 745
134 Ga0105239_10095666 3300010375 Bacteria 3281
135 Ga0157378_10000211 3300013297 Bacteria 56039
136 Ga0163162_10037360 3300013306 Bacteria 4846
137 Ga0157372_10442571 3300013307 Bacteria 1515
138 Ga0157375_10275012 3300013308 Bacteria 1846
139 Ga0157375_10422481 3300013308 Bacteria 1499
140 Ga0157380_10005451 3300014326 Bacteria 8891
141 Ga0182008_10362507 3300014497 Bacteria 771
142 Ga0157377_10020791 3300014745 Bacteria 3444
143 Ga0157377_10030668 3300014745 Bacteria 2914
144 Ga0157379_10379336 3300014968 Bacteria 1297
145 Ga0157379_10961853 3300014968 Bacteria 813
146 Ga0157376_10036299 3300014969 Bacteria 3993
147 Ga0207653_10004406 3300025885 Bacteria 4413
148 Ga0207642_10001369 3300025899 Bacteria 7563
149 Ga0207642_10021196 3300025899 Bacteria 2554
150 Ga0207688_10028200 3300025901 Bacteria 3089
151 Ga0207688_10242073 3300025901 Bacteria 1091
152 Ga0207680_10193277 3300025903 Bacteria 1383
153 Ga0207685_10473501 3300025905 Bacteria 655
154 Ga0207645_10339583 3300025907 Bacteria 1004
155 Ga0207645_10697265 3300025907 Bacteria 690
156 Ga0207643_10017649 3300025908 Bacteria 3904
157 Ga0207643_10086492 3300025908 Bacteria 1822
158 Ga0207684_10060184 3300025910 Bacteria 3226
159 Ga0207707_10241446 3300025912 Bacteria 1570
160 Ga0207695_10970408 3300025913 Bacteria 730
161 Ga0207663_10877209 3300025916 Bacteria 717
162 Ga0207660_10004471 3300025917 Bacteria 9116
163 Ga0207662_10000080 3300025918 Bacteria 44291
164 Ga0207662_10075469 3300025918 Bacteria 2048
165 Ga0207662_10690672 3300025918 Bacteria 715
166 Ga0207652_11530101 3300025921 Bacteria 571
167 Ga0207681_10005021 3300025923 Bacteria 8133
168 Ga0207687_10002107 3300025927 Bacteria 13597
169 Ga0207686_10014978 3300025934 Bacteria 4328
170 Ga0207709_10001290 3300025935 Bacteria 17883
171 Ga0207670_10008457 3300025936 Bacteria 5816
172 Ga0207670_10894802 3300025936 Bacteria 743
173 Ga0207704_10005551 3300025938 Bacteria 5813
174 Ga0207704_10327271 3300025938 Bacteria 1184
175 Ga0207665_10127985 3300025939 Bacteria 1800
176 Ga0207691_10047410 3300025940 Bacteria 3943
177 Ga0207691_11186203 3300025940 Bacteria 633
178 Ga0207689_10000972 3300025942 Bacteria 27502
179 Ga0207689_10100716 3300025942 Bacteria 2373
180 Ga0207689_10139176 3300025942 Bacteria 1999
181 Ga0207667_10272745 3300025949 Bacteria 1729
182 Ga0207651_10167819 3300025960 Bacteria 1728
183 Ga0207651_10168526 3300025960 Bacteria 1725
184 Ga0207712_10008364 3300025961 Bacteria 6538
185 Ga0207668_10020424 3300025972 Bacteria 4208
186 Ga0207640_10306395 3300025981 Bacteria 1259
187 Ga0207658_10146996 3300025986 Bacteria 1916
188 Ga0207677_10002533 3300026023 Bacteria 9581
189 Ga0207677_10751915 3300026023 Bacteria 869
190 Ga0207703_10159317 3300026035 Bacteria 1975
191 Ga0207703_11769165 3300026035 Bacteria 594
192 Ga0207708_10000309 3300026075 Bacteria 38568
193 Ga0207708_10004105 3300026075 Bacteria 10715
194 Ga0207708_10073003 3300026075 Bacteria 2630
195 Ga0207708_10209832 3300026075 Bacteria 1556
196 Ga0207702_10330073 3300026078 Bacteria 1455
197 Ga0207702_10666066 3300026078 Bacteria 1024
198 Ga0207641_10068430 3300026088 Bacteria 3045
199 Ga0207641_10269190 3300026088 Bacteria 1598
200 Ga0207648_10000201 3300026089 Bacteria 63324
201 Ga0207648_10012174 3300026089 Bacteria 8060
202 Ga0207676_10324777 3300026095 Bacteria 1414
203 Ga0207674_10280910 3300026116 Bacteria 1613
