F447209

General Info

Members Datasets Scaffolds Average Seq Length
453 243 904 202

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10101044|Ga0307517_101010442
Length 230
Sequence MGPAGKRVPDGFAVCSADPRCPPVNKDVAQEVSRPDGSDERYSVVAVAASAGGIIALGALLGALPVGLPVPVLVVQHLDPRHETVIAHVLARSARLPVKLAEAGELARPGTIYVAPPNLHLLVGAGGLLTLSDSELVHFVRPSADLLFESVAGAYGARAIACVLTGTGKDGAMGVTAVKSRGGTVIAQDPGSADFPGMPQAAVETGVVDFVLPLDEIAQVVRGLVAQADQ

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
234 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
238 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
239 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
240 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
241 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
242 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
243 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 1.99
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10101044 3300028786 Bacteria 2273
2 JGI25406J46586_10008911 3300003203 Bacteria 4514
3 rootH2_10106203 3300003320 Bacteria 2893
4 rootH1_10014112 3300003323 Bacteria 29521
5 JGI25404J52841_10000325 3300003659 Bacteria 6323
6 JGI25404J52841_10026448 3300003659 Bacteria 1248
7 Ga0070666_10213685 3300005335 Unclassified 1359
8 Ga0068868_100022844 3300005338 Bacteria 4727
9 Ga0070671_100214441 3300005355 Bacteria 1633
10 Ga0070709_10033740 3300005434 Bacteria 3098
11 Ga0070714_100000032 3300005435 Bacteria 133378
12 Ga0070663_100037707 3300005455 Bacteria 3367
13 Ga0070662_100129570 3300005457 Bacteria 1943
14 Ga0070706_100047583 3300005467 Bacteria 3957
15 Ga0070706_100283956 3300005467 Unclassified 1545
16 Ga0070707_100165966 3300005468 Bacteria 2152
17 Ga0070699_100059328 3300005518 Bacteria 3314
18 Ga0070699_100554943 3300005518 Bacteria 1046
19 Ga0070697_100001761 3300005536 Bacteria 16521
20 Ga0070697_100113910 3300005536 Bacteria 2256
21 Ga0070697_100476728 3300005536 Bacteria 1089
22 Ga0068853_100134644 3300005539 Bacteria 2214
23 Ga0068853_100168040 3300005539 Bacteria 1983
24 Ga0070672_100158233 3300005543 Bacteria 1878
25 Ga0070695_100442255 3300005545 Bacteria 994
26 Ga0070696_100075377 3300005546 Bacteria 2380
27 Ga0070665_100465840 3300005548 Bacteria 1274
28 Ga0068855_100007464 3300005563 Bacteria 13243
29 Ga0068854_100058148 3300005578 Bacteria 2790
30 Ga0068852_100050049 3300005616 Bacteria 3578
31 Ga0068863_100242298 3300005841 Bacteria 1740
32 Ga0068862_100233327 3300005844 Bacteria 1670
33 Ga0081455_10000265 3300005937 Bacteria 68995
34 Ga0081455_10001518 3300005937 Bacteria 28622
35 Ga0081455_10001771 3300005937 Bacteria 26093
36 Ga0081455_10074676 3300005937 Bacteria 2800
37 Ga0081455_10451229 3300005937 Bacteria 878
38 Ga0081538_10008072 3300005981 Bacteria 8989
39 Ga0081538_10023604 3300005981 Bacteria 4414
40 Ga0081540_1000244 3300005983 Bacteria 57049
41 Ga0081540_1002203 3300005983 Bacteria 16098
42 Ga0081539_10000009 3300005985 Bacteria 509286
43 Ga0070717_10076289 3300006028 Bacteria 2805
44 Ga0070717_10453213 3300006028 Bacteria 1156
45 Ga0075432_10033343 3300006058 Bacteria 1786
46 Ga0070715_10158137 3300006163 Unclassified 1117
47 Ga0070712_100116101 3300006175 Bacteria 2007
48 Ga0075428_100005881 3300006844 Bacteria 13628
49 Ga0075428_100145375 3300006844 Bacteria 2577
50 Ga0075428_100209501 3300006844 Bacteria 2106
51 Ga0075428_100360700 3300006844 Bacteria 1559
52 Ga0075428_100619703 3300006844 Bacteria 1155
53 Ga0075430_100215809 3300006846 Bacteria 1592
54 Ga0075431_100002129 3300006847 Bacteria 18929
55 Ga0075431_100433617 3300006847 Bacteria 1312
56 Ga0075431_100831730 3300006847 Bacteria 895
57 Ga0075433_10001127 3300006852 Bacteria 19352
58 Ga0075433_10023613 3300006852 Bacteria 5178
59 Ga0075433_10060007 3300006852 Bacteria 3329
60 Ga0075433_10071675 3300006852 Bacteria 3046
61 Ga0075433_10081538 3300006852 Bacteria 2853
62 Ga0075434_100064770 3300006871 Bacteria 3640
63 Ga0075434_100064839 3300006871 Bacteria 3638
64 Ga0075434_100066009 3300006871 Bacteria 3604
65 Ga0075434_100101969 3300006871 Bacteria 2877
66 Ga0075434_100158590 3300006871 Bacteria 2282
67 Ga0075434_100909651 3300006871 Unclassified 895
68 Ga0075434_101080049 3300006871 Bacteria 816
69 Ga0075429_100003482 3300006880 Bacteria 13430
70 Ga0075429_100729522 3300006880 Unclassified 868
