F447261

General Info

Members Datasets Scaffolds Average Seq Length
453 290 451 217

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0157071|Ga0496106_0157071_702_1433
Length 243
Sequence LRPQIAREERNDNFVDNAQTTGVLMSIELYGFWRSIASFRVRVALRLKNLSFEETSVDILSGEQFKPGYDAVNPEHVVPTFVHDGHSLFQSLAIMEYLEDIKPTPPLLPKDAKERAYARSLALMTIADAHPLVVPRVRNHLAKTFGADAKAIENWGKHWTSEGLSTYERLLARRRPAPFALGAQVGLADICIAGQVVGAHFLKIELTPFPIVAGLAERCFKMPEFSSSHPFEQPGYKAASASH

Samples

Sample ID Description Type Environment
1 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
267 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
268 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
269 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
270 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
271 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
272 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
273 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
274 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
275 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
280 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
283 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
284 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
287 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
288 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.66
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 0
Rhizoplane 2.87
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 6.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000019 3300003203 Bacteria 87589
2 rootL2_10341808 3300003322 Bacteria 1268
3 rootH1_10015906 3300003323 Bacteria 9735
4 Ga0065715_10126737 3300005293 Bacteria 2102
5 Ga0070658_10202564 3300005327 Bacteria 1675
6 Ga0070683_100001350 3300005329 Bacteria 18730
7 Ga0070690_100585510 3300005330 Unclassified 845
8 Ga0070677_10094007 3300005333 Bacteria 1309
9 Ga0070680_100004381 3300005336 Bacteria 10628
10 Ga0070680_100005784 3300005336 Bacteria 9384
11 Ga0068868_100164526 3300005338 Bacteria 1834
12 Ga0070660_100006367 3300005339 Bacteria 8183
13 Ga0070689_100028949 3300005340 Bacteria 4189
14 Ga0070661_100184804 3300005344 Bacteria 1587
15 Ga0070661_100334649 3300005344 Unclassified 1185
16 Ga0070669_100072671 3300005353 Bacteria 2547
17 Ga0070675_100654712 3300005354 Bacteria 955
18 Ga0070671_100507043 3300005355 Bacteria 1038
19 Ga0070674_100009522 3300005356 Bacteria 5818
20 Ga0070673_100461258 3300005364 Bacteria 1144
21 Ga0070667_100725939 3300005367 Bacteria 920
22 Ga0070709_10239670 3300005434 Bacteria 1302
23 Ga0070709_10497577 3300005434 Bacteria 925
24 Ga0070714_100106686 3300005435 Bacteria 2475
25 Ga0070714_100632307 3300005435 Bacteria 1029
26 Ga0070713_100006029 3300005436 Bacteria 8350
27 Ga0070713_100020265 3300005436 Bacteria 5095
28 Ga0070713_100486124 3300005436 Bacteria 1163
29 Ga0070713_100689487 3300005436 Bacteria 975
30 Ga0070713_101096951 3300005436 Bacteria 769
31 Ga0070710_10004892 3300005437 Bacteria 6338
32 Ga0070710_10007397 3300005437 Bacteria 5316
33 Ga0070711_100358838 3300005439 Bacteria 1173
34 Ga0070678_100031723 3300005456 Bacteria 3649
35 Ga0070662_100019649 3300005457 Bacteria 4589
36 Ga0070681_10133416 3300005458 Bacteria 2414
37 Ga0070681_10145373 3300005458 Bacteria 2300
38 Ga0068867_100340806 3300005459 Bacteria 1248
39 Ga0070685_10144930 3300005466 Bacteria 1499
40 Ga0070706_100092289 3300005467 Unclassified 2809
41 Ga0070699_100608193 3300005518 Bacteria 997
42 Ga0070679_100104595 3300005530 Bacteria 2817
43 Ga0070684_100001137 3300005535 Bacteria 19108
44 Ga0070684_100001541 3300005535 Bacteria 16650
45 Ga0070684_100044955 3300005535 Bacteria 3822
46 Ga0070684_100485174 3300005535 Bacteria 1144
47 Ga0068853_100186616 3300005539 Bacteria 1882
48 Ga0070686_100534206 3300005544 Bacteria 915
49 Ga0070696_100494286 3300005546 Bacteria 972
50 Ga0070693_100186494 3300005547 Bacteria 1339
51 Ga0070665_100322862 3300005548 Bacteria 1548
52 Ga0070665_100499152 3300005548 Bacteria 1228
53 Ga0068857_100789246 3300005577 Bacteria 906
54 Ga0068856_100000183 3300005614 Bacteria 65005
55 Ga0068852_101080960 3300005616 Bacteria 822
56 Ga0068859_100107949 3300005617 Bacteria 2844
57 Ga0068864_100029244 3300005618 Bacteria 4664
58 Ga0068863_100014067 3300005841 Bacteria 7710
59 Ga0068863_100255283 3300005841 Bacteria 1694
60 Ga0068858_100224675 3300005842 Bacteria 1779
61 Ga0068860_100937450 3300005843 Bacteria 883
62 Ga0081539_10000003 3300005985 Bacteria 594833
63 Ga0081539_10003401 3300005985 Bacteria 19633
64 Ga0081539_10054554 3300005985 Bacteria 2230
65 Ga0070717_10000620 3300006028 Bacteria 22822
66 Ga0070717_10089663 3300006028 Bacteria 2594
67 Ga0070717_10096213 3300006028 Bacteria 2508
68 Ga0070717_10096261 3300006028 Bacteria 2507
69 Ga0070717_10309282 3300006028 Bacteria 1406
70 Ga0075363_100012256 3300006048 Bacteria 4128
71 Ga0075432_10066251 3300006058 Bacteria 1292
72 Ga0070715_10036714 3300006163 Bacteria 2023
73 Ga0070715_10192062 3300006163 Bacteria 1031
74 Ga0070716_100018019 3300006173 Bacteria 3673
75 Ga0070716_100331259 3300006173 Bacteria 1070
76 Ga0070712_100004971 3300006175 Bacteria 8224
77 Ga0070712_100355237 3300006175 Bacteria 1200
78 Ga0075362_10200926 3300006177 Unclassified 970
79 Ga0075367_10503454 3300006178 Bacteria 768
80 Ga0075369_10098186 3300006186 Unclassified 1312
81 Ga0068871_100029518 3300006358 Bacteria 4308
82 Ga0075428_100080372 3300006844 Bacteria 3558
83 Ga0068865_100335989 3300006881 Bacteria 1219
84 Ga0097620_100107941 3300006931 Bacteria 2844
85 Ga0099794_10082119 3300007265 Bacteria 1591
86 Ga0099794_10085915 3300007265 Bacteria 1557
87 Ga0099795_10014712 3300007788 Bacteria 2432
88 Ga0099795_10052784 3300007788 Bacteria 1486
89 Ga0105240_10771301 3300009093 Bacteria 1044
90 Ga0111539_10139723 3300009094 Bacteria 2836
91 Ga0105245_10050839 3300009098 Bacteria 3716
92 Ga0105245_10923085 3300009098 Bacteria 915
93 Ga0105245_11092148 3300009098 Bacteria 844
94 Ga0105247_10156712 3300009101 Bacteria 1505
95 Ga0105247_10226382 3300009101 Bacteria 1268
96 Ga0105241_10211344 3300009174 Bacteria 1626
97 Ga0105242_10145835 3300009176 Bacteria 2059
98 Ga0105248_10008738 3300009177 Bacteria 11126
99 Ga0105248_10031594 3300009177 Bacteria 5917
100 Ga0105237_10047065 3300009545 Bacteria 4336
101 Ga0105237_10118667 3300009545 Bacteria 2639
102 Ga0105237_10146791 3300009545 Bacteria 2354
103 Ga0105249_10498341 3300009553 Bacteria 1263
104 Ga0099796_10053169 3300010159 Bacteria 1412
105 Ga0105246_10377378 3300011119 Bacteria 1170