204 Ga0207675_100005863 3300026118 Bacteria 11731
205 Ga0207675_100030170 3300026118 Bacteria 5050
206 Ga0207675_101503315 3300026118 Bacteria 694
207 Ga0207683_10360511 3300026121 Bacteria 1335
208 Ga0207683_10815763 3300026121 Bacteria 866
209 Ga0207698_10418510 3300026142 Bacteria 1285
210 Ga0209967_1009190 3300027364 Bacteria 1369
211 Ga0209981_1002178 3300027378 Bacteria 2493
212 Ga0209981_1006360 3300027378 Bacteria 1579
213 Ga0210000_1008908 3300027462 Bacteria 1473
214 Ga0209968_1006150 3300027526 Bacteria 1805
215 Ga0209999_1005264 3300027543 Bacteria 2326
216 Ga0209999_1014435 3300027543 Bacteria 1436
217 Ga0209983_1023730 3300027665 Bacteria 1289
218 Ga0209588_1056793 3300027671 Bacteria 1265
219 Ga0209966_1001099 3300027695 Bacteria 4895
220 Ga0209974_10016326 3300027876 Bacteria 2466
221 Ga0207428_10000488 3300027907 Bacteria 47436
222 Ga0207428_10043575 3300027907 Bacteria 3623
223 Ga0207428_10086191 3300027907 Bacteria 2444
224 Ga0207428_10101480 3300027907 Bacteria 2223
225 Ga0207428_10485240 3300027907 Bacteria 899
226 Ga0268265_10003584 3300028380 Bacteria 11086
227 Ga0268265_10008297 3300028380 Bacteria 7016
228 Ga0268265_10611888 3300028380 Bacteria 1042
229 Ga0268264_10014601 3300028381 Bacteria 6452
230 Ga0268264_10084978 3300028381 Bacteria 2715
231 Ga0268264_10134150 3300028381 Bacteria 2199
232 Ga0307408_100125358 3300031548 Bacteria 1996
233 Ga0307408_101176100 3300031548 Bacteria 714
234 Ga0307408_101333697 3300031548 Bacteria 673
235 Ga0307405_10471773 3300031731 Bacteria 1000
236 Ga0307405_10818362 3300031731 Bacteria 782
237 Ga0307405_11691108 3300031731 Bacteria 560
238 Ga0307406_11082483 3300031901 Bacteria 691
239 Ga0307407_10625600 3300031903 Bacteria 804
240 Ga0307412_10258881 3300031911 Bacteria 1355
241 Ga0307412_10324713 3300031911 Bacteria 1226
242 Ga0307412_10879240 3300031911 Bacteria 784
243 Ga0307412_11655287 3300031911 Bacteria 586
244 Ga0307416_100251230 3300032002 Bacteria 1721
245 Ga0307416_100899070 3300032002 Bacteria 985
246 Ga0307411_10127375 3300032005 Bacteria 1854
247 Ga0373930_0042094 3300034816 Bacteria 976
248 Ga0373958_0005084 3300034819 Bacteria 1980
249 Ga0373958_0194808 3300034819 Bacteria 528
250 Ga0373938_0032597 3300034957 Bacteria 1123
251 Ga0373926_0002236 3300035083 Bacteria 6114
252 Ga0373926_0012977 3300035083 Bacteria 2821
253 Ga0373928_0060122 3300035084 Bacteria 917
254 Ga0373929_0049976 3300035085 Bacteria 953
255 Ga0373944_0001419 3300035089 Bacteria 6036
256 Ga0373944_0005579 3300035089 Bacteria 3317
257 Ga0373949_0007903 3300035090 Bacteria 2330
258 Ga0373951_0015288 3300035091 Bacteria 1727
259 Ga0373951_0260925 3300035091 Bacteria 523
260 Ga0373952_0079059 3300035092 Bacteria 836
261 Ga0373932_0022168 3300035112 Bacteria 1684
262 Ga0373932_0039533 3300035112 Bacteria 1353
263 Ga0373932_0065720 3300035112 Bacteria 1113
264 Ga0373936_0044539 3300035113 Bacteria 1785
265 Ga0373939_0027148 3300035114 Bacteria 1619
266 Ga0373939_0109736 3300035114 Bacteria 959
267 Ga0373941_0034148 3300035115 Bacteria 1532
268 Ga0373941_0185486 3300035115 Bacteria 783
269 Ga0373945_0005526 3300035116 Bacteria 4049
270 Ga0373960_0106630 3300035121 Bacteria 914
271 Ga0373960_0169609 3300035121 Bacteria 756
272 Ga0373943_0015846 3300035170 Bacteria 3428
273 Ga0373943_0073401 3300035170 Bacteria 1737
274 Ga0373946_0004393 3300035171 Bacteria 5048