71 Ga0075436_100001491 3300006914 Bacteria 15964
72 Ga0075436_100004745 3300006914 Bacteria 9328
73 Ga0075435_100009134 3300007076 Bacteria 7158
74 Ga0075435_100081046 3300007076 Bacteria 2665
75 Ga0075435_100271661 3300007076 Bacteria 1446
76 Ga0075435_100360269 3300007076 Unclassified 1247
77 Ga0075435_100783573 3300007076 Bacteria 830
78 Ga0099794_10357829 3300007265 Bacteria 760
79 Ga0105240_10056234 3300009093 Bacteria 4924
80 Ga0111539_10000446 3300009094 Bacteria 51962
81 Ga0111539_10017914 3300009094 Bacteria 8773
82 Ga0111539_10026787 3300009094 Bacteria 7044
83 Ga0111539_10092549 3300009094 Bacteria 3553
84 Ga0111539_10114283 3300009094 Bacteria 3166
85 Ga0111539_10210490 3300009094 Bacteria 2266
86 Ga0105247_10289330 3300009101 Bacteria 1133
87 Ga0114129_10000176 3300009147 Bacteria 70596
88 Ga0114129_10000305 3300009147 Bacteria 57127
89 Ga0114129_10024552 3300009147 Bacteria 8540
90 Ga0114129_10075621 3300009147 Bacteria 4689
91 Ga0114129_10353571 3300009147 Bacteria 1946
92 Ga0114129_10419524 3300009147 Bacteria 1760
93 Ga0114129_10567981 3300009147 Bacteria 1473
94 Ga0105241_10004300 3300009174 Bacteria 10531
95 Ga0105248_10032635 3300009177 Bacteria 5818
96 Ga0105248_10120061 3300009177 Bacteria 2965
97 Ga0105248_10963162 3300009177 Unclassified 964
98 Ga0105237_10038680 3300009545 Bacteria 4817
99 Ga0105237_10150845 3300009545 Bacteria 2321
100 Ga0105238_10020224 3300009551 Bacteria 6775
101 Ga0105239_10018164 3300010375 Bacteria 7774
102 Ga0157371_10151789 3300013102 Bacteria 1652
103 Ga0157374_10058849 3300013296 Bacteria 3591
104 Ga0157374_10353481 3300013296 Bacteria 1460
105 Ga0157372_10793270 3300013307 Bacteria 1101
106 Ga0157375_10865384 3300013308 Bacteria 1050
107 Ga0163163_10072454 3300014325 Bacteria 3434
108 Ga0207680_10091339 3300025903 Bacteria 1937
109 Ga0207647_10009734 3300025904 Bacteria 6819
110 Ga0207685_10127126 3300025905 Bacteria 1127
111 Ga0207684_10187134 3300025910 Bacteria 1785
112 Ga0207684_10297157 3300025910 Unclassified 1392
113 Ga0207695_10006567 3300025913 Bacteria 15052
114 Ga0207671_10001572 3300025914 Bacteria 26013
115 Ga0207671_10062795 3300025914 Bacteria 2759
116 Ga0207646_10246574 3300025922 Unclassified 1613
117 Ga0207694_10000717 3300025924 Bacteria 29816
118 Ga0207700_10225060 3300025928 Bacteria 1592
119 Ga0207664_10000059 3300025929 Bacteria 119580
120 Ga0207664_10133802 3300025929 Bacteria 2090
121 Ga0207644_10304400 3300025931 Bacteria 1285
122 Ga0207706_10166907 3300025933 Bacteria 1935
123 Ga0207691_10202049 3300025940 Bacteria 1729
124 Ga0207661_10070123 3300025944 Bacteria 2861
125 Ga0207667_10601240 3300025949 Unclassified 1109
126 Ga0207640_10045807 3300025981 Bacteria 2811
127 Ga0207677_10062866 3300026023 Bacteria 2578
128 Ga0207639_10417845 3300026041 Unclassified 1212
129 Ga0207678_10050711 3300026067 Bacteria 3585
130 Ga0207641_10129746 3300026088 Bacteria 2262
131 Ga0207674_10083947 3300026116 Bacteria 3184
132 Ga0207674_10102697 3300026116 Bacteria 2839
133 Ga0207698_10199198 3300026142 Bacteria 1791
134 Ga0207428_10004775 3300027907 Bacteria 12801
135 Ga0207428_10029778 3300027907 Bacteria 4518
136 Ga0207428_10050421 3300027907 Bacteria 3330
137 Ga0207428_10069909 3300027907 Bacteria 2760
138 Ga0268266_10074375 3300028379 Bacteria 2950
139 Ga0268266_11054666 3300028379 Bacteria 786
140 Ga0268265_10217043 3300028380 Bacteria 1671
141 Ga0268264_10199419 3300028381 Bacteria 1830
142 Ga0265334_10000142 3300028573 Bacteria 44621
143 Ga0307515_10003309 3300028794 Bacteria 34051
144 Ga0307511_10066891 3300030521 Bacteria 2673
145 Ga0307512_10001818 3300030522 Bacteria 28729
146 Ga0307512_10168242 3300030522 Bacteria 1264
147 Ga0265328_10005741 3300031239 Bacteria 5300
148 Ga0265329_10131414 3300031242 Bacteria 806
149 Ga0307513_10091630 3300031456 Bacteria 3097
150 Ga0307509_10009267 3300031507 Bacteria 12352
151 Ga0307408_100082297 3300031548 Bacteria 2409
152 Ga0307508_10009962 3300031616 Bacteria 8711
153 Ga0307508_10080027 3300031616 Bacteria 2849
154 Ga0307514_10094495 3300031649 Bacteria 2167
155 Ga0307413_10032077 3300031824 Bacteria 2973
156 Ga0307518_10038199 3300031838 Bacteria 3491
157 Ga0307518_10126189 3300031838 Bacteria 1805
158 Ga0307407_10775042 3300031903 Bacteria 728
159 Ga0307412_10066619 3300031911 Bacteria 2442
160 Ga0307409_100833829 3300031995 Bacteria 932