106 Ga0157370_10033790 3300013104 Bacteria 4984
107 Ga0157370_11142434 3300013104 Bacteria 703
108 Ga0157369_10002453 3300013105 Bacteria 22254
109 Ga0157369_10021884 3300013105 Bacteria 7146
110 Ga0157369_10068642 3300013105 Bacteria 3809
111 Ga0157369_11065505 3300013105 Unclassified 827
112 Ga0157378_10507905 3300013297 Bacteria 1205
113 Ga0163162_10122333 3300013306 Bacteria 2707
114 Ga0157372_10097620 3300013307 Bacteria 3351
115 Ga0157372_10291682 3300013307 Bacteria 1897
116 Ga0157372_10314234 3300013307 Bacteria 1824
117 Ga0157380_10594887 3300014326 Bacteria 1093
118 Ga0182008_10081611 3300014497 Bacteria 1591
119 Ga0157379_10298764 3300014968 Bacteria 1467
120 Ga0157376_10231454 3300014969 Bacteria 1717
121 Ga0182006_1000201 3300015261 Bacteria 61463
122 Ga0182007_10081637 3300015262 Bacteria 1061
123 Ga0163161_10025092 3300017792 Bacteria 4216
124 Ga0206353_11725562 3300020082 Bacteria 1118
125 Ga0207682_10085081 3300025893 Bacteria 1362
126 Ga0207692_10056745 3300025898 Bacteria 2010
127 Ga0207692_10142740 3300025898 Bacteria 1363
128 Ga0207642_10316615 3300025899 Bacteria 910
129 Ga0207710_10001695 3300025900 Bacteria 10686
130 Ga0207710_10113221 3300025900 Bacteria 1290
131 Ga0207685_10077418 3300025905 Bacteria 1366
132 Ga0207699_10133548 3300025906 Bacteria 1622
133 Ga0207699_10389096 3300025906 Bacteria 991
134 Ga0207645_10236147 3300025907 Bacteria 1207
135 Ga0207684_10041923 3300025910 Unclassified 3880
136 Ga0207684_10147282 3300025910 Bacteria 2025
137 Ga0207707_10007942 3300025912 Bacteria 9229
138 Ga0207707_10214007 3300025912 Bacteria 1678
139 Ga0207671_10052033 3300025914 Bacteria 3034
140 Ga0207671_10418075 3300025914 Bacteria 1067
141 Ga0207693_10009722 3300025915 Bacteria 7830
142 Ga0207693_10568330 3300025915 Bacteria 884
143 Ga0207663_10179273 3300025916 Bacteria 1512
144 Ga0207660_10002420 3300025917 Bacteria 12257
145 Ga0207660_10064050 3300025917 Bacteria 2652
146 Ga0207657_10001056 3300025919 Bacteria 29204
147 Ga0207649_10263837 3300025920 Unclassified 1246
148 Ga0207652_10020277 3300025921 Bacteria 5473
149 Ga0207694_10010992 3300025924 Bacteria 6837
150 Ga0207694_10083216 3300025924 Bacteria 2516
151 Ga0207694_10224263 3300025924 Bacteria 1534
152 Ga0207650_10542967 3300025925 Bacteria 974
153 Ga0207687_10153460 3300025927 Bacteria 1760
154 Ga0207700_10014731 3300025928 Bacteria 5132
155 Ga0207700_10470863 3300025928 Bacteria 1109
156 Ga0207664_10033662 3300025929 Bacteria 3940
157 Ga0207644_10280348 3300025931 Bacteria 1338
158 Ga0207706_10004468 3300025933 Bacteria 13134
159 Ga0207686_10284805 3300025934 Bacteria 1221
160 Ga0207669_10017954 3300025937 Bacteria 3643
161 Ga0207669_10595655 3300025937 Bacteria 898
162 Ga0207704_10067821 3300025938 Bacteria 2246
163 Ga0207665_10000194 3300025939 Bacteria 40747
164 Ga0207665_10018338 3300025939 Bacteria 4599
165 Ga0207665_10033456 3300025939 Bacteria 3407
166 Ga0207691_10067170 3300025940 Bacteria 3242
167 Ga0207661_10000876 3300025944 Bacteria 19798
168 Ga0207661_10000978 3300025944 Bacteria 18856
169 Ga0207679_10242760 3300025945 Unclassified 1527
170 Ga0207679_10484321 3300025945 Bacteria 1102
171 Ga0207651_10650371 3300025960 Bacteria 925
172 Ga0207658_10105140 3300025986 Bacteria 2220
173 Ga0207658_10746162 3300025986 Bacteria 886
174 Ga0207703_10119204 3300026035 Bacteria 2263
175 Ga0207678_10555752 3300026067 Bacteria 1004
176 Ga0207702_10000931 3300026078 Bacteria 30177
177 Ga0207641_10091990 3300026088 Bacteria 2656
178 Ga0207648_10036853 3300026089 Bacteria 4308
179 Ga0207676_10793772 3300026095 Bacteria 923
180 Ga0207674_10129270 3300026116 Bacteria 2490
181 Ga0207674_10231820 3300026116 Bacteria 1794
182 Ga0207674_10729956 3300026116 Bacteria 956
183 Ga0207683_10013948 3300026121 Bacteria 6853
184 Ga0209588_1002236 3300027671 Bacteria 5233
185 Ga0268265_10034669 3300028380 Bacteria 3681
186 Ga0268264_10000020 3300028381 Bacteria 483593
187 Ga0265318_10004229 3300028577 Bacteria 7005
188 Ga0307511_10027900 3300030521 Bacteria 5144
189 Ga0307511_10204401 3300030521 Unclassified 1019
190 Ga0265763_1012000 3300030763 Unclassified 821
191 Ga0265330_10004110 3300031235 Bacteria 7456
192 Ga0265330_10095378 3300031235 Unclassified 1275
193 Ga0265332_10006990 3300031238 Bacteria 5114
194 Ga0265332_10034822 3300031238 Bacteria 2188
195 Ga0265320_10015256 3300031240 Bacteria 4346
196 Ga0265325_10036484 3300031241 Bacteria 2603
197 Ga0265325_10045667 3300031241 Unclassified 2275
198 Ga0265325_10197846 3300031241 Bacteria 929
199 Ga0265329_10009312 3300031242 Bacteria 3670
200 Ga0265340_10001351 3300031247 Bacteria 14058
201 Ga0265340_10024123 3300031247 Bacteria 3091
202 Ga0265340_10112238 3300031247 Bacteria 1259
203 Ga0265339_10023622 3300031249 Bacteria 3552
204 Ga0265339_10041919 3300031249 Bacteria 2537
205 Ga0265339_10048863 3300031249 Bacteria 2318
206 Ga0265331_10037754 3300031250 Unclassified 2363
207 Ga0265331_10105071 3300031250 Bacteria 1297
208 Ga0265316_10087444 3300031344 Bacteria 2381
209 Ga0307509_10045936 3300031507 Bacteria 4704
210 Ga0307509_10458203 3300031507 Bacteria 968
211 Ga0265313_10016271 3300031595 Bacteria 4283
212 Ga0307508_10000025 3300031616 Bacteria 174642
213 Ga0307508_10454209 3300031616 Bacteria 874
214 Ga0265314_10001458 3300031711 Bacteria 26393
215 Ga0265314_10035914 3300031711 Bacteria 3609
216 Ga0265314_10057494 3300031711 Bacteria 2670
217 Ga0265314_10058265 3300031711 Bacteria 2647
218 Ga0265342_10007270 3300031712 Bacteria 8131
219 Ga0265342_10014256 3300031712 Bacteria 5284
220 Ga0265342_10014569 3300031712 Bacteria 5215
221 Ga0265342_10068648 3300031712 Bacteria 2071
222 Ga0265342_10197650 3300031712 Bacteria 1094
223 Ga0307516_10124744 3300031730 Bacteria 2361
224 Ga0307507_10092036 3300033179 Bacteria 2591
225 Ga0307510_10025977 3300033180 Bacteria 6744
226 Ga0316214_1031211 3300033545 Bacteria 757
227 Ga0373934_0024897 3300035086 Bacteria 2315
228 Ga0373934_0033694 3300035086 Bacteria 2011
229 Ga0373923_0020395 3300035111 Bacteria 2575
230 Ga0373923_0031289 3300035111 Bacteria 2144
231 Ga0373936_0243095 3300035113 Bacteria 802
232 Ga0373953_0038429 3300035117 Bacteria 1893
233 Ga0373954_0009900 3300035118 Bacteria 4198
234 Ga0373954_0014357 3300035118 Bacteria 3532
235 Ga0373954_0048897 3300035118 Bacteria 1982
236 Ga0373954_0091960 3300035118 Bacteria 1457
237 Ga0373956_0001688 3300035119 Bacteria 9097
238 Ga0373956_0047986 3300035119 Bacteria 1912
239 Ga0373957_0008815 3300035120 Bacteria 3285
240 Ga0373943_0002726 3300035170 Bacteria 8032
241 Ga0373943_0040217 3300035170 Bacteria 2257
242 Ga0373943_0146095 3300035170 Bacteria 1278
