F447208

General Info

Members Datasets Scaffolds Average Seq Length
453 200 906 148

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10130761|Ga0265334_101307611
Length 163
Sequence MRAEKKFITSEYLARLNASPFFMVVDYTGLKVGPITELRTRLKKAGAELHVVKNSVFKIAVKEAGLPDLGNLTGQLAVVTGQRDVSAAAKTIKTFHKEFDKPKVRFGYLHNQRLEAADLTALADLPSLEVLRARLLGVIMAPATTKGEPEAAPAAEVAAAPAA

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
110 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
198 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.44
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 18.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10130761 3300028573 Bacteria 893
2 Ga0058859_11522917 3300004798 Unclassified 1288
3 Ga0058859_11694322 3300004798 Bacteria 656
4 Ga0058863_10076849 3300004799 Bacteria 2590
5 Ga0058861_12055730 3300004800 Bacteria 2164
6 Ga0058860_11454419 3300004801 Bacteria 1078
7 Ga0058862_10266919 3300004803 Bacteria 1144
8 Ga0058862_12121033 3300004803 Bacteria 1184
9 Ga0065712_10250779 3300005290 Bacteria 960
10 Ga0070658_10038544 3300005327 Bacteria 3853
11 Ga0070658_10614562 3300005327 Bacteria 942
12 Ga0070683_100859837 3300005329 Unclassified 870
13 Ga0070683_100958675 3300005329 Unclassified 821
14 Ga0070690_100002343 3300005330 Bacteria 10186
15 Ga0070690_100660350 3300005330 Bacteria 799
16 Ga0070666_10231820 3300005335 Bacteria 1304
17 Ga0070666_10296831 3300005335 Bacteria 1150
18 Ga0070680_101486904 3300005336 Unclassified 587
19 Ga0070660_100248611 3300005339 Bacteria 1450
20 Ga0070689_100001105 3300005340 Bacteria 16956
21 Ga0070689_100157652 3300005340 Bacteria 1833
22 Ga0070689_100491231 3300005340 Bacteria 1050
23 Ga0070689_100518133 3300005340 Bacteria 1023
24 Ga0070687_100444972 3300005343 Unclassified 860
25 Ga0070687_100748456 3300005343 Bacteria 687
26 Ga0070688_100210629 3300005365 Bacteria 1364
27 Ga0070688_100229716 3300005365 Bacteria 1312
28 Ga0070703_10198322 3300005406 Unclassified 786
29 Ga0070714_100022084 3300005435 Bacteria 5215
30 Ga0070713_100262319 3300005436 Bacteria 1579
31 Ga0070713_100562953 3300005436 Unclassified 1080
32 Ga0070713_100833530 3300005436 Bacteria 885
33 Ga0070701_10002782 3300005438 Bacteria 6798
34 Ga0070711_100009588 3300005439 Bacteria 5968
35 Ga0070711_100608730 3300005439 Bacteria 912
36 Ga0070705_100084927 3300005440 Bacteria 1955
37 Ga0070705_100342309 3300005440 Bacteria 1087
38 Ga0070705_100387749 3300005440 Bacteria 1030
39 Ga0070705_100436416 3300005440 Unclassified 979
40 Ga0070705_100444807 3300005440 Unclassified 971
41 Ga0070700_100230302 3300005441 Bacteria 1318
42 Ga0070694_100324924 3300005444 Bacteria 1185
43 Ga0070708_100082666 3300005445 Bacteria 2909
44 Ga0070708_100220131 3300005445 Bacteria 1780
45 Ga0070708_101171163 3300005445 Unclassified 719
46 Ga0070678_101329611 3300005456 Unclassified 669
47 Ga0070681_10089111 3300005458 Bacteria 3036
48 Ga0070681_10117944 3300005458 Bacteria 2590
49 Ga0070681_10239429 3300005458 Bacteria 1728
50 Ga0070681_10265006 3300005458 Bacteria 1630
51 Ga0070685_10039195 3300005466 Bacteria 2690
52 Ga0070707_100440643 3300005468 Unclassified 1263
53 Ga0070698_100556833 3300005471 Bacteria 1086
54 Ga0070698_101311479 3300005471 Bacteria 674
55 Ga0070699_100520123 3300005518 Bacteria 1082
56 Ga0070679_100249291 3300005530 Unclassified 1732
57 Ga0070684_100558867 3300005535 Unclassified 1062
58 Ga0070684_100624844 3300005535 Bacteria 1002
59 Ga0070697_100399570 3300005536 Unclassified 1192
60 Ga0070686_100087207 3300005544 Bacteria 2080
61 Ga0070686_100188007 3300005544 Bacteria 1472
62 Ga0070686_100601420 3300005544 Bacteria 866
63 Ga0070704_100031808 3300005549 Bacteria 3552
64 Ga0070704_100367234 3300005549 Bacteria 1219
65 Ga0070704_100541210 3300005549 Bacteria 1016
66 Ga0070704_100644170 3300005549 Bacteria 935
67 Ga0068855_100048837 3300005563 Bacteria 4993
68 Ga0068855_100205062 3300005563 Bacteria 2218
69 Ga0068855_100303284 3300005563 Bacteria 1768
70 Ga0068855_100401371 3300005563 Bacteria 1502
71 Ga0068855_100603440 3300005563 Bacteria 1183
72 Ga0068857_100000314 3300005577 Bacteria 33509
73 Ga0070702_100238121 3300005615 Bacteria 1227
74 Ga0068852_101579198 3300005616 Unclassified 678
75 Ga0068859_100329771 3300005617 Bacteria 1620
76 Ga0068864_100039557 3300005618 Bacteria 4031