161 Ga0307416_100037688 3300032002 Bacteria 3723
162 Ga0307416_100316070 3300032002 Bacteria 1561
163 Ga0307416_100417238 3300032002 Bacteria 1385
164 Ga0307411_10605757 3300032005 Bacteria 942
165 Ga0307411_10751267 3300032005 Bacteria 854
166 Ga0307507_10000005 3300033179 Bacteria 281494
167 Ga0307507_10010093 3300033179 Bacteria 12339
168 Ga0307507_10051907 3300033179 Bacteria 3940
169 Ga0307510_10020566 3300033180 Bacteria 7710
170 Ga0307510_10302875 3300033180 Bacteria 1060
171 Ga0373928_0157075 3300035084 Unclassified 633
172 Ga0373934_0051164 3300035086 Bacteria 1637
173 Ga0373936_0016397 3300035113 Bacteria 2850
174 Ga0373939_0265148 3300035114 Bacteria 673
175 Ga0373945_0023021 3300035116 Bacteria 2150
176 Ga0373953_0012901 3300035117 Bacteria 2970
177 Ga0373956_0013813 3300035119 Bacteria 3364
178 Ga0373956_0062220 3300035119 Bacteria 1691
179 Ga0373957_0000741 3300035120 Bacteria 8478
180 Ga0373957_0050115 3300035120 Bacteria 1595
181 Ga0373955_0015403 3300035172 Bacteria 3743
182 Ga0373955_0045343 3300035172 Bacteria 2372
183 Ga0373955_0624131 3300035172 Bacteria 660
184 Ga0373924_0026952 3300035410 Bacteria 2283
185 Ga0373924_0335780 3300035410 Unclassified 673
186 Ga0373931_0163582 3300035691 Bacteria 1306
187 Ga0373935_0006036 3300035692 Bacteria 7195
188 Ga0373935_0185443 3300035692 Bacteria 1430
189 Ga0373933_0039651 3300035724 Bacteria 2772
190 Ga0373933_0073464 3300035724 Bacteria 2083
191 Ga0373933_0205664 3300035724 Bacteria 1260
192 Ga0373933_0496466 3300035724 Bacteria 799
193 Ga0373947_0025674 3300035725 Bacteria 3436
194 Ga0373937_0035970 3300036401 Bacteria 4510
195 Ga0373937_0097261 3300036401 Bacteria 2730
196 Ga0373937_0645818 3300036401 Bacteria 1003
197 Ga0373925_0144608 3300037068 Bacteria 1863
198 Ga0373925_0247206 3300037068 Unclassified 1430
199 Ga0373925_0254391 3300037068 Bacteria 1409
200 Ga0395900_0021320 3300037418 Bacteria 6624
201 Ga0395900_0857318 3300037418 Bacteria 834
202 Ga0395901_0122740 3300038443 Bacteria 2730
203 Ga0242420_011437 3300038996 Bacteria 1489
204 Ga0436360_1129753 3300039438 Bacteria 751
205 Ga0436363_0395359 3300039450 Bacteria 1214
206 Ga0451577_0029902 3300042876 Bacteria 4921
207 Ga0453683_0020014 3300044673 Bacteria 4280
208 Ga0453683_0060126 3300044673 Bacteria 2376
209 Ga0466964_0033218 3300044706 Bacteria 2055
210 Ga0453684_0094841 3300044712 Bacteria 3669
211 Ga0466970_0007360 3300044765 Bacteria 5515
212 Ga0451576_0012854 3300045051 Bacteria 9388
213 Ga0451576_1022456 3300045051 Unclassified 866
214 Ga0466967_0949167 3300045976 Bacteria 856
215 Ga0495627_042029 3300046453 Bacteria 1402
216 Ga0495592_0012327 3300046454 Bacteria 6491
217 Ga0495592_0015888 3300046454 Bacteria 5711
218 Ga0495592_0021403 3300046454 Bacteria 4918
219 Ga0495629_0012553 3300046459 Bacteria 6134
220 Ga0495629_0033224 3300046459 Bacteria 3650
221 Ga0495629_0084512 3300046459 Bacteria 2214
222 Ga0495641_0019310 3300046461 Bacteria 3491
223 Ga0495651_0023055 3300046462 Bacteria 4841
224 Ga0495651_0053217 3300046462 Bacteria 3117
225 Ga0495651_0145445 3300046462 Bacteria 1714
226 Ga0495651_0146394 3300046462 Bacteria 1707
227 Ga0495653_0006163 3300046463 Bacteria 9836
228 Ga0495653_0016700 3300046463 Bacteria 5974
229 Ga0495653_0064665 3300046463 Bacteria 2755
230 Ga0495580_0002688 3300046472 Bacteria 15387
231 Ga0495582_0001594 3300046473 Bacteria 12786
232 Ga0495582_0062327 3300046473 Bacteria 2060
233 Ga0495639_0066126 3300046475 Bacteria 1664
234 Ga0495662_0001334 3300046476 Bacteria 12212
235 Ga0495662_0004941 3300046476 Bacteria 6670
236 Ga0495664_0001102 3300046477 Bacteria 13990
237 Ga0495664_0005285 3300046477 Bacteria 7078
238 Ga0495664_0022689 3300046477 Bacteria 3640
239 Ga0495608_0010087 3300046511 Bacteria 6587
240 Ga0495608_0011789 3300046511 Bacteria 6079
241 Ga0495608_0050659 3300046511 Bacteria 2754
242 Ga0495618_0040644 3300046514 Bacteria 2928
243 Ga0495618_0133466 3300046514 Bacteria 1588
244 Ga0495618_0172820 3300046514 Bacteria 1374
245 Ga0495618_0307905 3300046514 Bacteria 983
246 Ga0495628_0014693 3300046516 Bacteria 6556
247 Ga0495628_0019362 3300046516 Bacteria 5628
248 Ga0495628_0092751 3300046516 Bacteria 2335
249 Ga0495628_0122123 3300046516 Bacteria 1997
250 Ga0495630_0015658 3300046517 Bacteria 5540
251 Ga0495630_0019466 3300046517 Bacteria 4990