243 Ga0373946_0163375 3300035171 Bacteria 1047
244 Ga0373955_0009336 3300035172 Bacteria 4593
245 Ga0373955_0024145 3300035172 Bacteria 3105
246 Ga0373924_0020354 3300035410 Bacteria 2578
247 Ga0373935_0012434 3300035692 Bacteria 5120
248 Ga0373935_0034615 3300035692 Bacteria 3149
249 Ga0373935_0090502 3300035692 Bacteria 2002
250 Ga0373935_0258083 3300035692 Bacteria 1222
251 Ga0373927_0007505 3300035695 Bacteria 7374
252 Ga0373927_0089688 3300035695 Bacteria 1996
253 Ga0373927_0172474 3300035695 Bacteria 1418
254 Ga0373933_0058851 3300035724 Bacteria 2312
255 Ga0373933_0198735 3300035724 Bacteria 1282
256 Ga0373933_0566613 3300035724 Bacteria 745
257 Ga0373947_0027463 3300035725 Bacteria 3331
258 Ga0373947_0034020 3300035725 Bacteria 3013
259 Ga0373937_0310475 3300036401 Bacteria 1491
260 Ga0373937_0421699 3300036401 Bacteria 1266
261 Ga0372808_010158 3300036459 Bacteria 1321
262 Ga0373925_0003409 3300037068 Bacteria 12313
263 Ga0373925_0006116 3300037068 Bacteria 8897
264 Ga0373925_0014687 3300037068 Bacteria 5657
265 Ga0373925_0103712 3300037068 Bacteria 2189
266 Ga0395898_0051658 3300037466 Bacteria 4019
267 Ga0395901_0017612 3300038443 Bacteria 7295
268 Ga0436365_0711862 3300039437 Bacteria 1324
269 Ga0436365_1916011 3300039437 Bacteria 1566
270 Ga0439453_0005302 3300041408 Bacteria 1957
271 Ga0451853_1042173 3300041512 Bacteria 906
272 Ga0439441_028703 3300042001 Bacteria 1068
273 Ga0439443_003736 3300042003 Bacteria 1944
274 Ga0439435_0002197 3300042436 Bacteria 3816
275 Ga0450893_0045704 3300042532 Bacteria 811
276 Ga0451577_0716942 3300042876 Bacteria 905
277 Ga0466969_0104477 3300044656 Unclassified 1331
278 Ga0451576_0645680 3300045051 Bacteria 1112
279 Ga0495592_0028627 3300046454 Bacteria 4218
280 Ga0495592_0106207 3300046454 Bacteria 1993
281 Ga0495603_0007837 3300046455 Bacteria 6438
282 Ga0495603_0121928 3300046455 Bacteria 1519
283 Ga0495591_039184 3300046458 Bacteria 1360
284 Ga0495629_0001252 3300046459 Bacteria 19953
285 Ga0495629_0012160 3300046459 Bacteria 6237
286 Ga0495629_0080952 3300046459 Bacteria 2267
287 Ga0495638_0011046 3300046460 Bacteria 6240
288 Ga0495641_0010413 3300046461 Bacteria 5391
289 Ga0495651_0006647 3300046462 Bacteria 8839
290 Ga0495651_0030811 3300046462 Bacteria 4182
291 Ga0495651_0290736 3300046462 Bacteria 1100
292 Ga0495653_0024002 3300046463 Bacteria 4919
293 Ga0495653_0160811 3300046463 Bacteria 1559
294 Ga0495653_0246764 3300046463 Bacteria 1187
295 Ga0495580_0006686 3300046472 Bacteria 9359
296 Ga0495582_0002066 3300046473 Bacteria 11239
297 Ga0495605_0302543 3300046474 Bacteria 676
298 Ga0495639_0001991 3300046475 Bacteria 9054
299 Ga0495639_0012023 3300046475 Bacteria 3732
300 Ga0495662_0005330 3300046476 Bacteria 6442
301 Ga0495662_0080125 3300046476 Bacteria 1588
302 Ga0495664_0018547 3300046477 Bacteria 3989
303 Ga0495664_0063286 3300046477 Bacteria 2204
304 Ga0495585_0005773 3300046492 Bacteria 7764
305 Ga0495594_0003206 3300046499 Bacteria 8474
306 Ga0495594_0055287 3300046499 Bacteria 2188
307 Ga0495607_0038687 3300046501 Bacteria 2856
308 Ga0495606_0221165 3300046507 Bacteria 1067
309 Ga0495608_0017922 3300046511 Bacteria 4894
310 Ga0495608_0084528 3300046511 Bacteria 2058
311 Ga0495608_0118470 3300046511 Bacteria 1699
312 Ga0495610_0016363 3300046512 Bacteria 4273
313 Ga0495618_0087277 3300046514 Bacteria 1995
314 Ga0495618_0093764 3300046514 Bacteria 1920
315 Ga0495628_0021805 3300046516 Bacteria 5263
316 Ga0495628_0039096 3300046516 Bacteria 3795
317 Ga0495630_0011449 3300046517 Bacteria 6423
318 Ga0495630_0224816 3300046517 Bacteria 1433
319 Ga0495644_0027970 3300046523 Bacteria 2135
320 Ga0495663_0055070 3300046525 Bacteria 1240
321 Ga0495652_0025892 3300046529 Bacteria 5183
322 Ga0495652_0031736 3300046529 Bacteria 4623
323 Ga0495652_0103850 3300046529 Bacteria 2299
324 Ga0495665_0002799 3300046531 Bacteria 9412
325 Ga0495665_0055444 3300046531 Bacteria 2093
326 Ga0495640_0006125 3300046533 Bacteria 9533
327 Ga0495640_0065023 3300046533 Bacteria 2464
328 Ga0495640_0372983 3300046533 Bacteria 879
329 Ga0495586_0360568 3300046535 Unclassified 835
330 Ga0495587_0078629 3300046536 Bacteria 1913
331 Ga0495598_0076300 3300046537 Bacteria 1066
332 Ga0495621_0022303 3300046539 Bacteria 2097
333 Ga0495621_0030071 3300046539 Bacteria 1855
334 Ga0495645_0002070 3300046543 Bacteria 13648
335 Ga0495645_0030179 3300046543 Bacteria 3948
336 Ga0495622_0003052 3300046557 Bacteria 7949
337 Ga0495622_0026781 3300046557 Bacteria 2691
338 Ga0495633_0002841 3300046558 Bacteria 11923
339 Ga0495667_0006925 3300046559 Bacteria 7689
340 Ga0495667_0022397 3300046559 Bacteria 4256
341 Ga0495656_0042639 3300046615 Bacteria 1901
342 Ga0495634_0005305 3300046642 Bacteria 9947
343 Ga0495634_0016983 3300046642 Bacteria 5199
344 Ga0495634_0118677 3300046642 Bacteria 1695
345 Ga0495611_0015773 3300046648 Bacteria 3229
346 Ga0495635_0001193 3300046663 Bacteria 17302
347 Ga0495635_0020068 3300046663 Bacteria 4657
348 Ga0495588_0011562 3300046674 Bacteria 4146
349 Ga0495657_0128742 3300046675 Bacteria 1587
350 Ga0495599_0025814 3300046678 Bacteria 3680
351 Ga0495599_0028560 3300046678 Bacteria 3497
352 Ga0495623_0043179 3300046679 Bacteria 2869
353 Ga0495623_0173133 3300046679 Bacteria 1259
354 Ga0495646_0012137 3300046680 Bacteria 5477
355 Ga0495646_0047397 3300046680 Bacteria 2616
356 Ga0495646_0104727 3300046680 Bacteria 1617
357 Ga0495647_0003931 3300046681 Bacteria 4795
358 Ga0495647_0005047 3300046681 Bacteria 4320
359 Ga0495658_0001671 3300046683 Bacteria 11547
360 Ga0495613_0022696 3300046689 Bacteria 4675
361 Ga0495613_0065511 3300046689 Bacteria 2655
362 Ga0495624_0034993 3300046690 Bacteria 3245
363 Ga0495600_0010221 3300046809 Bacteria 5816
364 Ga0495600_0100867 3300046809 Bacteria 1882
365 Ga0495581_0001954 3300047315 Bacteria 11537
366 Ga0495581_0064251 3300047315 Bacteria 2120
367 Ga0495581_0175428 3300047315 Bacteria 1253
368 Ga0495604_0023640 3300047317 Bacteria 4904
369 Ga0495674_0009015 3300047319 Bacteria 9480
370 Ga0495674_0172795 3300047319 Bacteria 1802
371 Ga0495674_0414001 3300047319 Bacteria 1087
372 Ga0495676_0009448 3300047321 Bacteria 8881
373 Ga0495676_0135087 3300047321 Bacteria 1775
374 Ga0495680_0038379 3300047322 Bacteria 3827
375 Ga0495680_0057657 3300047322 Bacteria 3002
376 Ga0495677_0018444 3300047445 Bacteria 2530
377 Ga0495684_0000835 3300047471 Bacteria 24958
378 Ga0495684_0005632 3300047471 Bacteria 9760
379 Ga0495684_0115423 3300047471 Bacteria 2024
380 Ga0495686_0025256 3300047472 Bacteria 3897
381 Ga0495593_0008170 3300047673 Bacteria 6087