275 Ga0373946_0039300 3300035171 Bacteria 1931
276 Ga0373942_0002546 3300035207 Bacteria 4410
277 Ga0373942_0008026 3300035207 Bacteria 2455
278 Ga0373942_0329991 3300035207 Bacteria 535
279 Ga0373961_0285800 3300035241 Bacteria 606
280 Ga0373962_0099147 3300035242 Bacteria 907
281 Ga0373962_0136937 3300035242 Bacteria 792
282 Ga0373924_0057349 3300035410 Bacteria 1624
283 Ga0373931_0001278 3300035691 Bacteria 10741
284 Ga0373931_0001293 3300035691 Bacteria 10707
285 Ga0373931_0023160 3300035691 Bacteria 3134
286 Ga0373931_0279056 3300035691 Bacteria 1025
287 Ga0373931_0344557 3300035691 Bacteria 931
288 Ga0373931_1242599 3300035691 Bacteria 511
289 Ga0373935_0029073 3300035692 Bacteria 3419
290 Ga0373935_0056703 3300035692 Bacteria 2498
291 Ga0373927_0005228 3300035695 Bacteria 8981
292 Ga0373927_0043952 3300035695 Bacteria 2891
293 Ga0373947_0014236 3300035725 Bacteria 4561
294 Ga0373947_0123799 3300035725 Bacteria 1644
295 Ga0373925_0015426 3300037068 Bacteria 5524
296 Ga0373925_0024117 3300037068 Bacteria 4440
297 Ga0373925_1741137 3300037068 Bacteria 509
298 Ga0436360_0520484 3300039438 Bacteria 1180
299 Ga0436361_0321957 3300039447 Bacteria 18451
300 Ga0439453_0016463 3300041408 Bacteria 1290
301 Ga0439466_0203159 3300041411 Bacteria 603
302 Ga0439433_0032842 3300041999 Bacteria 1191
303 Ga0439441_138534 3300042001 Bacteria 567
304 Ga0439443_002837 3300042003 Bacteria 2119
305 Ga0450923_093742 3300042125 Bacteria 687
306 Ga0439435_0002459 3300042436 Bacteria 3684
307 Ga0439444_0004168 3300042437 Bacteria 2085
308 Ga0439464_0226904 3300042439 Bacteria 600
309 Ga0439460_0000547 3300042461 Bacteria 8245
310 Ga0439460_0123282 3300042461 Bacteria 849
311 Ga0451577_0069378 3300042876 Bacteria 3143
312 Ga0466963_0443043 3300044694 Bacteria 916
313 Ga0466964_0010399 3300044706 Bacteria 3510
314 Ga0453684_0210440 3300044712 Bacteria 2261
315 Ga0451576_0000926 3300045051 Bacteria 55382
316 Ga0451576_0018686 3300045051 Bacteria 7583
317 Ga0451576_0025473 3300045051 Bacteria 6371
318 Ga0451576_1011505 3300045051 Bacteria 871
319 Ga0451576_2157588 3300045051 Bacteria 572
320 Ga0466967_0042650 3300045976 Bacteria 3922
321 Ga0495592_0768057 3300046454 Bacteria 575
322 Ga0495603_0018040 3300046455 Bacteria 4269
323 Ga0495580_0003339 3300046472 Bacteria 13722
324 Ga0495639_0218504 3300046475 Bacteria 936
325 Ga0495584_0173479 3300046491 Bacteria 1096
326 Ga0495594_0058419 3300046499 Bacteria 2131
327 Ga0495666_0010741 3300046526 Bacteria 4568
328 Ga0495586_0006427 3300046535 Bacteria 6278
329 Ga0495586_0012176 3300046535 Bacteria 4566
330 Ga0495609_0132007 3300046538 Bacteria 1069
331 Ga0495609_0179373 3300046538 Bacteria 892
332 Ga0495621_0018603 3300046539 Bacteria 2258
333 Ga0495656_0779858 3300046615 Bacteria 516
334 Ga0495588_0008932 3300046674 Bacteria 4614
335 Ga0495647_0018090 3300046681 Bacteria 2503
336 Ga0495658_0002651 3300046683 Bacteria 8997
337 Ga0495669_0427719 3300046684 Bacteria 642
338 Ga0495676_0027464 3300047321 Bacteria 4878
339 Ga0495677_0269993 3300047445 Bacteria 667
340 Ga0501292_034220 3300049515 Bacteria 862
341 Ga0501031_0016909 3300049568 Bacteria 4738
342 Ga0501031_0382726 3300049568 Bacteria 910
343 Ga0501031_0412402 3300049568 Bacteria 873
344 Ga0501033_0025003 3300049570 Bacteria 4500
345 Ga0501036_0020596 3300049572 Bacteria 5539
346 Ga0501036_0924806 3300049572 Unclassified 715