252 Ga0495630_0039223 3300046517 Bacteria 3542
253 Ga0495630_0115869 3300046517 Bacteria 2031
254 Ga0495630_0428065 3300046517 Unclassified 1014
255 Ga0495666_0025238 3300046526 Bacteria 2935
256 Ga0495652_0025707 3300046529 Bacteria 5204
257 Ga0495652_0335550 3300046529 Bacteria 1088
258 Ga0495652_0716083 3300046529 Bacteria 672
259 Ga0495665_0015921 3300046531 Bacteria 4051
260 Ga0495665_0037862 3300046531 Bacteria 2573
261 Ga0495640_0011484 3300046533 Bacteria 6813
262 Ga0495640_0029268 3300046533 Bacteria 3956
263 Ga0495640_0154203 3300046533 Bacteria 1475
264 Ga0495586_0036332 3300046535 Bacteria 2644
265 Ga0495587_0021884 3300046536 Bacteria 3942
266 Ga0495587_0047127 3300046536 Bacteria 2556
267 Ga0495587_0049455 3300046536 Bacteria 2488
268 Ga0495645_0003301 3300046543 Bacteria 10929
269 Ga0495645_0064759 3300046543 Bacteria 2644
270 Ga0495645_0100112 3300046543 Bacteria 2061
271 Ga0495622_0017940 3300046557 Bacteria 3296
272 Ga0495667_0005414 3300046559 Bacteria 8629
273 Ga0495667_0059827 3300046559 Bacteria 2499
274 Ga0495667_0068685 3300046559 Bacteria 2314
275 Ga0495667_0182187 3300046559 Bacteria 1347
276 Ga0495667_0267719 3300046559 Bacteria 1086
277 Ga0495667_0272825 3300046559 Bacteria 1074
278 Ga0495634_0001864 3300046642 Bacteria 18138
279 Ga0495634_0025825 3300046642 Bacteria 4102
280 Ga0495634_0281771 3300046642 Bacteria 1009
281 Ga0495625_0005856 3300046660 Bacteria 11082
282 Ga0495635_0028338 3300046663 Bacteria 3892
283 Ga0495635_0130301 3300046663 Bacteria 1714
284 Ga0495635_0189530 3300046663 Bacteria 1396
285 Ga0495635_0603504 3300046663 Bacteria 716
286 Ga0495588_0006658 3300046674 Bacteria 5217
287 Ga0495657_0010260 3300046675 Bacteria 7050
288 Ga0495657_0020378 3300046675 Bacteria 4767
289 Ga0495657_0030061 3300046675 Bacteria 3806
290 Ga0495657_0061015 3300046675 Bacteria 2495
291 Ga0495657_0283775 3300046675 Bacteria 990
292 Ga0495599_0008584 3300046678 Bacteria 6220
293 Ga0495599_0022274 3300046678 Bacteria 3954
294 Ga0495599_0160921 3300046678 Bacteria 1387
295 Ga0495599_0290678 3300046678 Unclassified 988
296 Ga0495623_0042632 3300046679 Bacteria 2890
297 Ga0495623_0329869 3300046679 Bacteria 836
298 Ga0495646_0005317 3300046680 Bacteria 8127
299 Ga0495646_0011714 3300046680 Bacteria 5575
300 Ga0495646_0032860 3300046680 Bacteria 3226
301 Ga0495658_0154128 3300046683 Bacteria 1413
302 Ga0495669_0042026 3300046684 Bacteria 2031
303 Ga0495613_0010601 3300046689 Bacteria 6836
304 Ga0495613_0063559 3300046689 Bacteria 2700
305 Ga0495613_0183348 3300046689 Bacteria 1482
306 Ga0495671_0006130 3300046692 Bacteria 6976
307 Ga0495600_0039563 3300046809 Bacteria 3070
308 Ga0495600_0048725 3300046809 Bacteria 2763
309 Ga0495600_0126364 3300046809 Bacteria 1663
310 Ga0495600_0201894 3300046809 Bacteria 1276
311 Ga0495600_0513177 3300046809 Bacteria 735
312 Ga0495581_0013438 3300047315 Bacteria 4748
313 Ga0495581_0037336 3300047315 Bacteria 2811
314 Ga0495581_0064745 3300047315 Bacteria 2112
315 Ga0495604_0000376 3300047317 Bacteria 40194
316 Ga0495604_0002722 3300047317 Bacteria 14171
317 Ga0495604_0017136 3300047317 Bacteria 5794
318 Ga0495604_0052951 3300047317 Bacteria 3140
319 Ga0495604_0275906 3300047317 Bacteria 1137
320 Ga0495674_0020454 3300047319 Bacteria 6125
321 Ga0495674_0067423 3300047319 Bacteria 3100
322 Ga0495674_0346463 3300047319 Bacteria 1206
323 Ga0495676_0007737 3300047321 Bacteria 9859
324 Ga0495680_0075797 3300047322 Bacteria 2551
325 Ga0495675_0009062 3300047444 Bacteria 6185
326 Ga0495675_0016268 3300047444 Bacteria 4705
327 Ga0495685_076208 3300047447 Bacteria 1120
328 Ga0495681_0005226 3300047470 Bacteria 8723
329 Ga0495684_0069995 3300047471 Bacteria 2667
330 Ga0495684_0079549 3300047471 Bacteria 2488
331 Ga0495684_0107585 3300047471 Bacteria 2106
332 Ga0495686_0089694 3300047472 Bacteria 1868
333 Ga0495593_0002250 3300047673 Bacteria 11576
334 Ga0495593_0016884 3300047673 Bacteria 4109
335 Ga0495593_0032331 3300047673 Bacteria 2853
336 Ga0495593_0123029 3300047673 Unclassified 1320
337 Ga0495593_0143143 3300047673 Bacteria 1211
338 Ga0495602_0048314 3300048088 Bacteria 3825
339 Ga0495602_0063079 3300048088 Bacteria 3212
340 Ga0495614_0008946 3300048089 Bacteria 4442
341 Ga0495614_0029483 3300048089 Bacteria 2362
342 Ga0495614_0036889 3300048089 Bacteria 2097