382 Ga0495593_0030902 3300047673 Bacteria 2928
383 Ga0495593_0044632 3300047673 Bacteria 2370
384 Ga0495614_0016153 3300048089 Bacteria 3251
385 Ga0495614_0062846 3300048089 Bacteria 1596
386 Ga0496104_0109451 3300048907 Bacteria 2648
387 Ga0496106_0008279 3300048909 Bacteria 7695
388 Ga0496106_0157071 3300048909 Bacteria 1797
389 Ga0496108_0061781 3300048911 Bacteria 3154
390 Ga0496111_0137234 3300048914 Bacteria 1812
391 Ga0496111_0189930 3300048914 Bacteria 1527
392 Ga0496112_0000039 3300048915 Bacteria 91123
393 Ga0496112_0642987 3300048915 Unclassified 991
394 Ga0496113_0241128 3300048916 Bacteria 1442
395 Ga0496115_0005640 3300048918 Bacteria 9108
396 Ga0496115_0147567 3300048918 Bacteria 1942
397 Ga0496115_0304294 3300048918 Bacteria 1306
398 Ga0496115_0637224 3300048918 Bacteria 844
399 Ga0496117_0016587 3300048920 Bacteria 6206
400 Ga0496118_0022704 3300048921 Bacteria 5474
401 Ga0496119_0147750 3300048922 Bacteria 1263
402 Ga0496120_0010640 3300048923 Bacteria 6395
403 Ga0496121_0007078 3300048924 Bacteria 13619
404 Ga0496121_0010211 3300048924 Bacteria 10628
405 Ga0496121_0122484 3300048924 Bacteria 1961
406 Ga0496124_0103662 3300048927 Bacteria 2301
407 Ga0496126_0033909 3300048929 Bacteria 4801
408 Ga0496126_0038185 3300048929 Bacteria 4470
409 Ga0496126_0038554 3300048929 Bacteria 4445
410 Ga0496126_0203395 3300048929 Bacteria 1671
411 Ga0496126_0225773 3300048929 Bacteria 1571
412 Ga0501070_0006733 3300049586 Bacteria 9786
413 nmdc:mga03683_183285_c1 3300050489 Unclassified 956
414 nmdc:mga03n38_3743_c1 3300050490 Unclassified 2165
415 nmdc:mga06z11_155617_c1 3300050494 Unclassified 1303
416 nmdc:mga08y16_257293_c1 3300050511 Bacteria 1803
417 Ga0495601_0043976 3300053077 Bacteria 2807
418 Ga0495595_0011892 3300053084 Bacteria 3648
419 Ga0495619_0017649 3300053085 Bacteria 4521
420 Ga0495619_0029783 3300053085 Bacteria 3529
421 Ga0500647_0058772 3300053091 Bacteria 1849
422 Ga0500647_0161224 3300053091 Bacteria 1041
423 Ga0500566_0000075 3300053094 Bacteria 48255
424 Ga0500566_0000166 3300053094 Bacteria 33843
425 Ga0500640_016561 3300053095 Bacteria 3111
426 Ga0500641_0003170 3300053096 Bacteria 5818
427 Ga0500554_006995 3300053102 Bacteria 2570
428 Ga0500556_0005119 3300053104 Bacteria 3709
429 Ga0500569_034032 3300053109 Bacteria 1452
430 Ga0500572_000975 3300053111 Bacteria 8675
431 Ga0500595_010972 3300053119 Bacteria 3572
432 Ga0500614_001306 3300053123 Bacteria 6016
433 Ga0500626_226350 3300053128 Bacteria 716
434 Ga0500652_000016 3300053131 Bacteria 126768
435 Ga0500559_0006018 3300053136 Bacteria 5505
436 Ga0500559_0152326 3300053136 Unclassified 1085
437 Ga0500568_0000057 3300053139 Bacteria 109287
438 Ga0500573_0008366 3300053140 Bacteria 5697
439 Ga0500590_135826 3300053148 Unclassified 1131
440 Ga0500603_000053 3300053150 Bacteria 28532
441 Ga0500603_000124 3300053150 Bacteria 18201
442 Ga0500603_032035 3300053150 Bacteria 1361
443 Ga0500616_0030579 3300053153 Bacteria 2956
444 Ga0500630_000448 3300053159 Bacteria 17947
445 Ga0500638_094098 3300053162 Bacteria 1407
446 Ga0500639_000309 3300053163 Bacteria 24089
447 Ga0500636_0102253 3300053177 Bacteria 1627
448 Ga0500637_0000181 3300053178 Bacteria 23527
449 Ga0500596_002917 3300053735 Bacteria 3314
450 Ga0500599_002419 3300053736 Bacteria 2238
451 Ga0501082_0000008 3300060353 Bacteria 125977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0225773 Ga0496126_0225773_486_1070 194
2 3300046455 Ga0495603_0121928 Ga0495603_0121928_47_691 196
3 3300035120 Ga0373957_0008815 Ga0373957_0008815_2451_3110 197
4 3300035725 Ga0373947_0027463 Ga0373947_0027463_157_801 197
5 3300046475 Ga0495639_0012023 Ga0495639_0012023_1417_2061 197
6 3300047315 Ga0495581_0064251 Ga0495581_0064251_1366_2010 197
7 3300047319 Ga0495674_0172795 Ga0495674_0172795_535_1179 197
8 3300025945 Ga0207679_10484321 Ga0207679_104843212 198
9 3300035724 Ga0373933_0566613 Ga0373933_0566613_105_704 199
10 3300005336 Ga0070680_100004381 Ga0070680_1000043818 200
11 3300005339 Ga0070660_100006367 Ga0070660_1000063672 200
12 3300005344 Ga0070661_100184804 Ga0070661_1001848042 200
13 3300005535 Ga0070684_100044955 Ga0070684_1000449554 200
14 3300005616 Ga0068852_101080960 Ga0068852_1010809602 200
15 3300025917 Ga0207660_10002420 Ga0207660_100024207 200
16 3300025919 Ga0207657_10001056 Ga0207657_100010562 200
17 3300025924 Ga0207694_10010992 Ga0207694_100109927 200
18 3300035113 Ga0373936_0243095 Ga0373936_0243095_140_784 200
19 3300035118 Ga0373954_0014357 Ga0373954_0014357_1739_2383 200
20 3300035170 Ga0373943_0040217 Ga0373943_0040217_383_1027 200
21 3300035171 Ga0373946_0163375 Ga0373946_0163375_178_822 200
22 3300035410 Ga0373924_0020354 Ga0373924_0020354_874_1518 200
23 3300035692 Ga0373935_0034615 Ga0373935_0034615_1737_2381 200
24 3300037068 Ga0373925_0003409 Ga0373925_0003409_1903_2547 200
25 3300046459 Ga0495629_0012160 Ga0495629_0012160_5275_5919 200
26 3300046476 Ga0495662_0080125 Ga0495662_0080125_851_1495 200
27 3300046477 Ga0495664_0063286 Ga0495664_0063286_838_1482 200
28 3300046511 Ga0495608_0118470 Ga0495608_0118470_698_1342 200
29 3300046514 Ga0495618_0093764 Ga0495618_0093764_604_1248 200
30 3300046531 Ga0495665_0055444 Ga0495665_0055444_245_889 200
31 3300046680 Ga0495646_0047397 Ga0495646_0047397_1590_2234 200
32 3300046681 Ga0495647_0003931 Ga0495647_0003931_2083_2727 200
33 3300046690 Ga0495624_0034993 Ga0495624_0034993_1020_1664 200
34 3300047321 Ga0495676_0135087 Ga0495676_0135087_178_822 200
35 3300047471 Ga0495684_0000835 Ga0495684_0000835_21173_21817 200
36 3300047673 Ga0495593_0030902 Ga0495593_0030902_168_812 200
37 3300048089 Ga0495614_0062846 Ga0495614_0062846_151_795 200
38 3300009174 Ga0105241_10211344 Ga0105241_102113442 201
39 3300013105 Ga0157369_10068642 Ga0157369_100686424 201
40 3300013307 Ga0157372_10097620 Ga0157372_100976204 201
41 3300046463 Ga0495653_0246764 Ga0495653_0246764_308_952 201
42 3300046474 Ga0495605_0302543 Ga0495605_0302543_11_628 202
43 3300005354 Ga0070675_100654712 Ga0070675_1006547122 204
44 3300037068 Ga0373925_0014687 Ga0373925_0014687_175_828 204
45 3300005329 Ga0070683_100001350 Ga0070683_1000013509 205
46 3300005336 Ga0070680_100005784 Ga0070680_1000057842 205
47 3300005458 Ga0070681_10145373 Ga0070681_101453732 205
48 3300005530 Ga0070679_100104595 Ga0070679_1001045953 205
49 3300005535 Ga0070684_100001137 Ga0070684_1000011378 205
50 3300005539 Ga0068853_100186616 Ga0068853_1001866162 205
51 3300005841 Ga0068863_100014067 Ga0068863_1000140672 205
52 3300025912 Ga0207707_10007942 Ga0207707_100079422 205