77 Ga0068864_100136345 3300005618 Bacteria 2210
78 Ga0068870_10902735 3300005840 Unclassified 624
79 Ga0068863_100002752 3300005841 Bacteria 17408
80 Ga0068863_100066384 3300005841 Bacteria 3413
81 Ga0068863_100112083 3300005841 Bacteria 2598
82 Ga0068863_100346522 3300005841 Unclassified 1446
83 Ga0068858_100328122 3300005842 Bacteria 1463
84 Ga0070717_11144888 3300006028 Unclassified 708
85 Ga0070716_100390715 3300006173 Bacteria 997
86 Ga0097621_100591162 3300006237 Unclassified 1014
87 Ga0068871_100632907 3300006358 Unclassified 975
88 Ga0068871_100709028 3300006358 Bacteria 922
89 Ga0068871_101245109 3300006358 Unclassified 699
90 Ga0075428_100145194 3300006844 Bacteria 2579
91 Ga0075428_100293049 3300006844 Bacteria 1750
92 Ga0075434_100916301 3300006871 Unclassified 891
93 Ga0075436_100224566 3300006914 Bacteria 1333
94 Ga0097620_100329756 3300006931 Bacteria 1620
95 Ga0075435_100719027 3300007076 Unclassified 868
96 Ga0099794_10284203 3300007265 Unclassified 856
97 Ga0099795_10409531 3300007788 Unclassified 618
98 Ga0105240_10002950 3300009093 Bacteria 26829
99 Ga0105240_10061220 3300009093 Bacteria 4691
100 Ga0105240_10501092 3300009093 Bacteria 1350
101 Ga0105240_10720913 3300009093 Bacteria 1087
102 Ga0105240_10818167 3300009093 Bacteria 1008
103 Ga0111539_10144529 3300009094 Bacteria 2785
104 Ga0111539_10157066 3300009094 Bacteria 2661
105 Ga0111539_10853814 3300009094 Bacteria 1059
106 Ga0105245_11196912 3300009098 Unclassified 808
107 Ga0114129_10823245 3300009147 Bacteria 1182
108 Ga0114129_11501787 3300009147 Unclassified 828
109 Ga0105242_10123641 3300009176 Unclassified 2224
110 Ga0105242_10244881 3300009176 Bacteria 1613
111 Ga0105242_11520494 3300009176 Viruses 701
112 Ga0105242_11671475 3300009176 Unclassified 672
113 Ga0105248_10361523 3300009177 Bacteria 1634
114 Ga0105248_11425184 3300009177 Bacteria 784
115 Ga0105238_10035176 3300009551 Bacteria 5094
116 Ga0105238_10064489 3300009551 Bacteria 3663
117 Ga0105238_10147569 3300009551 Bacteria 2328
118 Ga0105238_10652792 3300009551 Bacteria 1062
119 Ga0105249_10812208 3300009553 Unclassified 999
120 Ga0105249_11662438 3300009553 Unclassified 711
121 Ga0157371_10106360 3300013102 Bacteria 1991
122 Ga0157370_10283785 3300013104 Bacteria 1530
123 Ga0157369_10433253 3300013105 Bacteria 1362
124 Ga0157374_10237474 3300013296 Bacteria 1792
125 Ga0157374_10300064 3300013296 Bacteria 1589
126 Ga0157374_10328572 3300013296 Bacteria 1516
127 Ga0157374_10374437 3300013296 Unclassified 1418
128 Ga0157374_10821465 3300013296 Unclassified 946
129 Ga0157374_11228832 3300013296 Unclassified 771
130 Ga0157378_10489407 3300013297 Bacteria 1227
131 Ga0157378_10571335 3300013297 Unclassified 1139
132 Ga0163162_10326750 3300013306 Bacteria 1666
133 Ga0163162_10446654 3300013306 Bacteria 1425
134 Ga0163162_10504485 3300013306 Unclassified 1340
135 Ga0163162_11491540 3300013306 Unclassified 770
136 Ga0157372_10242435 3300013307 Bacteria 2091
137 Ga0157375_10000016 3300013308 Bacteria 295002
138 Ga0157375_10672805 3300013308 Unclassified 1190
139 Ga0157375_10697866 3300013308 Bacteria 1169
140 Ga0157375_11141868 3300013308 Bacteria 913
141 Ga0163163_10000130 3300014325 Bacteria 77745
142 Ga0163163_10284621 3300014325 Bacteria 1705
143 Ga0157380_10877657 3300014326 Bacteria 921
144 Ga0157379_10552513 3300014968 Bacteria 1071
145 Ga0157379_10827481 3300014968 Unclassified 875
146 Ga0157376_10183483 3300014969 Unclassified 1914
147 Ga0157376_10477711 3300014969 Unclassified 1221
148 Ga0157376_10804170 3300014969 Unclassified 953
149 Ga0163161_11083673 3300017792 Bacteria 688
150 Ga0206356_10582914 3300020070 Bacteria 2311
151 Ga0206352_10359961 3300020078 Bacteria 1296
152 Ga0207680_10280275 3300025903 Unclassified 1158
153 Ga0207705_10082909 3300025909 Bacteria 2339
154 Ga0207707_10165780 3300025912 Bacteria 1931
155 Ga0207707_10303434 3300025912 Bacteria 1381
156 Ga0207707_10343930 3300025912 Bacteria 1286
157 Ga0207707_11068113 3300025912 Unclassified 659
158 Ga0207695_10043377 3300025913 Bacteria 4794
159 Ga0207695_10106731 3300025913 Bacteria 2786
160 Ga0207695_10113140 3300025913 Bacteria 2691
161 Ga0207695_10159545 3300025913 Bacteria 2188
162 Ga0207695_10205050 3300025913 Bacteria 1885
163 Ga0207663_10009428 3300025916 Bacteria 5155
164 Ga0207662_10040631 3300025918 Bacteria 2735