343 Ga0496104_0113256 3300048907 Bacteria 2601
344 Ga0496105_0015668 3300048908 Bacteria 6049
345 Ga0496108_0067791 3300048911 Bacteria 3010
346 Ga0496108_0131947 3300048911 Bacteria 2147
347 Ga0496109_0147291 3300048912 Bacteria 2203
348 Ga0496110_0075793 3300048913 Bacteria 2989
349 Ga0496111_0016894 3300048914 Bacteria 5037
350 Ga0496112_0008897 3300048915 Bacteria 9010
351 Ga0496113_0010129 3300048916 Bacteria 6220
352 Ga0501032_0098694 3300049569 Bacteria 1935
353 Ga0501034_0336399 3300049571 Bacteria 1440
354 Ga0501036_0056462 3300049572 Bacteria 3327
355 Ga0501037_0125416 3300049573 Bacteria 1844
356 Ga0501037_0181513 3300049573 Bacteria 1493
357 Ga0501037_0183340 3300049573 Bacteria 1485
358 Ga0501038_0012698 3300049574 Bacteria 7698
359 Ga0501038_0107794 3300049574 Bacteria 2311
360 Ga0501038_0411665 3300049574 Bacteria 1044
361 Ga0501039_0056326 3300049575 Bacteria 3045
362 Ga0501041_0060083 3300049577 Bacteria 2326
363 Ga0501042_0009716 3300049578 Bacteria 6426
364 Ga0501046_0062926 3300049580 Bacteria 2898
365 Ga0501047_0034152 3300049581 Bacteria 4911
366 Ga0501047_0051185 3300049581 Bacteria 3989
367 Ga0501047_0203516 3300049581 Unclassified 1840
368 Ga0501048_0676145 3300049582 Unclassified 741
369 Ga0501069_0000385 3300049585 Bacteria 19955
370 Ga0501070_0000001 3300049586 Bacteria 519187
371 Ga0501071_0003738 3300049587 Bacteria 9561
372 Ga0501071_0014553 3300049587 Bacteria 5382
373 Ga0501071_0112328 3300049587 Bacteria 2015
374 Ga0501071_0559326 3300049587 Unclassified 879
375 Ga0501072_0007747 3300049588 Bacteria 8154
376 Ga0501072_0377819 3300049588 Bacteria 1124
377 Ga0501073_0240953 3300049589 Bacteria 1249
378 Ga0501075_0007431 3300049591 Bacteria 7598
379 Ga0501076_0000461 3300049592 Bacteria 25817
380 Ga0501077_0028315 3300049593 Bacteria 3561
381 Ga0501079_0002995 3300049741 Bacteria 12353
382 Ga0501079_0194116 3300049741 Bacteria 1585
383 Ga0501079_0388575 3300049741 Unclassified 1094
384 Ga0501080_0014930 3300049742 Bacteria 7150
385 Ga0501081_0021123 3300049743 Bacteria 4345
386 Ga0501081_0138080 3300049743 Bacteria 1746
387 Ga0501083_0162320 3300049744 Bacteria 1461
388 Ga0501035_0120312 3300049822 Bacteria 2296
389 Ga0501035_0312019 3300049822 Bacteria 1323
390 Ga0501044_0009569 3300049823 Bacteria 10551
391 Ga0501044_0089671 3300049823 Bacteria 3103
392 Ga0501045_0028077 3300049824 Bacteria 4058
393 nmdc:mga05p37_1167_c1 3300050507 Bacteria 30274
394 nmdc:mga05p37_13542_c1 3300050507 Bacteria 9779
395 nmdc:mga05p37_20614_c1 3300050507 Bacteria 7976
396 nmdc:mga05p37_2158_c1 3300050507 Bacteria 22940
397 nmdc:mga05p37_371364_c1 3300050507 Bacteria 1678
398 nmdc:mga05p37_554199_c1 3300050507 Bacteria 1308
399 nmdc:mga05p37_627444_c1 3300050507 Bacteria 1208
400 nmdc:mga09592_48530_c1 3300050508 Bacteria 3579
401 nmdc:mga09592_91198_c1 3300050508 Bacteria 2604
402 nmdc:mga0qj67_217035_c1 3300050509 Bacteria 1553
403 nmdc:mga0qj67_608759_c1 3300050509 Bacteria 873
404 nmdc:mga06r32_29974_c1 3300050510 Bacteria 5103
405 nmdc:mga06r32_424342_c1 3300050510 Bacteria 1311
406 nmdc:mga06r32_561900_c1 3300050510 Bacteria 1114
407 nmdc:mga08y16_106534_c1 3300050511 Bacteria 2918
408 nmdc:mga08y16_2681_c1 3300050511 Bacteria 18287
409 nmdc:mga08y16_406567_c1 3300050511 Bacteria 1392
410 nmdc:mga0n895_2506_c1 3300050512 Bacteria 14370
411 nmdc:mga0n895_33966_c1 3300050512 Bacteria 4906
412 nmdc:mga0n895_342_c1 3300050512 Bacteria 31160
413 nmdc:mga0n895_51251_c1 3300050512 Bacteria 4049
414 nmdc:mga0n895_727595_c1 3300050512 Bacteria 987
415 nmdc:mga0n895_93222_c1 3300050512 Bacteria 3015
416 nmdc:mga0rr50_1319_c1 3300050513 Bacteria 13526
417 nmdc:mga0rr50_13957_c1 3300050513 Bacteria 2725
418 nmdc:mga0rr50_280437_c1 3300050513 Unclassified 1390
419 nmdc:mga0rr50_315549_c1 3300050513 Unclassified 1310
420 nmdc:mga08x19_1905_c1 3300050514 Bacteria 12752
421 nmdc:mga0a205_1677_c1 3300050515 Bacteria 19104
422 nmdc:mga0a205_21601_c1 3300050515 Bacteria 6087
423 nmdc:mga0a205_280_c1 3300050515 Bacteria 37307
424 nmdc:mga0a205_3016_c1 3300050515 Bacteria 14919
425 nmdc:mga0a205_50036_c1 3300050515 Bacteria 4035
426 Ga0495601_0017655 3300053077 Bacteria 4334
427 Ga0495601_0025669 3300053077 Bacteria 3635
428 Ga0495601_0055232 3300053077 Bacteria 2514
429 Ga0495612_0018162 3300053078 Bacteria 2815