53 3300025917 Ga0207660_10064050 Ga0207660_100640503 205
54 3300025921 Ga0207652_10020277 Ga0207652_100202774 205
55 3300025924 Ga0207694_10083216 Ga0207694_100832162 205
56 3300025944 Ga0207661_10000876 Ga0207661_1000087610 205
57 3300026088 Ga0207641_10091990 Ga0207641_100919901 205
58 3300026116 Ga0207674_10129270 Ga0207674_101292702 205
59 3300030521 Ga0307511_10204401 Ga0307511_102044011 205
60 3300026116 Ga0207674_10231820 Ga0207674_102318203 206
61 3300053139 Ga0500568_0000057 Ga0500568_0000057_13088_13735 210
62 3300025914 Ga0207671_10418075 Ga0207671_104180752 211
63 3300005355 Ga0070671_100507043 Ga0070671_1005070432 212
64 3300005367 Ga0070667_100725939 Ga0070667_1007259392 212
65 3300005457 Ga0070662_100019649 Ga0070662_1000196492 212
66 3300005459 Ga0068867_100340806 Ga0068867_1003408062 212
67 3300006881 Ga0068865_100335989 Ga0068865_1003359892 212
68 3300009176 Ga0105242_10145835 Ga0105242_101458352 212
69 3300009177 Ga0105248_10008738 Ga0105248_100087383 212
70 3300009545 Ga0105237_10047065 Ga0105237_100470653 212
71 3300013306 Ga0163162_10122333 Ga0163162_101223333 212
72 3300017792 Ga0163161_10025092 Ga0163161_100250923 212
73 3300025931 Ga0207644_10280348 Ga0207644_102803483 212
74 3300025933 Ga0207706_10004468 Ga0207706_100044687 212
75 3300025934 Ga0207686_10284805 Ga0207686_102848052 212
76 3300025938 Ga0207704_10067821 Ga0207704_100678212 212
77 3300025986 Ga0207658_10746162 Ga0207658_107461621 212
78 3300046539 Ga0495621_0030071 Ga0495621_0030071_342_983 212
79 3300047445 Ga0495677_0018444 Ga0495677_0018444_101_742 212
80 3300005535 Ga0070684_100485174 Ga0070684_1004851742 213
81 3300005546 Ga0070696_100494286 Ga0070696_1004942862 213
82 3300005985 Ga0081539_10003401 Ga0081539_100034016 213
83 3300009545 Ga0105237_10146791 Ga0105237_101467912 213
84 3300013307 Ga0157372_10314234 Ga0157372_103142342 213
85 3300025914 Ga0207671_10052033 Ga0207671_100520333 213
86 iso_pu_bacteria 8006926726 8006932387 213
87 3300005327 Ga0070658_10202564 Ga0070658_102025643 214
88 3300006048 Ga0075363_100012256 Ga0075363_1000122563 214
89 3300006177 Ga0075362_10200926 Ga0075362_102009261 214
90 3300006178 Ga0075367_10503454 Ga0075367_105034542 214
91 3300006186 Ga0075369_10098186 Ga0075369_100981862 214
92 3300025937 Ga0207669_10595655 Ga0207669_105956551 214
93 3300039437 Ga0436365_1916011 Ga0436365_1916011_262_915 214
94 3300046543 Ga0495645_0030179 Ga0495645_0030179_548_1192 214
95 3300048907 Ga0496104_0109451 Ga0496104_0109451_858_1511 214
96 3300048911 Ga0496108_0061781 Ga0496108_0061781_709_1362 214
97 3300048914 Ga0496111_0189930 Ga0496111_0189930_289_942 214
98 3300050489 nmdc:mga03683_183285_c1 nmdc:mga03683_183285_c1_225_875 214
99 3300050490 nmdc:mga03n38_3743_c1 nmdc:mga03n38_3743_c1_194_844 214
100 3300050494 nmdc:mga06z11_155617_c1 nmdc:mga06z11_155617_c1_212_862 214
101 3300053091 Ga0500647_0161224 Ga0500647_0161224_44_688 214
102 3300053096 Ga0500641_0003170 Ga0500641_0003170_4503_5153 214
103 3300053102 Ga0500554_006995 Ga0500554_006995_65_709 214
104 3300053119 Ga0500595_010972 Ga0500595_010972_2403_3053 214
105 3300053131 Ga0500652_000016 Ga0500652_000016_42764_43414 214
106 3300053150 Ga0500603_000124 Ga0500603_000124_15892_16536 214
107 3300053178 Ga0500637_0000181 Ga0500637_0000181_14528_15172 214
108 iso_pu_bacteria 3005710791 3005713080 214
109 3300005333 Ga0070677_10094007 Ga0070677_100940072 215
110 3300005338 Ga0068868_100164526 Ga0068868_1001645264 215
111 3300005340 Ga0070689_100028949 Ga0070689_1000289496 215
112 3300005364 Ga0070673_100461258 Ga0070673_1004612581 215
113 3300005466 Ga0070685_10144930 Ga0070685_101449302 215
114 3300005544 Ga0070686_100534206 Ga0070686_1005342062 215
115 3300005618 Ga0068864_100029244 Ga0068864_1000292442 215
116 3300006058 Ga0075432_10066251 Ga0075432_100662511 215
117 3300006844 Ga0075428_100080372 Ga0075428_1000803723 215
118 3300007265 Ga0099794_10085915 Ga0099794_100859152 215
119 3300007788 Ga0099795_10052784 Ga0099795_100527842 215
120 3300009094 Ga0111539_10139723 Ga0111539_101397231 215
121 3300009553 Ga0105249_10498341 Ga0105249_104983412 215
122 3300014326 Ga0157380_10594887 Ga0157380_105948872 215
123 3300014968 Ga0157379_10298764 Ga0157379_102987642 215
124 3300025893 Ga0207682_10085081 Ga0207682_100850812 215
125 3300025925 Ga0207650_10542967 Ga0207650_105429673 215
126 3300035170 Ga0373943_0146095 Ga0373943_0146095_533_1180 215
127 3300035692 Ga0373935_0090502 Ga0373935_0090502_1344_1991 215
128 3300035695 Ga0373927_0089688 Ga0373927_0089688_348_995 215
129 3300037068 Ga0373925_0103712 Ga0373925_0103712_1244_1891 215
130 3300041408 Ga0439453_0005302 Ga0439453_0005302_335_997 215
131 3300042001 Ga0439441_028703 Ga0439441_028703_81_743 215
132 3300042003 Ga0439443_003736 Ga0439443_003736_749_1411 215
133 3300042436 Ga0439435_0002197 Ga0439435_0002197_1317_1979 215
134 3300042532 Ga0450893_0045704 Ga0450893_0045704_51_713 215
135 3300046557 Ga0495622_0026781 Ga0495622_0026781_1775_2422 215
136 3300048924 Ga0496121_0122484 Ga0496121_0122484_882_1529 215
137 3300048929 Ga0496126_0038185 Ga0496126_0038185_891_1538 215
138 3300050511 nmdc:mga08y16_257293_c1 nmdc:mga08y16_257293_c1_21_677 215
139 3300053150 Ga0500603_032035 Ga0500603_032035_515_1162 215
140 3300005985 Ga0081539_10054554 Ga0081539_100545542 216
141 3300006173 Ga0070716_100018019 Ga0070716_1000180193 216
142 3300025939 Ga0207665_10018338 Ga0207665_100183384 216
143 3300026067 Ga0207678_10555752 Ga0207678_105557521 216
144 3300028577 Ga0265318_10004229 Ga0265318_100042298 216
145 3300031235 Ga0265330_10095378 Ga0265330_100953782 216
146 3300031240 Ga0265320_10015256 Ga0265320_100152564 216
147 3300031241 Ga0265325_10045667 Ga0265325_100456672 216
148 3300031241 Ga0265325_10197846 Ga0265325_101978461 216
149 3300031242 Ga0265329_10009312 Ga0265329_100093123 216
150 3300031247 Ga0265340_10024123 Ga0265340_100241232 216
151 3300031247 Ga0265340_10112238 Ga0265340_101122382 216
152 3300031249 Ga0265339_10023622 Ga0265339_100236223 216
153 3300031250 Ga0265331_10037754 Ga0265331_100377542 216
154 3300031595 Ga0265313_10016271 Ga0265313_100162712 216
155 3300031711 Ga0265314_10057494 Ga0265314_100574942 216
156 3300031712 Ga0265342_10014569 Ga0265342_100145697 216
157 3300042876 Ga0451577_0716942 Ga0451577_0716942_53_712 216
158 3300046458 Ga0495591_039184 Ga0495591_039184_559_1218 216
159 3300046492 Ga0495585_0005773 Ga0495585_0005773_6204_6863 216
160 3300046499 Ga0495594_0055287 Ga0495594_0055287_1005_1664 216
161 3300046501 Ga0495607_0038687 Ga0495607_0038687_864_1523 216