347 Ga0501036_1705363 3300049572 Bacteria 508
348 Ga0501037_0021969 3300049573 Bacteria 4724
349 Ga0501037_0436257 3300049573 Bacteria 895
350 Ga0501038_0000612 3300049574 Bacteria 31789
351 Ga0501038_1224596 3300049574 Bacteria 544
352 Ga0501039_0023777 3300049575 Bacteria 4703
353 Ga0501039_0315439 3300049575 Bacteria 1229
354 Ga0501040_0018057 3300049576 Bacteria 4684
355 Ga0501040_0051324 3300049576 Bacteria 2821
356 Ga0501040_0120313 3300049576 Bacteria 1842
357 Ga0501040_0302560 3300049576 Bacteria 1143
358 Ga0501041_0009259 3300049577 Bacteria 5798
359 Ga0501041_0013618 3300049577 Bacteria 4823
360 Ga0501041_0039739 3300049577 Bacteria 2855
361 Ga0501042_0070373 3300049578 Bacteria 2503
362 Ga0501042_0134462 3300049578 Bacteria 1783
363 Ga0501042_0227110 3300049578 Bacteria 1346
364 Ga0501042_0344000 3300049578 Bacteria 1078
365 Ga0501042_1061174 3300049578 Bacteria 591
366 Ga0501043_0047835 3300049579 Bacteria 3363
367 Ga0501046_0000987 3300049580 Bacteria 27829
368 Ga0501046_0518469 3300049580 Bacteria 852
369 Ga0501046_0578603 3300049580 Bacteria 798
370 Ga0501048_0016508 3300049582 Bacteria 5443
371 Ga0501048_0044828 3300049582 Bacteria 3160
372 Ga0501048_0669967 3300049582 Bacteria 745
373 Ga0501068_0029826 3300049584 Bacteria 3233
374 Ga0501070_0342114 3300049586 Bacteria 1215
375 Ga0501070_0462681 3300049586 Bacteria 1022
376 Ga0501071_0015821 3300049587 Bacteria 5182
377 Ga0501071_0038461 3300049587 Bacteria 3419
378 Ga0501071_0590167 3300049587 Bacteria 854
379 Ga0501072_0018319 3300049588 Bacteria 5389
380 Ga0501072_0095756 3300049588 Bacteria 2359
381 Ga0501072_0156960 3300049588 Bacteria 1814
382 Ga0501072_0180366 3300049588 Bacteria 1684
383 Ga0501072_0961485 3300049588 Bacteria 666
384 Ga0501073_0109563 3300049589 Bacteria 1916
385 Ga0501074_0012046 3300049590 Bacteria 6282
386 Ga0501075_0000175 3300049591 Bacteria 33306
387 Ga0501075_0255051 3300049591 Bacteria 1337
388 Ga0501076_0021833 3300049592 Bacteria 4914
389 Ga0501076_0157016 3300049592 Bacteria 1852
390 Ga0501077_0003314 3300049593 Bacteria 9691
391 Ga0501077_0017263 3300049593 Bacteria 4552
392 Ga0501077_0275902 3300049593 Bacteria 1070
393 Ga0501202_117672 3300049652 Bacteria 665
394 Ga0501216_049266 3300049660 Bacteria 825
395 Ga0501217_044089 3300049661 Bacteria 1145
396 Ga0501228_032008 3300049666 Bacteria 649
397 Ga0501230_068282 3300049667 Bacteria 729
398 Ga0501233_023973 3300049668 Bacteria 1331
399 Ga0501233_114950 3300049668 Bacteria 723
400 Ga0501253_114242 3300049683 Bacteria 647
401 Ga0501258_049986 3300049687 Bacteria 581
402 Ga0501225_0167870 3300049705 Bacteria 679
403 Ga0501229_025228 3300049706 Bacteria 799
404 Ga0501079_0017243 3300049741 Bacteria 5513
405 Ga0501079_0710384 3300049741 Bacteria 791
406 Ga0501079_1334207 3300049741 Bacteria 565
407 Ga0501080_0022102 3300049742 Bacteria 5893
408 Ga0501081_0009784 3300049743 Bacteria 6246
409 Ga0501081_0123625 3300049743 Bacteria 1845
410 Ga0501269_050742 3300049766 Bacteria 570
411 Ga0501283_017809 3300049779 Bacteria 1114
412 Ga0501283_070357 3300049779 Bacteria 644
413 Ga0501035_0121096 3300049822 Bacteria 2287
414 Ga0501044_0121394 3300049823 Bacteria 2614
415 Ga0501045_0005542 3300049824 Bacteria 8730
416 Ga0501045_0061360 3300049824 Bacteria 2758
417 nmdc:mga05p37_1114082_c1 3300050507 Bacteria 825
418 nmdc:mga05p37_456_c1 3300050507 Bacteria 44536