430 Ga0495595_0000911 3300053084 Bacteria 11399
431 Ga0495619_0011266 3300053085 Bacteria 5625
432 Ga0495619_0016663 3300053085 Bacteria 4650
433 Ga0495619_0032501 3300053085 Bacteria 3386
434 Ga0500644_0187214 3300053088 Bacteria 850
435 Ga0500560_001527 3300053107 Bacteria 4065
436 Ga0500618_053355 3300053125 Bacteria 914
437 Ga0500573_0061408 3300053140 Bacteria 2152
438 Ga0500573_0328183 3300053140 Bacteria 752
439 Ga0500586_178183 3300053145 Bacteria 711
440 Ga0500624_019492 3300053157 Bacteria 1079
441 Ga0501082_0016479 3300060353 Bacteria 6360
442 Ga0501082_0682181 3300060353 Bacteria 899
443 Ga0501082_1310493 3300060353 Unclassified 633
444 Ga0530510_0003381 3300061734 Bacteria 10978
445 Ga0530510_0125790 3300061734 Bacteria 1884
446 2552106884 2551306166 Bacteria 9731570
447 2558907755 2558860112 Bacteria 9931328
448 2586065260 2585427649 Bacteria 9053857
449 2795797522 2795385472 Bacteria 6627535
450 2809593656 2808606522 Bacteria 9488490
451 2899361859 2899359706 Bacteria 10940472
452 2915773765 2915768154 Bacteria 8424322
453 Ga0307517_10101044
454 JGI25406J46586_10008911
455 rootH2_10106203
456 rootH1_10014112
457 JGI25404J52841_10000325
458 JGI25404J52841_10026448
459 Ga0070666_10213685
460 Ga0068868_100022844
461 Ga0070671_100214441
462 Ga0070709_10033740
463 Ga0070714_100000032
464 Ga0070663_100037707
465 Ga0070662_100129570
466 Ga0070706_100047583
467 Ga0070706_100283956
468 Ga0070707_100165966
469 Ga0070699_100059328
470 Ga0070699_100554943
471 Ga0070697_100001761
472 Ga0070697_100113910
473 Ga0070697_100476728
474 Ga0068853_100134644
475 Ga0068853_100168040
476 Ga0070672_100158233
477 Ga0070695_100442255
478 Ga0070696_100075377
479 Ga0070665_100465840
480 Ga0068855_100007464
481 Ga0068854_100058148
482 Ga0068852_100050049
483 Ga0068863_100242298
484 Ga0068862_100233327
485 Ga0081455_10000265
486 Ga0081455_10001518
487 Ga0081455_10001771
488 Ga0081455_10074676
489 Ga0081455_10451229
490 Ga0081538_10008072
491 Ga0081538_10023604
492 Ga0081540_1000244
493 Ga0081540_1002203
494 Ga0081539_10000009
495 Ga0070717_10076289
496 Ga0070717_10453213
497 Ga0075432_10033343
498 Ga0070715_10158137
499 Ga0070712_100116101
500 Ga0075428_100005881
501 Ga0075428_100145375
502 Ga0075428_100209501
503 Ga0075428_100360700
504 Ga0075428_100619703
505 Ga0075430_100215809
506 Ga0075431_100002129
507 Ga0075431_100433617
508 Ga0075431_100831730
509 Ga0075433_10001127
510 Ga0075433_10023613
511 Ga0075433_10060007
512 Ga0075433_10071675
513 Ga0075433_10081538
514 Ga0075434_100064770
515 Ga0075434_100064839
516 Ga0075434_100066009
517 Ga0075434_100101969
518 Ga0075434_100158590
519 Ga0075434_100909651
520 Ga0075434_101080049
521 Ga0075429_100003482
522 Ga0075429_100729522
523 Ga0075436_100001491
524 Ga0075436_100004745
525 Ga0075435_100009134
526 Ga0075435_100081046
527 Ga0075435_100271661
528 Ga0075435_100360269
529 Ga0075435_100783573
530 Ga0099794_10357829
531 Ga0105240_10056234
532 Ga0111539_10000446
533 Ga0111539_10017914
534 Ga0111539_10026787
535 Ga0111539_10092549
536 Ga0111539_10114283
537 Ga0111539_10210490
538 Ga0105247_10289330
539 Ga0114129_10000176
540 Ga0114129_10000305
541 Ga0114129_10024552
542 Ga0114129_10075621
543 Ga0114129_10353571
544 Ga0114129_10419524
545 Ga0114129_10567981
546 Ga0105241_10004300
547 Ga0105248_10032635
548 Ga0105248_10120061
549 Ga0105248_10963162
550 Ga0105237_10038680
551 Ga0105237_10150845
552 Ga0105238_10020224
553 Ga0105239_10018164
554 Ga0157371_10151789
555 Ga0157374_10058849
556 Ga0157374_10353481
557 Ga0157372_10793270
558 Ga0157375_10865384
559 Ga0163163_10072454
560 Ga0207680_10091339
561 Ga0207647_10009734
562 Ga0207685_10127126
563 Ga0207684_10187134
564 Ga0207684_10297157
565 Ga0207695_10006567
566 Ga0207671_10001572
567 Ga0207671_10062795
568 Ga0207646_10246574
569 Ga0207694_10000717
570 Ga0207700_10225060
571 Ga0207664_10000059
572 Ga0207664_10133802
573 Ga0207644_10304400
574 Ga0207706_10166907
575 Ga0207691_10202049
576 Ga0207661_10070123
577 Ga0207667_10601240
578 Ga0207640_10045807
579 Ga0207677_10062866
580 Ga0207639_10417845
581 Ga0207678_10050711
582 Ga0207641_10129746
583 Ga0207674_10083947
584 Ga0207674_10102697
585 Ga0207698_10199198
586 Ga0207428_10004775
587 Ga0207428_10029778
588 Ga0207428_10050421
589 Ga0207428_10069909
590 Ga0268266_10074375
591 Ga0268266_11054666