162 3300046523 Ga0495644_0027970 Ga0495644_0027970_270_929 216
163 3300046525 Ga0495663_0055070 Ga0495663_0055070_473_1132 216
164 3300046537 Ga0495598_0076300 Ga0495598_0076300_351_1010 216
165 3300046558 Ga0495633_0002841 Ga0495633_0002841_784_1443 216
166 3300046648 Ga0495611_0015773 Ga0495611_0015773_1723_2382 216
167 3300048916 Ga0496113_0241128 Ga0496113_0241128_436_1104 216
168 3300048918 Ga0496115_0147567 Ga0496115_0147567_731_1399 216
169 3300005293 Ga0065715_10126737 Ga0065715_101267371 217
170 3300005353 Ga0070669_100072671 Ga0070669_1000726712 217
171 3300005356 Ga0070674_100009522 Ga0070674_1000095226 217
172 3300005456 Ga0070678_100031723 Ga0070678_1000317234 217
173 3300005548 Ga0070665_100322862 Ga0070665_1003228622 217
174 3300005548 Ga0070665_100499152 Ga0070665_1004991522 217
175 3300005617 Ga0068859_100107949 Ga0068859_1001079492 217
176 3300005841 Ga0068863_100255283 Ga0068863_1002552831 217
177 3300005842 Ga0068858_100224675 Ga0068858_1002246752 217
178 3300005843 Ga0068860_100937450 Ga0068860_1009374501 217
179 3300006358 Ga0068871_100029518 Ga0068871_1000295185 217
180 3300006931 Ga0097620_100107941 Ga0097620_1001079412 217
181 3300009098 Ga0105245_10050839 Ga0105245_100508394 217
182 3300009098 Ga0105245_10923085 Ga0105245_109230852 217
183 3300009098 Ga0105245_11092148 Ga0105245_110921481 217
184 3300009101 Ga0105247_10156712 Ga0105247_101567122 217
185 3300009177 Ga0105248_10031594 Ga0105248_100315943 217
186 3300009545 Ga0105237_10118667 Ga0105237_101186673 217
187 3300011119 Ga0105246_10377378 Ga0105246_103773782 217
188 3300013104 Ga0157370_10033790 Ga0157370_100337905 217
189 3300013105 Ga0157369_10002453 Ga0157369_1000245318 217
190 3300013297 Ga0157378_10507905 Ga0157378_105079051 217
191 3300014497 Ga0182008_10081611 Ga0182008_100816112 217
192 3300015261 Ga0182006_1000201 Ga0182006_10002015 217
193 3300015262 Ga0182007_10081637 Ga0182007_100816371 217
194 3300020082 Ga0206353_11725562 Ga0206353_117255622 217
195 3300025899 Ga0207642_10316615 Ga0207642_103166151 217
196 3300025900 Ga0207710_10001695 Ga0207710_1000169515 217
197 3300025900 Ga0207710_10113221 Ga0207710_101132212 217
198 3300025907 Ga0207645_10236147 Ga0207645_102361472 217
199 3300025927 Ga0207687_10153460 Ga0207687_101534602 217
200 3300025937 Ga0207669_10017954 Ga0207669_100179545 217
201 3300025940 Ga0207691_10067170 Ga0207691_100671703 217
202 3300025960 Ga0207651_10650371 Ga0207651_106503712 217
203 3300025986 Ga0207658_10105140 Ga0207658_101051402 217
204 3300026035 Ga0207703_10119204 Ga0207703_101192043 217
205 3300026089 Ga0207648_10036853 Ga0207648_100368533 217
206 3300026095 Ga0207676_10793772 Ga0207676_107937722 217
207 3300026121 Ga0207683_10013948 Ga0207683_100139485 217
208 3300028381 Ga0268264_10000020 Ga0268264_10000020163 217
209 3300030521 Ga0307511_10027900 Ga0307511_100279004 217
210 3300031507 Ga0307509_10045936 Ga0307509_100459365 217
211 3300031730 Ga0307516_10124744 Ga0307516_101247442 217
212 3300033179 Ga0307507_10092036 Ga0307507_100920363 217
213 3300041512 Ga0451853_1042173 Ga0451853_1042173_98_751 217
214 3300046533 Ga0495640_0372983 Ga0495640_0372983_141_809 217
215 3300046539 Ga0495621_0022303 Ga0495621_0022303_125_784 217
216 3300046615 Ga0495656_0042639 Ga0495656_0042639_317_976 217
217 3300046678 Ga0495599_0028560 Ga0495599_0028560_918_1583 217
218 3300047319 Ga0495674_0414001 Ga0495674_0414001_328_993 217
219 3300048909 Ga0496106_0008279 Ga0496106_0008279_2160_2825 217
220 3300048920 Ga0496117_0016587 Ga0496117_0016587_2122_2787 217
221 3300048921 Ga0496118_0022704 Ga0496118_0022704_779_1444 217
222 3300048924 Ga0496121_0007078 Ga0496121_0007078_12525_13178 217
223 3300048924 Ga0496121_0010211 Ga0496121_0010211_4717_5382 217
224 3300048927 Ga0496124_0103662 Ga0496124_0103662_31_696 217
225 3300048929 Ga0496126_0038554 Ga0496126_0038554_131_796 217
226 3300048929 Ga0496126_0203395 Ga0496126_0203395_924_1577 217
227 3300053136 Ga0500559_0152326 Ga0500559_0152326_167_832 217
228 3300053140 Ga0500573_0008366 Ga0500573_0008366_4770_5435 217
229 3300053148 Ga0500590_135826 Ga0500590_135826_337_1005 217
230 3300053162 Ga0500638_094098 Ga0500638_094098_348_1016 217
231 3300053177 Ga0500636_0102253 Ga0500636_0102253_828_1493 217
232 3300005330 Ga0070690_100585510 Ga0070690_1005855101 218
233 3300005344 Ga0070661_100334649 Ga0070661_1003346491 218
234 3300005435 Ga0070714_100106686 Ga0070714_1001066862 218
235 3300005436 Ga0070713_100006029 Ga0070713_1000060293 218
236 3300005458 Ga0070681_10133416 Ga0070681_101334163 218
237 3300005467 Ga0070706_100092289 Ga0070706_1000922892 218
238 3300005518 Ga0070699_100608193 Ga0070699_1006081931 218
239 3300005547 Ga0070693_100186494 Ga0070693_1001864941 218
240 3300005577 Ga0068857_100789246 Ga0068857_1007892462 218
241 3300005614 Ga0068856_100000183 Ga0068856_10000018329 218
242 3300006028 Ga0070717_10000620 Ga0070717_100006204 218
243 3300006028 Ga0070717_10096261 Ga0070717_100962612 218
244 3300007265 Ga0099794_10082119 Ga0099794_100821192 218
245 3300007788 Ga0099795_10014712 Ga0099795_100147123 218
246 3300009093 Ga0105240_10771301 Ga0105240_107713012 218
247 3300009101 Ga0105247_10226382 Ga0105247_102263822 218
248 3300010159 Ga0099796_10053169 Ga0099796_100531692 218
249 3300013105 Ga0157369_10021884 Ga0157369_100218849 218
250 3300013105 Ga0157369_11065505 Ga0157369_110655052 218
251 3300013307 Ga0157372_10291682 Ga0157372_102916822 218
252 3300025910 Ga0207684_10041923 Ga0207684_100419234 218
253 3300025910 Ga0207684_10147282 Ga0207684_101472823 218
254 3300025912 Ga0207707_10214007 Ga0207707_102140072 218
255 3300025920 Ga0207649_10263837 Ga0207649_102638371 218
256 3300025924 Ga0207694_10224263 Ga0207694_102242631 218
257 3300025928 Ga0207700_10014731 Ga0207700_100147315 218
258 3300025929 Ga0207664_10033662 Ga0207664_100336624 218
259 3300025945 Ga0207679_10242760 Ga0207679_102427602 218
260 3300026078 Ga0207702_10000931 Ga0207702_100009315 218
261 3300026116 Ga0207674_10729956 Ga0207674_107299561 218
262 3300028380 Ga0268265_10034669 Ga0268265_100346691 218
263 3300030763 Ga0265763_1012000 Ga0265763_10120001 218
264 3300031235 Ga0265330_10004110 Ga0265330_100041107 218
265 3300031238 Ga0265332_10006990 Ga0265332_100069903 218
266 3300031241 Ga0265325_10036484 Ga0265325_100364843 218
267 3300031247 Ga0265340_10001351 Ga0265340_100013513 218
268 3300031249 Ga0265339_10041919 Ga0265339_100419193 218
269 3300031250 Ga0265331_10105071 Ga0265331_101050712 218
270 3300031344 Ga0265316_10087444 Ga0265316_100874442 218
271 3300031507 Ga0307509_10458203 Ga0307509_104582032 218