419 nmdc:mga05p37_61434_c1 3300050507 Bacteria 4625
420 nmdc:mga05p37_615200_c1 3300050507 Bacteria 1223
421 nmdc:mga09592_39391_c1 3300050508 Bacteria 3970
422 nmdc:mga09592_40635_c1 3300050508 Bacteria 3715
423 nmdc:mga09592_6067_c1 3300050508 Bacteria 9850
424 nmdc:mga0qj67_176144_c1 3300050509 Bacteria 1737
425 nmdc:mga0qj67_181258_c1 3300050509 Bacteria 1711
426 nmdc:mga0qj67_53874_c1 3300050509 Bacteria 3185
427 nmdc:mga0qj67_654304_c1 3300050509 Bacteria 838
428 nmdc:mga0qj67_671309_c1 3300050509 Bacteria 826
429 nmdc:mga0qj67_84412_c1 3300050509 Bacteria 2547
430 nmdc:mga06r32_109025_c1 3300050510 Bacteria 2723
431 nmdc:mga06r32_179033_c1 3300050510 Bacteria 2105
432 nmdc:mga06r32_274396_c1 3300050510 Bacteria 1674
433 nmdc:mga06r32_435438_c1 3300050510 Bacteria 1292
434 nmdc:mga06r32_765602_c1 3300050510 Bacteria 928
435 nmdc:mga08y16_149091_c1 3300050511 Bacteria 2432
436 nmdc:mga08y16_195671_c1 3300050511 Bacteria 2096
437 nmdc:mga08y16_29862_c1 3300050511 Bacteria 5741
438 nmdc:mga08y16_4565_c1 3300050511 Bacteria 14433
439 nmdc:mga0n895_2276_c1 3300050512 Bacteria 14895
440 nmdc:mga0n895_621231_c1 3300050512 Bacteria 1081
441 nmdc:mga0rr50_32486_c1 3300050513 Bacteria 3720
442 nmdc:mga08x19_1685_c1 3300050514 Bacteria 13579
443 nmdc:mga0a205_207696_c1 3300050515 Bacteria 1847
444 nmdc:mga0a205_5582_c1 3300050515 Bacteria 11330
445 Ga0501084_0022186 3300054114 Bacteria 5297
446 Ga0590071_013607 3300059421 Bacteria 1906
447 Ga0590077_008944 3300059426 Bacteria 2051
448 Ga0590077_087685 3300059426 Bacteria 720
449 Ga0501082_0020121 3300060353 Bacteria 5751
450 Ga0501082_0383173 3300060353 Bacteria 1227
451 Ga0530510_0015651 3300061734 Bacteria 5359
452 Ga0530510_0109360 3300061734 Bacteria 2024
453 2885082682 2885080285 Bacteria 6355622
454 Ga0065707_10199679
455 Ga0065707_10309781
456 Ga0070676_10107586
457 Ga0070676_10111284
458 Ga0070690_100002266
459 Ga0070680_100000721
460 Ga0070680_100462681
461 Ga0070680_101439771
462 Ga0070682_100002017
463 Ga0068868_100004853
464 Ga0070689_100076695
465 Ga0070689_100498782
466 Ga0070691_10008100
467 Ga0070687_100000778
468 Ga0070687_100501490
469 Ga0070668_100048031
470 Ga0070669_100006224
471 Ga0070669_100096761
472 Ga0070675_100045100
473 Ga0070675_100155725
474 Ga0070675_101208989
475 Ga0070671_100257372
476 Ga0070674_100124925
477 Ga0070673_100228042
478 Ga0070701_10001015
479 Ga0070701_10057292
480 Ga0070711_100790487
481 Ga0070705_100000157
482 Ga0070705_100019927
483 Ga0070705_100247742
484 Ga0070700_100018997
485 Ga0070700_100231715
486 Ga0070700_100593515
487 Ga0070694_100001988
488 Ga0070694_100267974
489 Ga0070678_101156559
490 Ga0070678_101599075
491 Ga0070681_10081689
492 Ga0070681_10798166
493 Ga0068867_100001912
494 Ga0068867_100004756
495 Ga0068867_100954345
496 Ga0070685_10221476
497 Ga0070685_11528625
498 Ga0070706_100036115
499 Ga0070699_100117449
500 Ga0070679_100027265
501 Ga0070679_101332407
502 Ga0070684_101406661
503 Ga0070697_100036453
504 Ga0070672_100602141
505 Ga0070686_100000463
506 Ga0070695_100000269
507 Ga0070695_101234252
508 Ga0070696_100000099
509 Ga0070696_100078622
510 Ga0070696_100128397
511 Ga0070696_101170439
512 Ga0070693_100000073
513 Ga0070693_100113095
514 Ga0070704_100000023
515 Ga0070704_101015497
516 Ga0070704_101115702
517 Ga0070704_101125551
518 Ga0068855_100024552
519 Ga0068854_100040320