165 Ga0207662_10807249 3300025918 Unclassified 661
166 Ga0207657_10127159 3300025919 Bacteria 2092
167 Ga0207652_10215311 3300025921 Bacteria 1730
168 Ga0207652_10668980 3300025921 Archaea 928
169 Ga0207652_10672556 3300025921 Unclassified 925
170 Ga0207694_10020359 3300025924 Bacteria 5018
171 Ga0207694_10030076 3300025924 Bacteria 4147
172 Ga0207694_10067825 3300025924 Bacteria 2785
173 Ga0207700_10197682 3300025928 Bacteria 1693
174 Ga0207700_10397214 3300025928 Bacteria 1208
175 Ga0207700_10771918 3300025928 Bacteria 859
176 Ga0207700_10867026 3300025928 Unclassified 808
177 Ga0207664_10014961 3300025929 Bacteria 5618
178 Ga0207686_10136205 3300025934 Bacteria 1691
179 Ga0207670_10002276 3300025936 Bacteria 10056
180 Ga0207670_10027396 3300025936 Bacteria 3602
181 Ga0207670_10070307 3300025936 Bacteria 2417
182 Ga0207670_10966216 3300025936 Unclassified 716
183 Ga0207670_11080077 3300025936 Bacteria 677
184 Ga0207711_10225843 3300025941 Bacteria 1714
185 Ga0207661_10645554 3300025944 Unclassified 973
186 Ga0207661_10730348 3300025944 Unclassified 911
187 Ga0207661_10796465 3300025944 Unclassified 870
188 Ga0207667_10097416 3300025949 Bacteria 3036
189 Ga0207667_10117627 3300025949 Bacteria 2739
190 Ga0207667_10157547 3300025949 Bacteria 2336
191 Ga0207667_10547223 3300025949 Bacteria 1171
192 Ga0207651_12081916 3300025960 Bacteria 510
193 Ga0207712_10733631 3300025961 Bacteria 864
194 Ga0207703_10030262 3300026035 Bacteria 4278
195 Ga0207703_11213229 3300026035 Bacteria 725
196 Ga0207639_10379269 3300026041 Bacteria 1269
197 Ga0207708_10136091 3300026075 Bacteria 1924
198 Ga0207708_10345724 3300026075 Bacteria 1219
199 Ga0207702_10318842 3300026078 Bacteria 1480
200 Ga0207641_10109820 3300026088 Bacteria 2443
201 Ga0207641_10256580 3300026088 Bacteria 1635
202 Ga0207641_10386795 3300026088 Unclassified 1341
203 Ga0207641_10457369 3300026088 Bacteria 1234
204 Ga0207648_11187898 3300026089 Bacteria 716
205 Ga0207676_10121916 3300026095 Bacteria 2200
206 Ga0207676_10623672 3300026095 Bacteria 1038
207 Ga0207676_12101891 3300026095 Bacteria 563
208 Ga0207674_10014586 3300026116 Bacteria 8672
209 Ga0207674_10085667 3300026116 Bacteria 3145
210 Ga0207674_10695812 3300026116 Bacteria 981
211 Ga0207683_11183737 3300026121 Unclassified 708
212 Ga0207698_10221931 3300026142 Bacteria 1709
213 Ga0268265_11672063 3300028380 Unclassified 642
214 Ga0265337_1000229 3300028556 Bacteria 30122
215 Ga0265337_1000970 3300028556 Bacteria 15043
216 Ga0265337_1002027 3300028556 Bacteria 9617
217 Ga0265337_1007013 3300028556 Bacteria 4262
218 Ga0265337_1041403 3300028556 Unclassified 1325
219 Ga0265337_1056850 3300028556 Bacteria 1090
220 Ga0265337_1067995 3300028556 Bacteria 981
221 Ga0265326_10003823 3300028558 Bacteria 4900
222 Ga0265326_10057110 3300028558 Bacteria 1104
223 Ga0265319_1000019 3300028563 Bacteria 154537
224 Ga0265319_1008100 3300028563 Bacteria 4640
225 Ga0265319_1073030 3300028563 Bacteria 1097
226 Ga0265319_1188859 3300028563 Unclassified 634
227 Ga0265334_10063969 3300028573 Bacteria 1382
228 Ga0265334_10112183 3300028573 Bacteria 979
229 Ga0265334_10134673 3300028573 Unclassified 878
230 Ga0265318_10071814 3300028577 Bacteria 1283
231 Ga0265318_10141070 3300028577 Bacteria 885
232 Ga0265323_10000417 3300028653 Bacteria 24407
233 Ga0265323_10008406 3300028653 Bacteria 4255
234 Ga0265323_10043591 3300028653 Bacteria 1619
235 Ga0265323_10058341 3300028653 Bacteria 1348
236 Ga0265323_10166100 3300028653 Bacteria 703
237 Ga0265322_10019692 3300028654 Bacteria 1936
238 Ga0265336_10006299 3300028666 Bacteria 4292
239 Ga0265336_10020180 3300028666 Bacteria 2142
240 Ga0265336_10021674 3300028666 Bacteria 2053
241 Ga0265336_10084268 3300028666 Bacteria 948
242 Ga0265338_10000780 3300028800 Bacteria 54179
243 Ga0265338_10000987 3300028800 Bacteria 47972
244 Ga0265338_10004601 3300028800 Bacteria 18557
245 Ga0265338_10006533 3300028800 Bacteria 14823
246 Ga0265338_10008265 3300028800 Bacteria 12668
247 Ga0265338_10008911 3300028800 Bacteria 12083
248 Ga0265338_10012654 3300028800 Bacteria 9604
249 Ga0265338_10013914 3300028800 Bacteria 9029
250 Ga0265338_10013920 3300028800 Bacteria 9025
251 Ga0265338_10015221 3300028800 Bacteria 8475
252 Ga0265338_10020800 3300028800 Bacteria 6880
253 Ga0265338_10038711 3300028800 Bacteria 4512