272 3300031616 Ga0307508_10454209 Ga0307508_104542091 218
273 3300031711 Ga0265314_10001458 Ga0265314_100014583 218
274 3300031711 Ga0265314_10035914 Ga0265314_100359143 218
275 3300031712 Ga0265342_10014256 Ga0265342_100142563 218
276 3300031712 Ga0265342_10068648 Ga0265342_100686484 218
277 3300031712 Ga0265342_10197650 Ga0265342_101976501 218
278 3300033180 Ga0307510_10025977 Ga0307510_100259773 218
279 3300035111 Ga0373923_0020395 Ga0373923_0020395_989_1678 218
280 3300035119 Ga0373956_0047986 Ga0373956_0047986_129_818 218
281 3300035170 Ga0373943_0002726 Ga0373943_0002726_2392_3048 218
282 3300035172 Ga0373955_0009336 Ga0373955_0009336_3339_4028 218
283 3300035692 Ga0373935_0012434 Ga0373935_0012434_97_753 218
284 3300035695 Ga0373927_0007505 Ga0373927_0007505_1328_1984 218
285 3300035695 Ga0373927_0172474 Ga0373927_0172474_17_673 218
286 3300035724 Ga0373933_0198735 Ga0373933_0198735_102_758 218
287 3300035725 Ga0373947_0034020 Ga0373947_0034020_429_1085 218
288 3300036459 Ga0372808_010158 Ga0372808_010158_562_1221 218
289 3300037068 Ga0373925_0006116 Ga0373925_0006116_2033_2722 218
290 3300037466 Ga0395898_0051658 Ga0395898_0051658_1705_2385 218
291 3300038443 Ga0395901_0017612 Ga0395901_0017612_522_1202 218
292 3300044656 Ga0466969_0104477 Ga0466969_0104477_389_1045 218
293 3300045051 Ga0451576_0645680 Ga0451576_0645680_109_777 218
294 3300046455 Ga0495603_0007837 Ga0495603_0007837_3870_4559 218
295 3300046459 Ga0495629_0001252 Ga0495629_0001252_11111_11800 218
296 3300046460 Ga0495638_0011046 Ga0495638_0011046_1855_2517 218
297 3300046461 Ga0495641_0010413 Ga0495641_0010413_1134_1790 218
298 3300046463 Ga0495653_0160811 Ga0495653_0160811_742_1431 218
299 3300046472 Ga0495580_0006686 Ga0495580_0006686_2146_2802 218
300 3300046473 Ga0495582_0002066 Ga0495582_0002066_2140_2829 218
301 3300046475 Ga0495639_0001991 Ga0495639_0001991_2180_2836 218
302 3300046476 Ga0495662_0005330 Ga0495662_0005330_1736_2425 218
303 3300046499 Ga0495594_0003206 Ga0495594_0003206_4582_5238 218
304 3300046507 Ga0495606_0221165 Ga0495606_0221165_59_715 218
305 3300046512 Ga0495610_0016363 Ga0495610_0016363_3480_4142 218
306 3300046517 Ga0495630_0011449 Ga0495630_0011449_2980_3669 218
307 3300046529 Ga0495652_0025892 Ga0495652_0025892_2635_3291 218
308 3300046531 Ga0495665_0002799 Ga0495665_0002799_5850_6506 218
309 3300046533 Ga0495640_0006125 Ga0495640_0006125_6820_7476 218
310 3300046557 Ga0495622_0003052 Ga0495622_0003052_2468_3124 218
311 3300046559 Ga0495667_0022397 Ga0495667_0022397_3068_3757 218
312 3300046642 Ga0495634_0005305 Ga0495634_0005305_7049_7738 218
313 3300046663 Ga0495635_0001193 Ga0495635_0001193_829_1485 218
314 3300046674 Ga0495588_0011562 Ga0495588_0011562_1006_1662 218
315 3300046681 Ga0495647_0005047 Ga0495647_0005047_1583_2272 218
316 3300046683 Ga0495658_0001671 Ga0495658_0001671_3786_4442 218
317 3300046689 Ga0495613_0022696 Ga0495613_0022696_2013_2669 218
318 3300046809 Ga0495600_0100867 Ga0495600_0100867_1169_1858 218
319 3300047315 Ga0495581_0001954 Ga0495581_0001954_9294_9950 218
320 3300047319 Ga0495674_0009015 Ga0495674_0009015_1842_2531 218
321 3300047321 Ga0495676_0009448 Ga0495676_0009448_6558_7247 218
322 3300047472 Ga0495686_0025256 Ga0495686_0025256_1522_2178 218
323 3300047673 Ga0495593_0008170 Ga0495593_0008170_3139_3795 218
324 3300048089 Ga0495614_0016153 Ga0495614_0016153_848_1504 218
325 3300048914 Ga0496111_0137234 Ga0496111_0137234_355_1011 218
326 3300048915 Ga0496112_0642987 Ga0496112_0642987_114_770 218
327 3300048918 Ga0496115_0637224 Ga0496115_0637224_29_688 218
328 3300048922 Ga0496119_0147750 Ga0496119_0147750_487_1149 218
329 3300048923 Ga0496120_0010640 Ga0496120_0010640_2387_3049 218
330 3300048929 Ga0496126_0033909 Ga0496126_0033909_1069_1725 218
331 3300053085 Ga0495619_0017649 Ga0495619_0017649_418_1074 218
332 3300053094 Ga0500566_0000166 Ga0500566_0000166_1746_2408 218
333 3300053104 Ga0500556_0005119 Ga0500556_0005119_743_1405 218
334 3300053109 Ga0500569_034032 Ga0500569_034032_724_1380 218
335 3300053128 Ga0500626_226350 Ga0500626_226350_26_688 218
336 3300053153 Ga0500616_0030579 Ga0500616_0030579_786_1448 218
337 3300053736 Ga0500599_002419 Ga0500599_002419_98_760 218
338 3300060353 Ga0501082_0000008 Ga0501082_0000008_116749_117477 218
339 3300003203 JGI25406J46586_10000019 JGI25406J46586_100000191 219
340 3300003322 rootL2_10341808 rootL2_103418082 219
341 3300003323 rootH1_10015906 rootH1_100159069 219
342 3300005434 Ga0070709_10239670 Ga0070709_102396702 219
343 3300005434 Ga0070709_10497577 Ga0070709_104975771 219
344 3300005435 Ga0070714_100632307 Ga0070714_1006323071 219
345 3300005436 Ga0070713_100020265 Ga0070713_1000202652 219
346 3300005436 Ga0070713_100486124 Ga0070713_1004861241 219
347 3300005436 Ga0070713_100689487 Ga0070713_1006894871 219
348 3300005436 Ga0070713_101096951 Ga0070713_1010969511 219
349 3300005437 Ga0070710_10004892 Ga0070710_100048924 219
350 3300005437 Ga0070710_10007397 Ga0070710_100073976 219
351 3300005439 Ga0070711_100358838 Ga0070711_1003588381 219
352 3300005535 Ga0070684_100001541 Ga0070684_1000015418 219
353 3300005985 Ga0081539_10000003 Ga0081539_10000003170 219
354 3300006028 Ga0070717_10089663 Ga0070717_100896632 219
355 3300006028 Ga0070717_10096213 Ga0070717_100962133 219
356 3300006028 Ga0070717_10309282 Ga0070717_103092821 219
357 3300006163 Ga0070715_10036714 Ga0070715_100367142 219
358 3300006163 Ga0070715_10192062 Ga0070715_101920621 219
359 3300006173 Ga0070716_100331259 Ga0070716_1003312591 219
360 3300006175 Ga0070712_100004971 Ga0070712_1000049712 219
361 3300006175 Ga0070712_100355237 Ga0070712_1003552372 219
362 3300013104 Ga0157370_11142434 Ga0157370_111424341 219
363 3300014969 Ga0157376_10231454 Ga0157376_102314542 219
364 3300025898 Ga0207692_10056745 Ga0207692_100567452 219
365 3300025898 Ga0207692_10142740 Ga0207692_101427401 219
366 3300025905 Ga0207685_10077418 Ga0207685_100774182 219
367 3300025906 Ga0207699_10133548 Ga0207699_101335481 219
368 3300025906 Ga0207699_10389096 Ga0207699_103890962 219
369 3300025915 Ga0207693_10009722 Ga0207693_100097225 219
370 3300025915 Ga0207693_10568330 Ga0207693_105683301 219
371 3300025916 Ga0207663_10179273 Ga0207663_101792732 219
372 3300025928 Ga0207700_10470863 Ga0207700_104708631 219
373 3300025939 Ga0207665_10000194 Ga0207665_1000019411 219
374 3300025939 Ga0207665_10033456 Ga0207665_100334562 219
375 3300025944 Ga0207661_10000978 Ga0207661_1000097814 219
376 3300027671 Ga0209588_1002236 Ga0209588_10022364 219
377 3300031238 Ga0265332_10034822 Ga0265332_100348222 219