520 Ga0068856_100024672
521 Ga0068856_100520327
522 Ga0070702_100000431
523 Ga0070702_100145708
524 Ga0068852_100470759
525 Ga0068859_100008340
526 Ga0068859_101766873
527 Ga0068864_100390320
528 Ga0068866_10000066
529 Ga0068866_10058494
530 Ga0068861_100002311
531 Ga0068861_100003879
532 Ga0068861_100798461
533 Ga0068861_101075747
534 Ga0068863_100247180
535 Ga0068863_100834974
536 Ga0068858_100006844
537 Ga0068860_100009194
538 Ga0068860_100141867
539 Ga0068860_100310658
540 Ga0068862_100004410
541 Ga0068862_100007495
542 Ga0068862_100668284
543 Ga0070715_10071949
544 Ga0070716_100262857
545 Ga0097621_100002382
546 Ga0075428_100000181
547 Ga0075428_101346871
548 Ga0075430_100003428
549 Ga0075430_100251146
550 Ga0075430_100422112
551 Ga0075430_100760612
552 Ga0075430_100902205
553 Ga0075431_100092543
554 Ga0075431_100794353
555 Ga0075431_101312145
556 Ga0075433_10008488
557 Ga0075433_10315653
558 Ga0075434_100005182
559 Ga0075429_100000544
560 Ga0068865_100000102
561 Ga0068865_100087949
562 Ga0075436_100001501
563 Ga0097620_100008340
564 Ga0097620_101767122
565 Ga0075435_100002107
566 Ga0099794_10069934
567 Ga0105240_11295772
568 Ga0111539_10028346
569 Ga0111539_10041148
570 Ga0111539_10370014
571 Ga0111539_10565882
572 Ga0111539_11370691
573 Ga0105245_10044418
574 Ga0114129_10000190
575 Ga0114129_10090171
576 Ga0114129_10755955
577 Ga0114129_11870450
578 Ga0105243_10000706
579 Ga0105243_10034651
580 Ga0105241_10094622
581 Ga0105242_10000306
582 Ga0105248_11081108
583 Ga0105237_10785664
584 Ga0105249_10016658
585 Ga0105249_10026520
586 Ga0105249_11507192
587 Ga0105239_10095666
588 Ga0157378_10000211
589 Ga0163162_10037360
590 Ga0157372_10442571
591 Ga0157375_10275012
592 Ga0157375_10422481
593 Ga0157380_10005451
594 Ga0182008_10362507
595 Ga0157377_10020791
596 Ga0157377_10030668
597 Ga0157379_10379336
598 Ga0157379_10961853
599 Ga0157376_10036299
600 Ga0207653_10004406
601 Ga0207642_10001369
602 Ga0207642_10021196
603 Ga0207688_10028200
604 Ga0207688_10242073
605 Ga0207680_10193277
606 Ga0207685_10473501
607 Ga0207645_10339583
608 Ga0207645_10697265
609 Ga0207643_10017649
610 Ga0207643_10086492
611 Ga0207684_10060184
612 Ga0207707_10241446
613 Ga0207695_10970408
614 Ga0207663_10877209
615 Ga0207660_10004471
616 Ga0207662_10000080
617 Ga0207662_10075469
618 Ga0207662_10690672
619 Ga0207652_11530101
620 Ga0207681_10005021
621 Ga0207687_10002107
622 Ga0207686_10014978
623 Ga0207709_10001290
624 Ga0207670_10008457
625 Ga0207670_10894802
626 Ga0207704_10005551
627 Ga0207704_10327271
628 Ga0207665_10127985
629 Ga0207691_10047410
630 Ga0207691_11186203
631 Ga0207689_10000972
632 Ga0207689_10100716
633 Ga0207689_10139176
634 Ga0207667_10272745
635 Ga0207651_10167819
636 Ga0207651_10168526
637 Ga0207712_10008364
638 Ga0207668_10020424
639 Ga0207640_10306395
640 Ga0207658_10146996
641 Ga0207677_10002533
642 Ga0207677_10751915
643 Ga0207703_10159317
644 Ga0207703_11769165
645 Ga0207708_10000309
646 Ga0207708_10004105
647 Ga0207708_10073003
648 Ga0207708_10209832
649 Ga0207702_10330073
650 Ga0207702_10666066
651 Ga0207641_10068430
652 Ga0207641_10269190
653 Ga0207648_10000201
654 Ga0207648_10012174
655 Ga0207676_10324777
656 Ga0207674_10280910
657 Ga0207675_100005863
658 Ga0207675_100030170
659 Ga0207675_101503315
660 Ga0207683_10360511
661 Ga0207683_10815763
662 Ga0207698_10418510
663 Ga0209967_1009190
664 Ga0209981_1002178