254 Ga0265338_10052895 3300028800 Bacteria 3638
255 Ga0265338_10077154 3300028800 Bacteria 2818
256 Ga0265338_10176641 3300028800 Bacteria 1632
257 Ga0265338_10179185 3300028800 Bacteria 1617
258 Ga0265338_10207234 3300028800 Bacteria 1474
259 Ga0265338_10207408 3300028800 Unclassified 1473
260 Ga0265338_10209711 3300028800 Bacteria 1463
261 Ga0265338_10236065 3300028800 Bacteria 1357
262 Ga0265338_10341742 3300028800 Bacteria 1078
263 Ga0265338_10514873 3300028800 Unclassified 841
264 Ga0265338_10692069 3300028800 Unclassified 704
265 Ga0265338_10699517 3300028800 Unclassified 700
266 Ga0265338_10865949 3300028800 Unclassified 617
267 Ga0265338_10881005 3300028800 Unclassified 610
268 Ga0265324_10001945 3300029957 Bacteria 11071
269 Ga0265324_10014532 3300029957 Bacteria 2911
270 Ga0265324_10054437 3300029957 Bacteria 1373
271 Ga0265324_10057138 3300029957 Bacteria 1336
272 Ga0265324_10058552 3300029957 Bacteria 1318
273 Ga0265330_10087713 3300031235 Bacteria 1337
274 Ga0265330_10129209 3300031235 Bacteria 1076
275 Ga0265320_10000792 3300031240 Bacteria 24069
276 Ga0265320_10011788 3300031240 Bacteria 5126
277 Ga0265320_10092206 3300031240 Bacteria 1402
278 Ga0265320_10108987 3300031240 Bacteria 1270
279 Ga0265320_10119158 3300031240 Bacteria 1205
280 Ga0265325_10037424 3300031241 Bacteria 2565
281 Ga0265325_10151874 3300031241 Bacteria 1094
282 Ga0265340_10001882 3300031247 Bacteria 11951
283 Ga0265340_10034214 3300031247 Bacteria 2528
284 Ga0265339_10018742 3300031249 Bacteria 4076
285 Ga0265339_10034763 3300031249 Bacteria 2831
286 Ga0265339_10208358 3300031249 Bacteria 961
287 Ga0265339_10224623 3300031249 Bacteria 917
288 Ga0265327_10016827 3300031251 Bacteria 4622
289 Ga0265327_10120370 3300031251 Bacteria 1244
290 Ga0265316_10001873 3300031344 Bacteria 22101
291 Ga0265316_10159068 3300031344 Bacteria 1689
292 Ga0265316_10195887 3300031344 Bacteria 1499
293 Ga0265316_10256718 3300031344 Bacteria 1282
294 Ga0265316_11060405 3300031344 Unclassified 563
295 Ga0265313_10000967 3300031595 Bacteria 28455
296 Ga0265313_10303264 3300031595 Unclassified 641
297 Ga0265314_10025365 3300031711 Bacteria 4472
298 Ga0265314_10070841 3300031711 Bacteria 2335
299 Ga0265314_10214194 3300031711 Bacteria 1129
300 Ga0265314_10224597 3300031711 Bacteria 1093
301 Ga0265342_10228855 3300031712 Bacteria 999
302 Ga0316576_10526946 3300031727 Bacteria 867
303 Ga0373926_0015216 3300035083 Bacteria 2622
304 Ga0373944_0035825 3300035089 Unclassified 1514
305 Ga0373954_0001471 3300035118 Bacteria 9581
306 Ga0373954_0002140 3300035118 Bacteria 8202
307 Ga0373956_0072036 3300035119 Bacteria 1578
308 Ga0373956_0224845 3300035119 Bacteria 891
309 Ga0373943_0547464 3300035170 Bacteria 679
310 Ga0373946_0094733 3300035171 Bacteria 1329
311 Ga0373946_0274552 3300035171 Bacteria 828
312 Ga0373955_0337935 3300035172 Bacteria 911
313 Ga0373935_0064365 3300035692 Bacteria 2351
314 Ga0373935_0115509 3300035692 Bacteria 1787
315 Ga0373935_0831776 3300035692 Unclassified 682
316 Ga0373927_0007553 3300035695 Bacteria 7356
317 Ga0373933_0114497 3300035724 Bacteria 1685
318 Ga0373933_0419270 3300035724 Bacteria 874
319 Ga0373947_0001855 3300035725 Bacteria 12884
320 Ga0373947_0240323 3300035725 Bacteria 1195
321 Ga0373947_0783891 3300035725 Unclassified 651
322 Ga0373937_0050542 3300036401 Bacteria 3808
323 Ga0373937_0212650 3300036401 Bacteria 1820
324 Ga0373937_0225459 3300036401 Bacteria 1764
325 Ga0373937_0316148 3300036401 Unclassified 1477
326 Ga0373925_0005094 3300037068 Bacteria 9839
327 Ga0373925_0226610 3300037068 Bacteria 1493
328 Ga0373925_0358436 3300037068 Bacteria 1185
329 Ga0373925_0485276 3300037068 Bacteria 1014
330 Ga0451839_1434689 3300041496 Unclassified 708
331 Ga0451577_0006545 3300042876 Bacteria 11589
332 Ga0451577_0136316 3300042876 Bacteria 2204
333 Ga0451577_0141816 3300042876 Bacteria 2160
334 Ga0451577_1140756 3300042876 Bacteria 697
335 Ga0453684_0003298 3300044712 Bacteria 36801
336 Ga0453684_0005150 3300044712 Bacteria 26304
337 Ga0453684_0258266 3300044712 Bacteria 1997
338 Ga0453684_0611182 3300044712 Bacteria 1194
339 Ga0453684_1277959 3300044712 Unclassified 767
340 Ga0451576_0015000 3300045051 Bacteria 8608
341 Ga0451576_0048586 3300045051 Bacteria 4456
342 Ga0451576_0096656 3300045051 Bacteria 3072
343 Ga0451576_0160518 3300045051 Bacteria 2346