378 3300031249 Ga0265339_10048863 Ga0265339_100488633 219
379 3300031616 Ga0307508_10000025 Ga0307508_1000002542 219
380 3300031711 Ga0265314_10058265 Ga0265314_100582653 219
381 3300031712 Ga0265342_10007270 Ga0265342_100072702 219
382 3300033545 Ga0316214_1031211 Ga0316214_10312111 219
383 3300035086 Ga0373934_0024897 Ga0373934_0024897_787_1446 219
384 3300035086 Ga0373934_0033694 Ga0373934_0033694_542_1201 219
385 3300035111 Ga0373923_0031289 Ga0373923_0031289_1101_1760 219
386 3300035117 Ga0373953_0038429 Ga0373953_0038429_1118_1777 219
387 3300035118 Ga0373954_0009900 Ga0373954_0009900_2457_3116 219
388 3300035118 Ga0373954_0048897 Ga0373954_0048897_21_680 219
389 3300035118 Ga0373954_0091960 Ga0373954_0091960_33_692 219
390 3300035119 Ga0373956_0001688 Ga0373956_0001688_5261_5920 219
391 3300035172 Ga0373955_0024145 Ga0373955_0024145_1548_2207 219
392 3300035692 Ga0373935_0258083 Ga0373935_0258083_428_1087 219
393 3300035724 Ga0373933_0058851 Ga0373933_0058851_872_1531 219
394 3300036401 Ga0373937_0310475 Ga0373937_0310475_45_704 219
395 3300036401 Ga0373937_0421699 Ga0373937_0421699_537_1196 219
396 3300039437 Ga0436365_0711862 Ga0436365_0711862_645_1304 219
397 3300046454 Ga0495592_0028627 Ga0495592_0028627_311_970 219
398 3300046454 Ga0495592_0106207 Ga0495592_0106207_541_1200 219
399 3300046459 Ga0495629_0080952 Ga0495629_0080952_559_1218 219
400 3300046462 Ga0495651_0006647 Ga0495651_0006647_4987_5646 219
401 3300046462 Ga0495651_0030811 Ga0495651_0030811_3035_3694 219
402 3300046462 Ga0495651_0290736 Ga0495651_0290736_370_1029 219
403 3300046463 Ga0495653_0024002 Ga0495653_0024002_3144_3803 219
404 3300046477 Ga0495664_0018547 Ga0495664_0018547_847_1506 219
405 3300046511 Ga0495608_0017922 Ga0495608_0017922_367_1026 219
406 3300046511 Ga0495608_0084528 Ga0495608_0084528_590_1249 219
407 3300046514 Ga0495618_0087277 Ga0495618_0087277_853_1512 219
408 3300046516 Ga0495628_0021805 Ga0495628_0021805_294_953 219
409 3300046516 Ga0495628_0039096 Ga0495628_0039096_960_1619 219
410 3300046517 Ga0495630_0224816 Ga0495630_0224816_13_672 219
411 3300046529 Ga0495652_0031736 Ga0495652_0031736_2040_2699 219
412 3300046529 Ga0495652_0103850 Ga0495652_0103850_361_1020 219
413 3300046533 Ga0495640_0065023 Ga0495640_0065023_919_1578 219
414 3300046535 Ga0495586_0360568 Ga0495586_0360568_149_808 219
415 3300046536 Ga0495587_0078629 Ga0495587_0078629_696_1355 219
416 3300046543 Ga0495645_0002070 Ga0495645_0002070_5452_6111 219
417 3300046559 Ga0495667_0006925 Ga0495667_0006925_5751_6410 219
418 3300046642 Ga0495634_0016983 Ga0495634_0016983_1724_2383 219
419 3300046642 Ga0495634_0118677 Ga0495634_0118677_937_1596 219
420 3300046663 Ga0495635_0020068 Ga0495635_0020068_1023_1682 219
421 3300046675 Ga0495657_0128742 Ga0495657_0128742_184_843 219
422 3300046678 Ga0495599_0025814 Ga0495599_0025814_900_1559 219
423 3300046679 Ga0495623_0043179 Ga0495623_0043179_942_1601 219
424 3300046679 Ga0495623_0173133 Ga0495623_0173133_244_903 219
425 3300046680 Ga0495646_0012137 Ga0495646_0012137_1041_1700 219
426 3300046680 Ga0495646_0104727 Ga0495646_0104727_942_1601 219
427 3300046689 Ga0495613_0065511 Ga0495613_0065511_1311_1970 219
428 3300046809 Ga0495600_0010221 Ga0495600_0010221_4387_5046 219
429 3300047315 Ga0495581_0175428 Ga0495581_0175428_140_799 219
430 3300047317 Ga0495604_0023640 Ga0495604_0023640_2656_3315 219
431 3300047322 Ga0495680_0038379 Ga0495680_0038379_2756_3415 219
432 3300047322 Ga0495680_0057657 Ga0495680_0057657_2122_2781 219
433 3300047471 Ga0495684_0005632 Ga0495684_0005632_4543_5202 219
434 3300047471 Ga0495684_0115423 Ga0495684_0115423_379_1038 219
435 3300047673 Ga0495593_0044632 Ga0495593_0044632_430_1089 219
436 3300048909 Ga0496106_0157071 Ga0496106_0157071_702_1433 219
437 3300048915 Ga0496112_0000039 Ga0496112_0000039_88050_88709 219
438 3300048918 Ga0496115_0005640 Ga0496115_0005640_6048_6707 219
439 3300048918 Ga0496115_0304294 Ga0496115_0304294_500_1231 219
440 3300049586 Ga0501070_0006733 Ga0501070_0006733_5555_6214 219
441 3300053077 Ga0495601_0043976 Ga0495601_0043976_423_1082 219
442 3300053084 Ga0495595_0011892 Ga0495595_0011892_2679_3338 219
443 3300053085 Ga0495619_0029783 Ga0495619_0029783_1590_2249 219
444 3300053091 Ga0500647_0058772 Ga0500647_0058772_720_1379 219
445 3300053094 Ga0500566_0000075 Ga0500566_0000075_17687_18346 219
446 3300053095 Ga0500640_016561 Ga0500640_016561_2234_2893 219
447 3300053111 Ga0500572_000975 Ga0500572_000975_898_1557 219
448 3300053123 Ga0500614_001306 Ga0500614_001306_5060_5719 219
449 3300053136 Ga0500559_0006018 Ga0500559_0006018_4036_4695 219
450 3300053150 Ga0500603_000053 Ga0500603_000053_3116_3775 219
451 3300053159 Ga0500630_000448 Ga0500630_000448_874_1533 219
452 3300053163 Ga0500639_000309 Ga0500639_000309_17407_18066 219
453 3300053735 Ga0500596_002917 Ga0500596_002917_470_1129 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

25

100

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

34

101

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

29

106

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9469 4 210
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9396 4 211
3niv-assembly1.cif.gz_B the crystal structure of glutathione s-transferase from legionella pneumophila 0.9292 4 206
3niv-assembly2.cif.gz_D the crystal structure of glutathione s-transferase from legionella pneumophila 0.9273 4 208
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.9266 3 212
ID Description Score Start End Superfamily
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9661 2 76 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9644 3 78 3.40.30.10
4pxoB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.96 6 78 3.40.30.10
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9597 3 65 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9566 3 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A429MKP1-F1-model_v4 Maleylacetoacetate isomerase 0.9755 4 98 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A438JAI0-F1-model_v4 Glutathione S-transferase zeta class 0.9745 2 93 GO:0016740
AF-A0A7Y1Z2B7-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9589 4 212 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A128F930-F1-model_v4 Maleylpyruvate isomerase (EC 5.2.1.4) 0.9576 4 209 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
GO:0050077
AF-A0A7J9MFQ6-F1-model_v4 GST N-terminal domain-containing protein 0.9571 2 113 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
94.02 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map