665 Ga0209981_1006360
666 Ga0210000_1008908
667 Ga0209968_1006150
668 Ga0209999_1005264
669 Ga0209999_1014435
670 Ga0209983_1023730
671 Ga0209588_1056793
672 Ga0209966_1001099
673 Ga0209974_10016326
674 Ga0207428_10000488
675 Ga0207428_10043575
676 Ga0207428_10086191
677 Ga0207428_10101480
678 Ga0207428_10485240
679 Ga0268265_10003584
680 Ga0268265_10008297
681 Ga0268265_10611888
682 Ga0268264_10014601
683 Ga0268264_10084978
684 Ga0268264_10134150
685 Ga0307408_100125358
686 Ga0307408_101176100
687 Ga0307408_101333697
688 Ga0307405_10471773
689 Ga0307405_10818362
690 Ga0307405_11691108
691 Ga0307406_11082483
692 Ga0307407_10625600
693 Ga0307412_10258881
694 Ga0307412_10324713
695 Ga0307412_10879240
696 Ga0307412_11655287
697 Ga0307416_100251230
698 Ga0307416_100899070
699 Ga0307411_10127375
700 Ga0373930_0042094
701 Ga0373958_0005084
702 Ga0373958_0194808
703 Ga0373938_0032597
704 Ga0373926_0002236
705 Ga0373926_0012977
706 Ga0373928_0060122
707 Ga0373929_0049976
708 Ga0373944_0001419
709 Ga0373944_0005579
710 Ga0373949_0007903
711 Ga0373951_0015288
712 Ga0373951_0260925
713 Ga0373952_0079059
714 Ga0373932_0022168
715 Ga0373932_0039533
716 Ga0373932_0065720
717 Ga0373936_0044539
718 Ga0373939_0027148
719 Ga0373939_0109736
720 Ga0373941_0034148
721 Ga0373941_0185486
722 Ga0373945_0005526
723 Ga0373960_0106630
724 Ga0373960_0169609
725 Ga0373943_0015846
726 Ga0373943_0073401
727 Ga0373946_0004393
728 Ga0373946_0039300
729 Ga0373942_0002546
730 Ga0373942_0008026
731 Ga0373942_0329991
732 Ga0373961_0285800
733 Ga0373962_0099147
734 Ga0373962_0136937
735 Ga0373924_0057349
736 Ga0373931_0001278
737 Ga0373931_0001293
738 Ga0373931_0023160
739 Ga0373931_0279056
740 Ga0373931_0344557
741 Ga0373931_1242599
742 Ga0373935_0029073
743 Ga0373935_0056703
744 Ga0373927_0005228
745 Ga0373927_0043952
746 Ga0373947_0014236
747 Ga0373947_0123799
748 Ga0373925_0015426
749 Ga0373925_0024117
750 Ga0373925_1741137
751 Ga0436360_0520484
752 Ga0436361_0321957
753 Ga0439453_0016463
754 Ga0439466_0203159
755 Ga0439433_0032842
756 Ga0439441_138534
757 Ga0439443_002837
758 Ga0450923_093742
759 Ga0439435_0002459
760 Ga0439444_0004168
761 Ga0439464_0226904
762 Ga0439460_0000547
763 Ga0439460_0123282
764 Ga0451577_0069378
765 Ga0466963_0443043
766 Ga0466964_0010399
767 Ga0453684_0210440
768 Ga0451576_0000926
769 Ga0451576_0018686
770 Ga0451576_0025473
771 Ga0451576_1011505
772 Ga0451576_2157588
773 Ga0466967_0042650
774 Ga0495592_0768057
775 Ga0495603_0018040
776 Ga0495580_0003339
777 Ga0495639_0218504
778 Ga0495584_0173479
779 Ga0495594_0058419
780 Ga0495666_0010741
781 Ga0495586_0006427
782 Ga0495586_0012176
783 Ga0495609_0132007
784 Ga0495609_0179373
785 Ga0495621_0018603
786 Ga0495656_0779858
787 Ga0495588_0008932
788 Ga0495647_0018090
789 Ga0495658_0002651
790 Ga0495669_0427719
791 Ga0495676_0027464
792 Ga0495677_0269993
793 Ga0501292_034220
794 Ga0501031_0016909
795 Ga0501031_0382726
796 Ga0501031_0412402
797 Ga0501033_0025003
798 Ga0501036_0020596
799 Ga0501036_0924806
800 Ga0501036_1705363
801 Ga0501037_0021969
802 Ga0501037_0436257
803 Ga0501038_0000612
804 Ga0501038_1224596
805 Ga0501039_0023777
806 Ga0501039_0315439
807 Ga0501040_0018057
808 Ga0501040_0051324
809 Ga0501040_0120313
810 Ga0501040_0302560
811 Ga0501041_0009259
812 Ga0501041_0013618
813 Ga0501041_0039739
814 Ga0501042_0070373
815 Ga0501042_0134462