344 Ga0451576_0196668 3300045051 Bacteria 2106
345 Ga0451576_0331094 3300045051 Bacteria 1594
346 Ga0451576_0713850 3300045051 Unclassified 1053
347 Ga0451576_0718332 3300045051 Unclassified 1050
348 Ga0451576_1222195 3300045051 Unclassified 784
349 Ga0451576_1349557 3300045051 Unclassified 743
350 Ga0451576_1740906 3300045051 Unclassified 645
351 Ga0495592_0000015 3300046454 Bacteria 145683
352 Ga0495592_0018446 3300046454 Bacteria 5307
353 Ga0495592_0136151 3300046454 Bacteria 1713
354 Ga0495629_0132371 3300046459 Bacteria 1737
355 Ga0495582_0039765 3300046473 Bacteria 2589
356 Ga0495639_0129347 3300046475 Bacteria 1208
357 Ga0495662_0004542 3300046476 Bacteria 6961
358 Ga0495664_0055490 3300046477 Bacteria 2357
359 Ga0495618_0007658 3300046514 Bacteria 6531
360 Ga0495628_0000140 3300046516 Bacteria 62202
361 Ga0495628_0093687 3300046516 Bacteria 2323
362 Ga0495628_0114496 3300046516 Bacteria 2072
363 Ga0495628_0151676 3300046516 Bacteria 1765
364 Ga0495628_0514408 3300046516 Unclassified 863
365 Ga0495630_0000022 3300046517 Bacteria 172932
366 Ga0495630_0021741 3300046517 Bacteria 4737
367 Ga0495630_0066878 3300046517 Bacteria 2702
368 Ga0495630_0188291 3300046517 Bacteria 1574
369 Ga0495630_0199907 3300046517 Bacteria 1525
370 Ga0495630_0447376 3300046517 Unclassified 990
371 Ga0495666_0040967 3300046526 Bacteria 2244
372 Ga0495652_0232573 3300046529 Bacteria 1377
373 Ga0495652_0513339 3300046529 Unclassified 829
374 Ga0495640_0018113 3300046533 Bacteria 5233
375 Ga0495640_0081318 3300046533 Bacteria 2153
376 Ga0495640_0122708 3300046533 Bacteria 1687
377 Ga0495640_0242819 3300046533 Bacteria 1130
378 Ga0495586_0000010 3300046535 Bacteria 143135
379 Ga0495586_0000942 3300046535 Bacteria 16500
380 Ga0495586_0001725 3300046535 Bacteria 11933
381 Ga0495586_0008130 3300046535 Bacteria 5593
382 Ga0495586_0040090 3300046535 Bacteria 2518
383 Ga0495586_0315609 3300046535 Bacteria 896
384 Ga0495587_0122517 3300046536 Bacteria 1489
385 Ga0495645_0002009 3300046543 Bacteria 13855
386 Ga0495645_0051821 3300046543 Bacteria 2986
387 Ga0495645_0151373 3300046543 Bacteria 1611
388 Ga0495667_0032330 3300046559 Bacteria 3507
389 Ga0495634_0006447 3300046642 Bacteria 8915
390 Ga0495634_0035656 3300046642 Bacteria 3405
391 Ga0495634_0046148 3300046642 Bacteria 2942
392 Ga0495635_0132791 3300046663 Bacteria 1697
393 Ga0495599_0037695 3300046678 Bacteria 3037
394 Ga0495599_0061823 3300046678 Bacteria 2339
395 Ga0495646_0095405 3300046680 Bacteria 1712
396 Ga0495647_0005636 3300046681 Bacteria 4113
397 Ga0495658_0003253 3300046683 Bacteria 8076
398 Ga0495658_0023804 3300046683 Bacteria 3254
399 Ga0495658_0043055 3300046683 Bacteria 2523
400 Ga0495658_0156850 3300046683 Bacteria 1401
401 Ga0495669_0131651 3300046684 Bacteria 1177
402 Ga0495613_0002808 3300046689 Bacteria 13068
403 Ga0495613_0116957 3300046689 Bacteria 1917
404 Ga0495624_0039744 3300046690 Bacteria 3015
405 Ga0495624_0138185 3300046690 Bacteria 1493
406 Ga0495600_0280130 3300046809 Bacteria 1056
407 Ga0495600_0289697 3300046809 Bacteria 1035
408 Ga0495581_0198212 3300047315 Bacteria 1174
409 Ga0495604_0282480 3300047317 Bacteria 1121
410 Ga0495604_0537236 3300047317 Bacteria 755
411 Ga0495674_0000992 3300047319 Bacteria 27284
412 Ga0495674_0008677 3300047319 Bacteria 9666
413 Ga0495674_0109181 3300047319 Bacteria 2347
414 Ga0495676_0029339 3300047321 Bacteria 4685
415 Ga0495676_0092476 3300047321 Bacteria 2258
416 Ga0495680_0005121 3300047322 Bacteria 12378
417 Ga0495680_0161292 3300047322 Bacteria 1628
418 Ga0495675_0053686 3300047444 Bacteria 2558
419 Ga0495675_0086306 3300047444 Bacteria 1973
420 Ga0495675_0131567 3300047444 Bacteria 1555
421 Ga0495684_0263310 3300047471 Bacteria 1250
422 Ga0495684_0355597 3300047471 Bacteria 1039
423 Ga0496107_0038808 3300048910 Bacteria 3415
424 Ga0496115_0021650 3300048918 Bacteria 4968
425 Ga0501031_0000229 3300049568 Bacteria 31986
426 Ga0501032_0025533 3300049569 Bacteria 4072
427 Ga0501032_0027127 3300049569 Bacteria 3938
428 Ga0501033_0004135 3300049570 Bacteria 11687
429 Ga0501033_0029907 3300049570 Bacteria 4094
430 Ga0501033_0156409 3300049570 Bacteria 1642
431 Ga0501034_0220726 3300049571 Bacteria 1848
432 Ga0501036_0282858 3300049572 Bacteria 1388
433 Ga0501043_0094146 3300049579 Bacteria 2355
434 Ga0501046_0240618 3300049580 Bacteria 1335