592 Ga0268265_10217043
593 Ga0268264_10199419
594 Ga0265334_10000142
595 Ga0307515_10003309
596 Ga0307511_10066891
597 Ga0307512_10001818
598 Ga0307512_10168242
599 Ga0265328_10005741
600 Ga0265329_10131414
601 Ga0307513_10091630
602 Ga0307509_10009267
603 Ga0307408_100082297
604 Ga0307508_10009962
605 Ga0307508_10080027
606 Ga0307514_10094495
607 Ga0307413_10032077
608 Ga0307518_10038199
609 Ga0307518_10126189
610 Ga0307407_10775042
611 Ga0307412_10066619
612 Ga0307409_100833829
613 Ga0307416_100037688
614 Ga0307416_100316070
615 Ga0307416_100417238
616 Ga0307411_10605757
617 Ga0307411_10751267
618 Ga0307507_10000005
619 Ga0307507_10010093
620 Ga0307507_10051907
621 Ga0307510_10020566
622 Ga0307510_10302875
623 Ga0373928_0157075
624 Ga0373934_0051164
625 Ga0373936_0016397
626 Ga0373939_0265148
627 Ga0373945_0023021
628 Ga0373953_0012901
629 Ga0373956_0013813
630 Ga0373956_0062220
631 Ga0373957_0000741
632 Ga0373957_0050115
633 Ga0373955_0015403
634 Ga0373955_0045343
635 Ga0373955_0624131
636 Ga0373924_0026952
637 Ga0373924_0335780
638 Ga0373931_0163582
639 Ga0373935_0006036
640 Ga0373935_0185443
641 Ga0373933_0039651
642 Ga0373933_0073464
643 Ga0373933_0205664
644 Ga0373933_0496466
645 Ga0373947_0025674
646 Ga0373937_0035970
647 Ga0373937_0097261
648 Ga0373937_0645818
649 Ga0373925_0144608
650 Ga0373925_0247206
651 Ga0373925_0254391
652 Ga0395900_0021320
653 Ga0395900_0857318
654 Ga0395901_0122740
655 Ga0242420_011437
656 Ga0436360_1129753
657 Ga0436363_0395359
658 Ga0451577_0029902
659 Ga0453683_0020014
660 Ga0453683_0060126
661 Ga0466964_0033218
662 Ga0453684_0094841
663 Ga0466970_0007360
664 Ga0451576_0012854
665 Ga0451576_1022456
666 Ga0466967_0949167
667 Ga0495627_042029
668 Ga0495592_0012327
669 Ga0495592_0015888
670 Ga0495592_0021403
671 Ga0495629_0012553
672 Ga0495629_0033224
673 Ga0495629_0084512
674 Ga0495641_0019310
675 Ga0495651_0023055
676 Ga0495651_0053217
677 Ga0495651_0145445
678 Ga0495651_0146394
679 Ga0495653_0006163
680 Ga0495653_0016700
681 Ga0495653_0064665
682 Ga0495580_0002688
683 Ga0495582_0001594
684 Ga0495582_0062327
685 Ga0495639_0066126
686 Ga0495662_0001334
687 Ga0495662_0004941
688 Ga0495664_0001102
689 Ga0495664_0005285
690 Ga0495664_0022689
691 Ga0495608_0010087
692 Ga0495608_0011789
693 Ga0495608_0050659
694 Ga0495618_0040644
695 Ga0495618_0133466
696 Ga0495618_0172820
697 Ga0495618_0307905
698 Ga0495628_0014693
699 Ga0495628_0019362
700 Ga0495628_0092751
701 Ga0495628_0122123
702 Ga0495630_0015658
703 Ga0495630_0019466
704 Ga0495630_0039223
705 Ga0495630_0115869
706 Ga0495630_0428065
707 Ga0495666_0025238
708 Ga0495652_0025707
709 Ga0495652_0335550
710 Ga0495652_0716083
711 Ga0495665_0015921
712 Ga0495665_0037862
713 Ga0495640_0011484
714 Ga0495640_0029268
715 Ga0495640_0154203
716 Ga0495586_0036332
717 Ga0495587_0021884
718 Ga0495587_0047127
719 Ga0495587_0049455
720 Ga0495645_0003301
721 Ga0495645_0064759
722 Ga0495645_0100112
723 Ga0495622_0017940
724 Ga0495667_0005414
725 Ga0495667_0059827
726 Ga0495667_0068685
727 Ga0495667_0182187
728 Ga0495667_0267719
729 Ga0495667_0272825
730 Ga0495634_0001864
731 Ga0495634_0025825
732 Ga0495634_0281771
733 Ga0495625_0005856
734 Ga0495635_0028338
735 Ga0495635_0130301
736 Ga0495635_0189530
737 Ga0495635_0603504
738 Ga0495588_0006658
739 Ga0495657_0010260
740 Ga0495657_0020378
741 Ga0495657_0030061
742 Ga0495657_0061015
743 Ga0495657_0283775
744 Ga0495599_0008584
745 Ga0495599_0022274
746 Ga0495599_0160921
747 Ga0495599_0290678
748 Ga0495623_0042632
749 Ga0495623_0329869
750 Ga0495646_0005317
751 Ga0495646_0011714
752 Ga0495646_0032860
753 Ga0495658_0154128
754 Ga0495669_0042026
755 Ga0495613_0010601
756 Ga0495613_0063559
757 Ga0495613_0183348
758 Ga0495671_0006130
759 Ga0495600_0039563
760 Ga0495600_0048725
761 Ga0495600_0126364
762 Ga0495600_0201894
763 Ga0495600_0513177
764 Ga0495581_0013438
765 Ga0495581_0037336
766 Ga0495581_0064745
767 Ga0495604_0000376
768 Ga0495604_0002722
769 Ga0495604_0017136
770 Ga0495604_0052951
771 Ga0495604_0275906
772 Ga0495674_0020454
773 Ga0495674_0067423
774 Ga0495674_0346463
775 Ga0495676_0007737
776 Ga0495680_0075797
777 Ga0495675_0009062
778 Ga0495675_0016268
779 Ga0495685_076208
780 Ga0495681_0005226
781 Ga0495684_0069995
782 Ga0495684_0079549
783 Ga0495684_0107585
784 Ga0495686_0089694
785 Ga0495593_0002250