816 Ga0501042_0227110
817 Ga0501042_0344000
818 Ga0501042_1061174
819 Ga0501043_0047835
820 Ga0501046_0000987
821 Ga0501046_0518469
822 Ga0501046_0578603
823 Ga0501048_0016508
824 Ga0501048_0044828
825 Ga0501048_0669967
826 Ga0501068_0029826
827 Ga0501070_0342114
828 Ga0501070_0462681
829 Ga0501071_0015821
830 Ga0501071_0038461
831 Ga0501071_0590167
832 Ga0501072_0018319
833 Ga0501072_0095756
834 Ga0501072_0156960
835 Ga0501072_0180366
836 Ga0501072_0961485
837 Ga0501073_0109563
838 Ga0501074_0012046
839 Ga0501075_0000175
840 Ga0501075_0255051
841 Ga0501076_0021833
842 Ga0501076_0157016
843 Ga0501077_0003314
844 Ga0501077_0017263
845 Ga0501077_0275902
846 Ga0501202_117672
847 Ga0501216_049266
848 Ga0501217_044089
849 Ga0501228_032008
850 Ga0501230_068282
851 Ga0501233_023973
852 Ga0501233_114950
853 Ga0501253_114242
854 Ga0501258_049986
855 Ga0501225_0167870
856 Ga0501229_025228
857 Ga0501079_0017243
858 Ga0501079_0710384
859 Ga0501079_1334207
860 Ga0501080_0022102
861 Ga0501081_0009784
862 Ga0501081_0123625
863 Ga0501269_050742
864 Ga0501283_017809
865 Ga0501283_070357
866 Ga0501035_0121096
867 Ga0501044_0121394
868 Ga0501045_0005542
869 Ga0501045_0061360
870 nmdc:mga05p37_1114082_c1
871 nmdc:mga05p37_456_c1
872 nmdc:mga05p37_61434_c1
873 nmdc:mga05p37_615200_c1
874 nmdc:mga09592_39391_c1
875 nmdc:mga09592_40635_c1
876 nmdc:mga09592_6067_c1
877 nmdc:mga0qj67_176144_c1
878 nmdc:mga0qj67_181258_c1
879 nmdc:mga0qj67_53874_c1
880 nmdc:mga0qj67_654304_c1
881 nmdc:mga0qj67_671309_c1
882 nmdc:mga0qj67_84412_c1
883 nmdc:mga06r32_109025_c1
884 nmdc:mga06r32_179033_c1
885 nmdc:mga06r32_274396_c1
886 nmdc:mga06r32_435438_c1
887 nmdc:mga06r32_765602_c1
888 nmdc:mga08y16_149091_c1
889 nmdc:mga08y16_195671_c1
890 nmdc:mga08y16_29862_c1
891 nmdc:mga08y16_4565_c1
892 nmdc:mga0n895_2276_c1
893 nmdc:mga0n895_621231_c1
894 nmdc:mga0rr50_32486_c1
895 nmdc:mga08x19_1685_c1
896 nmdc:mga0a205_207696_c1
897 nmdc:mga0a205_5582_c1
898 Ga0501084_0022186
899 Ga0590071_013607
900 Ga0590077_008944
901 Ga0590077_087685
902 Ga0501082_0020121
903 Ga0501082_0383173
904 Ga0530510_0015651
905 Ga0530510_0109360
906 2885082682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

117

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ey7-assembly1.cif.gz_B structure from the mobile metagenome of v. cholerae. integron cassette protein vch_cass1 0.948 1 128
3ey8-assembly1.cif.gz_A structure from the mobile metagenome of v. pseudocholerae. vpc_cass1 0.9473 1 128
3hnq-assembly1.cif.gz_A crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 0.9435 1 127
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.933 1 127
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.9324 2 127
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9716 6 127 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9637 6 127 3.10.180.10
af_Q4VBH2_28_179_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8011 76 125 3.30.460.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7876 6 124 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7655 5 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A5E8XM96-F1-model_v4 deleted 0.9981 72 128
AF-A0A357NRA2-F1-model_v4 deleted 0.9833 74 128
AF-A0A435TUY5-F1-model_v4 VOC family protein 0.9744 67 129
AF-A0A7I7ZDC9-F1-model_v4 deleted 0.9739 74 127
AF-A0A537FGZ7-F1-model_v4 VOC family protein 0.9725 12 129

Map