435 Ga0501080_1028983 3300049742 Bacteria 713
436 Ga0501035_0022917 3300049822 Bacteria 5733
437 Ga0501035_0042376 3300049822 Bacteria 4105
438 Ga0501044_0001696 3300049823 Bacteria 25845
439 Ga0501044_0010340 3300049823 Bacteria 10130
440 Ga0501044_0434033 3300049823 Bacteria 1222
441 nmdc:mga05p37_1098706_c1 3300050507 Unclassified 833
442 nmdc:mga09592_277175_c1 3300050508 Bacteria 1454
443 nmdc:mga08y16_11198_c1 3300050511 Bacteria 9420
444 nmdc:mga08y16_160700_c1 3300050511 Bacteria 2334
445 nmdc:mga08y16_683265_c1 3300050511 Bacteria 1028
446 nmdc:mga0rr50_1117390_c1 3300050513 Unclassified 670
447 nmdc:mga08x19_106664_c1 3300050514 Bacteria 1864
448 Ga0495601_0260759 3300053077 Bacteria 1131
449 Ga0495601_0530454 3300053077 Unclassified 758
450 Ga0500650_0003182 3300053098 Bacteria 5637
451 Ga0587079_015004 3300059647 Bacteria 1309
452 Ga0587071_018105 3300060344 Bacteria 1263
453 Ga0466962_0260086 3300061719 Bacteria 854
454 Ga0265334_10130761
455 Ga0058859_11522917
456 Ga0058859_11694322
457 Ga0058863_10076849
458 Ga0058861_12055730
459 Ga0058860_11454419
460 Ga0058862_10266919
461 Ga0058862_12121033
462 Ga0065712_10250779
463 Ga0070658_10038544
464 Ga0070658_10614562
465 Ga0070683_100859837
466 Ga0070683_100958675
467 Ga0070690_100002343
468 Ga0070690_100660350
469 Ga0070666_10231820
470 Ga0070666_10296831
471 Ga0070680_101486904
472 Ga0070660_100248611
473 Ga0070689_100001105
474 Ga0070689_100157652
475 Ga0070689_100491231
476 Ga0070689_100518133
477 Ga0070687_100444972
478 Ga0070687_100748456
479 Ga0070688_100210629
480 Ga0070688_100229716
481 Ga0070703_10198322
482 Ga0070714_100022084
483 Ga0070713_100262319
484 Ga0070713_100562953
485 Ga0070713_100833530
486 Ga0070701_10002782
487 Ga0070711_100009588
488 Ga0070711_100608730
489 Ga0070705_100084927
490 Ga0070705_100342309
491 Ga0070705_100387749
492 Ga0070705_100436416
493 Ga0070705_100444807
494 Ga0070700_100230302
495 Ga0070694_100324924
496 Ga0070708_100082666
497 Ga0070708_100220131
498 Ga0070708_101171163
499 Ga0070678_101329611
500 Ga0070681_10089111
501 Ga0070681_10117944
502 Ga0070681_10239429
503 Ga0070681_10265006
504 Ga0070685_10039195
505 Ga0070707_100440643
506 Ga0070698_100556833
507 Ga0070698_101311479
508 Ga0070699_100520123
509 Ga0070679_100249291
510 Ga0070684_100558867
511 Ga0070684_100624844
512 Ga0070697_100399570
513 Ga0070686_100087207
514 Ga0070686_100188007
515 Ga0070686_100601420
516 Ga0070704_100031808
517 Ga0070704_100367234
518 Ga0070704_100541210
519 Ga0070704_100644170
520 Ga0068855_100048837
521 Ga0068855_100205062
522 Ga0068855_100303284
523 Ga0068855_100401371
524 Ga0068855_100603440
525 Ga0068857_100000314
526 Ga0070702_100238121
527 Ga0068852_101579198
528 Ga0068859_100329771
529 Ga0068864_100039557
530 Ga0068864_100136345
531 Ga0068870_10902735
532 Ga0068863_100002752
533 Ga0068863_100066384
534 Ga0068863_100112083
535 Ga0068863_100346522
536 Ga0068858_100328122
537 Ga0070717_11144888
538 Ga0070716_100390715
539 Ga0097621_100591162
540 Ga0068871_100632907
541 Ga0068871_100709028
542 Ga0068871_101245109
543 Ga0075428_100145194
544 Ga0075428_100293049
545 Ga0075434_100916301
546 Ga0075436_100224566
547 Ga0097620_100329756
548 Ga0075435_100719027
549 Ga0099794_10284203
550 Ga0099795_10409531
551 Ga0105240_10002950
552 Ga0105240_10061220
553 Ga0105240_10501092
554 Ga0105240_10720913
555 Ga0105240_10818167
556 Ga0111539_10144529
557 Ga0111539_10157066
558 Ga0111539_10853814
559 Ga0105245_11196912
560 Ga0114129_10823245
561 Ga0114129_11501787
562 Ga0105242_10123641
563 Ga0105242_10244881
564 Ga0105242_11520494
565 Ga0105242_11671475
566 Ga0105248_10361523
567 Ga0105248_11425184
568 Ga0105238_10035176
569 Ga0105238_10064489
570 Ga0105238_10147569
571 Ga0105238_10652792
572 Ga0105249_10812208
573 Ga0105249_11662438
574 Ga0157371_10106360
575 Ga0157370_10283785
576 Ga0157369_10433253
577 Ga0157374_10237474
578 Ga0157374_10300064
579 Ga0157374_10328572
580 Ga0157374_10374437
581 Ga0157374_10821465
582 Ga0157374_11228832
583 Ga0157378_10489407
584 Ga0157378_10571335
585 Ga0163162_10326750
586 Ga0163162_10446654
587 Ga0163162_10504485
588 Ga0163162_11491540
589 Ga0157372_10242435
590 Ga0157375_10000016
591 Ga0157375_10672805
592 Ga0157375_10697866
593 Ga0157375_11141868
594 Ga0163163_10000130
595 Ga0163163_10284621
596 Ga0157380_10877657