786 Ga0495593_0016884
787 Ga0495593_0032331
788 Ga0495593_0123029
789 Ga0495593_0143143
790 Ga0495602_0048314
791 Ga0495602_0063079
792 Ga0495614_0008946
793 Ga0495614_0029483
794 Ga0495614_0036889
795 Ga0496104_0113256
796 Ga0496105_0015668
797 Ga0496108_0067791
798 Ga0496108_0131947
799 Ga0496109_0147291
800 Ga0496110_0075793
801 Ga0496111_0016894
802 Ga0496112_0008897
803 Ga0496113_0010129
804 Ga0501032_0098694
805 Ga0501034_0336399
806 Ga0501036_0056462
807 Ga0501037_0125416
808 Ga0501037_0181513
809 Ga0501037_0183340
810 Ga0501038_0012698
811 Ga0501038_0107794
812 Ga0501038_0411665
813 Ga0501039_0056326
814 Ga0501041_0060083
815 Ga0501042_0009716
816 Ga0501046_0062926
817 Ga0501047_0034152
818 Ga0501047_0051185
819 Ga0501047_0203516
820 Ga0501048_0676145
821 Ga0501069_0000385
822 Ga0501070_0000001
823 Ga0501071_0003738
824 Ga0501071_0014553
825 Ga0501071_0112328
826 Ga0501071_0559326
827 Ga0501072_0007747
828 Ga0501072_0377819
829 Ga0501073_0240953
830 Ga0501075_0007431
831 Ga0501076_0000461
832 Ga0501077_0028315
833 Ga0501079_0002995
834 Ga0501079_0194116
835 Ga0501079_0388575
836 Ga0501080_0014930
837 Ga0501081_0021123
838 Ga0501081_0138080
839 Ga0501083_0162320
840 Ga0501035_0120312
841 Ga0501035_0312019
842 Ga0501044_0009569
843 Ga0501044_0089671
844 Ga0501045_0028077
845 nmdc:mga05p37_1167_c1
846 nmdc:mga05p37_13542_c1
847 nmdc:mga05p37_20614_c1
848 nmdc:mga05p37_2158_c1
849 nmdc:mga05p37_371364_c1
850 nmdc:mga05p37_554199_c1
851 nmdc:mga05p37_627444_c1
852 nmdc:mga09592_48530_c1
853 nmdc:mga09592_91198_c1
854 nmdc:mga0qj67_217035_c1
855 nmdc:mga0qj67_608759_c1
856 nmdc:mga06r32_29974_c1
857 nmdc:mga06r32_424342_c1
858 nmdc:mga06r32_561900_c1
859 nmdc:mga08y16_106534_c1
860 nmdc:mga08y16_2681_c1
861 nmdc:mga08y16_406567_c1
862 nmdc:mga0n895_2506_c1
863 nmdc:mga0n895_33966_c1
864 nmdc:mga0n895_342_c1
865 nmdc:mga0n895_51251_c1
866 nmdc:mga0n895_727595_c1
867 nmdc:mga0n895_93222_c1
868 nmdc:mga0rr50_1319_c1
869 nmdc:mga0rr50_13957_c1
870 nmdc:mga0rr50_280437_c1
871 nmdc:mga0rr50_315549_c1
872 nmdc:mga08x19_1905_c1
873 nmdc:mga0a205_1677_c1
874 nmdc:mga0a205_21601_c1
875 nmdc:mga0a205_280_c1
876 nmdc:mga0a205_3016_c1
877 nmdc:mga0a205_50036_c1
878 Ga0495601_0017655
879 Ga0495601_0025669
880 Ga0495601_0055232
881 Ga0495612_0018162
882 Ga0495595_0000911
883 Ga0495619_0011266
884 Ga0495619_0016663
885 Ga0495619_0032501
886 Ga0500644_0187214
887 Ga0500560_001527
888 Ga0500618_053355
889 Ga0500573_0061408
890 Ga0500573_0328183
891 Ga0500586_178183
892 Ga0500624_019492
893 Ga0501082_0016479
894 Ga0501082_0682181
895 Ga0501082_1310493
896 Ga0530510_0003381
897 Ga0530510_0125790
898 2552106884
899 2558907755
900 2586065260
901 2795797522
902 2809593656
903 2899361859
904 2915773765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01339

CheB_methylest

CheB methylesterase

45

221

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9473 11 193
6ymz-assembly4.cif.gz_D structure of the cheb methylsterase from p. atrosepticum scri1043 0.9424 10 193
6ymz-assembly5.cif.gz_E structure of the cheb methylsterase from p. atrosepticum scri1043 0.9418 10 193
1chd-assembly1.cif.gz_A cheb methylesterase domain 0.9356 11 192
6ymz-assembly1.cif.gz_A structure of the cheb methylsterase from p. atrosepticum scri1043 0.9226 6 193
ID Description Score Start End Superfamily
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9473 11 193 3.40.50.180
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9134 11 193 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9134 10 201 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.8706 10 201 3.40.50.180
af_Q9VYH2_84_343_3.90.550.50 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A; 0.7227 13 48 3.90.550.50
ID Description Score Start End GO Terms
AF-A0A062VD65-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9887 9 193 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A2V9RYA2-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9846 11 193 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A2V9Z1B7-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9824 8 192 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A4V3FK78-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9812 8 193 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A2G8MKY3-F1-model_v4 deleted 0.9812 13 177

Map