597 Ga0157379_10552513
598 Ga0157379_10827481
599 Ga0157376_10183483
600 Ga0157376_10477711
601 Ga0157376_10804170
602 Ga0163161_11083673
603 Ga0206356_10582914
604 Ga0206352_10359961
605 Ga0207680_10280275
606 Ga0207705_10082909
607 Ga0207707_10165780
608 Ga0207707_10303434
609 Ga0207707_10343930
610 Ga0207707_11068113
611 Ga0207695_10043377
612 Ga0207695_10106731
613 Ga0207695_10113140
614 Ga0207695_10159545
615 Ga0207695_10205050
616 Ga0207663_10009428
617 Ga0207662_10040631
618 Ga0207662_10807249
619 Ga0207657_10127159
620 Ga0207652_10215311
621 Ga0207652_10668980
622 Ga0207652_10672556
623 Ga0207694_10020359
624 Ga0207694_10030076
625 Ga0207694_10067825
626 Ga0207700_10197682
627 Ga0207700_10397214
628 Ga0207700_10771918
629 Ga0207700_10867026
630 Ga0207664_10014961
631 Ga0207686_10136205
632 Ga0207670_10002276
633 Ga0207670_10027396
634 Ga0207670_10070307
635 Ga0207670_10966216
636 Ga0207670_11080077
637 Ga0207711_10225843
638 Ga0207661_10645554
639 Ga0207661_10730348
640 Ga0207661_10796465
641 Ga0207667_10097416
642 Ga0207667_10117627
643 Ga0207667_10157547
644 Ga0207667_10547223
645 Ga0207651_12081916
646 Ga0207712_10733631
647 Ga0207703_10030262
648 Ga0207703_11213229
649 Ga0207639_10379269
650 Ga0207708_10136091
651 Ga0207708_10345724
652 Ga0207702_10318842
653 Ga0207641_10109820
654 Ga0207641_10256580
655 Ga0207641_10386795
656 Ga0207641_10457369
657 Ga0207648_11187898
658 Ga0207676_10121916
659 Ga0207676_10623672
660 Ga0207676_12101891
661 Ga0207674_10014586
662 Ga0207674_10085667
663 Ga0207674_10695812
664 Ga0207683_11183737
665 Ga0207698_10221931
666 Ga0268265_11672063
667 Ga0265337_1000229
668 Ga0265337_1000970
669 Ga0265337_1002027
670 Ga0265337_1007013
671 Ga0265337_1041403
672 Ga0265337_1056850
673 Ga0265337_1067995
674 Ga0265326_10003823
675 Ga0265326_10057110
676 Ga0265319_1000019
677 Ga0265319_1008100
678 Ga0265319_1073030
679 Ga0265319_1188859
680 Ga0265334_10063969
681 Ga0265334_10112183
682 Ga0265334_10134673
683 Ga0265318_10071814
684 Ga0265318_10141070
685 Ga0265323_10000417
686 Ga0265323_10008406
687 Ga0265323_10043591
688 Ga0265323_10058341
689 Ga0265323_10166100
690 Ga0265322_10019692
691 Ga0265336_10006299
692 Ga0265336_10020180
693 Ga0265336_10021674
694 Ga0265336_10084268
695 Ga0265338_10000780
696 Ga0265338_10000987
697 Ga0265338_10004601
698 Ga0265338_10006533
699 Ga0265338_10008265
700 Ga0265338_10008911
701 Ga0265338_10012654
702 Ga0265338_10013914
703 Ga0265338_10013920
704 Ga0265338_10015221
705 Ga0265338_10020800
706 Ga0265338_10038711
707 Ga0265338_10052895
708 Ga0265338_10077154
709 Ga0265338_10176641
710 Ga0265338_10179185
711 Ga0265338_10207234
712 Ga0265338_10207408
713 Ga0265338_10209711
714 Ga0265338_10236065
715 Ga0265338_10341742
716 Ga0265338_10514873
717 Ga0265338_10692069
718 Ga0265338_10699517
719 Ga0265338_10865949
720 Ga0265338_10881005
721 Ga0265324_10001945
722 Ga0265324_10014532
723 Ga0265324_10054437
724 Ga0265324_10057138
725 Ga0265324_10058552
726 Ga0265330_10087713
727 Ga0265330_10129209
728 Ga0265320_10000792
729 Ga0265320_10011788
730 Ga0265320_10092206
731 Ga0265320_10108987
732 Ga0265320_10119158
733 Ga0265325_10037424
734 Ga0265325_10151874
735 Ga0265340_10001882
736 Ga0265340_10034214
737 Ga0265339_10018742
738 Ga0265339_10034763
739 Ga0265339_10208358
740 Ga0265339_10224623
741 Ga0265327_10016827
742 Ga0265327_10120370
743 Ga0265316_10001873
744 Ga0265316_10159068
745 Ga0265316_10195887
746 Ga0265316_10256718
747 Ga0265316_11060405
748 Ga0265313_10000967
749 Ga0265313_10303264
750 Ga0265314_10025365
751 Ga0265314_10070841
752 Ga0265314_10214194
753 Ga0265314_10224597
754 Ga0265342_10228855
755 Ga0316576_10526946
756 Ga0373926_0015216
757 Ga0373944_0035825
758 Ga0373954_0001471
759 Ga0373954_0002140
760 Ga0373956_0072036
761 Ga0373956_0224845
762 Ga0373943_0547464
763 Ga0373946_0094733
764 Ga0373946_0274552
765 Ga0373955_0337935
766 Ga0373935_0064365
767 Ga0373935_0115509
768 Ga0373935_0831776
769 Ga0373927_0007553
770 Ga0373933_0114497
771 Ga0373933_0419270
772 Ga0373947_0001855
773 Ga0373947_0240323
774 Ga0373947_0783891
775 Ga0373937_0050542
776 Ga0373937_0212650
777 Ga0373937_0225459
778 Ga0373937_0316148
779 Ga0373925_0005094
780 Ga0373925_0226610
781 Ga0373925_0358436
782 Ga0373925_0485276
783 Ga0451839_1434689
784 Ga0451577_0006545
785 Ga0451577_0136316
786 Ga0451577_0141816
787 Ga0451577_1140756
788 Ga0453684_0003298
789 Ga0453684_0005150
790 Ga0453684_0258266
791 Ga0453684_0611182
792 Ga0453684_1277959
793 Ga0451576_0015000
794 Ga0451576_0048586
795 Ga0451576_0096656
796 Ga0451576_0160518
797 Ga0451576_0196668
798 Ga0451576_0331094
799 Ga0451576_0713850
800 Ga0451576_0718332
801 Ga0451576_1222195
802 Ga0451576_1349557
803 Ga0451576_1740906
804 Ga0495592_0000015
805 Ga0495592_0018446
806 Ga0495592_0136151
807 Ga0495629_0132371
808 Ga0495582_0039765
809 Ga0495639_0129347
810 Ga0495662_0004542
811 Ga0495664_0055490
812 Ga0495618_0007658
813 Ga0495628_0000140
814 Ga0495628_0093687
815 Ga0495628_0114496
816 Ga0495628_0151676
817 Ga0495628_0514408
818 Ga0495630_0000022
819 Ga0495630_0021741
820 Ga0495630_0066878
821 Ga0495630_0188291
822 Ga0495630_0199907
823 Ga0495630_0447376
824 Ga0495666_0040967
825 Ga0495652_0232573
826 Ga0495652_0513339
827 Ga0495640_0018113
828 Ga0495640_0081318
829 Ga0495640_0122708
830 Ga0495640_0242819
831 Ga0495586_0000010
832 Ga0495586_0000942
833 Ga0495586_0001725
834 Ga0495586_0008130
835 Ga0495586_0040090
836 Ga0495586_0315609
837 Ga0495587_0122517
838 Ga0495645_0002009
839 Ga0495645_0051821
840 Ga0495645_0151373
841 Ga0495667_0032330
842 Ga0495634_0006447
843 Ga0495634_0035656
844 Ga0495634_0046148
845 Ga0495635_0132791
846 Ga0495599_0037695
847 Ga0495599_0061823
848 Ga0495646_0095405
849 Ga0495647_0005636
850 Ga0495658_0003253
851 Ga0495658_0023804
852 Ga0495658_0043055
853 Ga0495658_0156850
854 Ga0495669_0131651
855 Ga0495613_0002808
856 Ga0495613_0116957
857 Ga0495624_0039744
858 Ga0495624_0138185
859 Ga0495600_0280130
860 Ga0495600_0289697
861 Ga0495581_0198212
862 Ga0495604_0282480
863 Ga0495604_0537236
864 Ga0495674_0000992
865 Ga0495674_0008677
866 Ga0495674_0109181
867 Ga0495676_0029339
868 Ga0495676_0092476
869 Ga0495680_0005121
870 Ga0495680_0161292
871 Ga0495675_0053686
872 Ga0495675_0086306
873 Ga0495675_0131567
874 Ga0495684_0263310
875 Ga0495684_0355597
876 Ga0496107_0038808
877 Ga0496115_0021650
878 Ga0501031_0000229
879 Ga0501032_0025533
880 Ga0501032_0027127
881 Ga0501033_0004135
882 Ga0501033_0029907
883 Ga0501033_0156409
884 Ga0501034_0220726
885 Ga0501036_0282858
886 Ga0501043_0094146
887 Ga0501046_0240618
888 Ga0501080_1028983
889 Ga0501035_0022917
890 Ga0501035_0042376
891 Ga0501044_0001696
892 Ga0501044_0010340
893 Ga0501044_0434033
894 nmdc:mga05p37_1098706_c1
895 nmdc:mga09592_277175_c1
896 nmdc:mga08y16_11198_c1
897 nmdc:mga08y16_160700_c1
898 nmdc:mga08y16_683265_c1
899 nmdc:mga0rr50_1117390_c1
900 nmdc:mga08x19_106664_c1
901 Ga0495601_0260759
902 Ga0495601_0530454
903 Ga0500650_0003182
904 Ga0587079_015004
905 Ga0587071_018105
906 Ga0466962_0260086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

1

97

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7as8-assembly1.cif.gz_L bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9181 4 124
8fn2-assembly1.cif.gz_J the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9138 4 127
5zeb-assembly1.cif.gz_I m. smegmatis p/p state 70s ribosome structure 0.8928 1 125
8fmw-assembly1.cif.gz_AJ the structure of a hibernating ribosome in the lyme disease pathogen 0.8918 4 143
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.8893 1 125
ID Description Score Start End Superfamily
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8683 2 125 3.30.70.1730
5oolI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8587 1 125 3.30.70.1730
af_Q8I1U9_104_236_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8505 1 125 3.30.70.1730
6dzpI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8442 1 125 3.30.70.1730
af_Q21083_19_191_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8403 1 125 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A7C5H3I0-F1-model_v4 50S ribosomal protein L10 0.9435 1 130 GO:0003735
GO:0006412
GO:0015934
AF-A0A7C1MGM9-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9371 2 109 GO:0005840
GO:1990904
AF-A0A356J529-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9345 1 113 GO:0005840
GO:1990904
AF-A0A346Y3X4-F1-model_v4 Large ribosomal subunit protein uL10 0.933 2 140 GO:0003735
GO:0006412
GO:0015934
GO:0070180
AF-A0A3M1BNV2-F1-model_v4 Large ribosomal subunit protein uL10 0.9312 1 143 GO:0005840
GO:0006412
GO:0070180
GO:1990904

Map