F447180

General Info

Members Datasets Scaffolds Average Seq Length
453 324 906 127

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10496564|Ga0105248_104965643
Length 147
Sequence MKLHIVMIHVRHDFTSQQETIMPLTHIALRRGKPVAYRQAILDGVYAAMRETFNVPEDDRFMTITQHDADEFLYGRSYLGIERSDDLVLIQLTVSNTRTLEQKKALFAAIAKKLGDNPGIRPQDVFVNLVEVVKENWSFGHGLAQYA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
210 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
211 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
216 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
217 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
280 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
304 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
309 2547132374 Acidovorax radicis N35 Isolate Unclassified
310 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
311 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
312 2643221609 Acidovorax sp. Root217 Isolate Unclassified
313 2643221717 Acidovorax sp. Root267 Isolate Unclassified
314 2738543012 Acidovorax sp. CF301 Isolate Unclassified
315 2816332133 Acidovorax radicis 2721A Isolate Unclassified
316 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
317 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
318 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
319 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
320 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
321 2885266251 Ralstonia sp. SET104 Isolate Nodule
322 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
323 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
324 2928058823 Ralstonia sp. 1138 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0
Isolates 3.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.71
Nodule 0.66
Rhizoplane 2.21
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10496564 3300009177 Bacteria 1376
2 JGI24740J21852_10000335 3300001979 Bacteria 19925
3 JGI24751J29686_10007107 3300002459 Bacteria 2289
4 JGI25155J39150_1000284 3300002704 Bacteria 18276
5 JGI25156J39149_1000110 3300002705 Bacteria 59456
6 JGI25156J39149_1001546 3300002705 Bacteria 9501
7 JGI25162J39368_1000210 3300002737 Bacteria 61589
8 JGI25162J39368_1009735 3300002737 Bacteria 1262
9 JGI25154J39366_1000231 3300002738 Bacteria 37387
10 JGI25154J39366_1003628 3300002738 Bacteria 3152
11 JGI25157J39369_1000705 3300002741 Bacteria 18005
12 JGI25157J39369_1001603 3300002741 Bacteria 7905
13 JGI25164J39214_1000004 3300002772 Bacteria 350814
14 JGI25406J46586_10061138 3300003203 Bacteria 1216
15 JGI25406J46586_10169735 3300003203 Bacteria 636
16 JGI25165J46597_1000164 3300003214 Bacteria 104150
17 rootL2_10034869 3300003322 Bacteria 1651
18 rootH1_10067788 3300003323 Bacteria 2700
19 JGI26145J50221_1021737 3300003371 Bacteria 623
20 JGI25404J52841_10017514 3300003659 Bacteria 1553
21 Ga0055532_1000015 3300003758 Bacteria 340197
22 Ga0055527_1000553 3300003760 Bacteria 12422
23 Ga0055535_1000516 3300003761 Bacteria 33686
24 Ga0055542_1000380 3300003762 Bacteria 45333
25 Ga0055529_1000102 3300003763 Bacteria 129901
26 Ga0055529_1002472 3300003763 Bacteria 3566
27 Ga0055529_1003300 3300003763 Bacteria 2718
28 Ga0055529_1009463 3300003763 Bacteria 1277
29 Ga0065712_10056276 3300005290 Bacteria 627
30 Ga0065712_10243264 3300005290 Bacteria 978
31 Ga0065715_10056134 3300005293 Bacteria 766
32 Ga0065715_10284119 3300005293 Bacteria 1079
33 Ga0070676_10489759 3300005328 Bacteria 871
34 Ga0070683_100304525 3300005329 Bacteria 1516
35 Ga0070690_100223903 3300005330 Bacteria 1319
36 Ga0070690_100540913 3300005330 Bacteria 877
37 Ga0070670_100110427 3300005331 Bacteria 2369
38 Ga0070670_100828314 3300005331 Bacteria 837
39 Ga0070677_10010341 3300005333 Bacteria 3189
40 Ga0068869_100053264 3300005334 Bacteria 2941
41 Ga0068869_100115965 3300005334 Bacteria 2043
42 Ga0070666_10815547 3300005335 Bacteria 688
43 Ga0070680_100003110 3300005336 Bacteria 12319
44 Ga0070682_100080162 3300005337 Bacteria 2110
45 Ga0070682_100571977 3300005337 Bacteria 888
46 Ga0068868_100095074 3300005338 Bacteria 2405
47 Ga0068868_101608232 3300005338 Bacteria 611
48 Ga0070660_100199147 3300005339 Bacteria 1624
49 Ga0070689_100050635 3300005340 Bacteria 3209
50 Ga0070687_100018174 3300005343 Bacteria 3247
51 Ga0070687_100022793 3300005343 Bacteria 2966
52 Ga0070692_10262778 3300005345 Bacteria 1038
53 Ga0070668_100099067 3300005347 Bacteria 2308
54 Ga0070669_100093313 3300005353 Bacteria 2260
55 Ga0070669_100664087 3300005353 Bacteria 878
56 Ga0070675_100102967 3300005354 Bacteria 2406
57 Ga0070671_101547986 3300005355 Bacteria 587
58 Ga0070674_100089264 3300005356 Bacteria 2220
59 Ga0070673_100095580 3300005364 Bacteria 2437
60 Ga0070688_100247662 3300005365 Bacteria 1267
61 Ga0070659_100014826 3300005366 Bacteria 5828
62 Ga0070667_100056080 3300005367 Bacteria 3328
63 Ga0070667_100198854 3300005367 Bacteria 1778
64 Ga0070667_100391021 3300005367 Bacteria 1264
65 Ga0070703_10002972 3300005406 Bacteria 4846
66 Ga0070713_100356959 3300005436 Bacteria 1357
67 Ga0070701_10494247 3300005438 Bacteria 793
68 Ga0070705_100000904 3300005440 Bacteria 16573
69 Ga0070700_100014147 3300005441 Bacteria 4503
70 Ga0070694_100001032 3300005444 Bacteria 15865
71 Ga0070708_100006701 3300005445 Bacteria 9172
72 Ga0070663_100025760 3300005455 Bacteria 3974
73 Ga0070663_101941966 3300005455 Bacteria 529
74 Ga0070678_100075211 3300005456 Bacteria 2540
75 Ga0070662_100078273 3300005457 Bacteria 2456
76 Ga0070681_10130902 3300005458 Bacteria 2441
77 Ga0068867_100111919 3300005459 Bacteria 2098
78 Ga0070706_100122926 3300005467 Bacteria 2420
79 Ga0070699_100000310 3300005518 Bacteria 47250
80 Ga0070679_100025982 3300005530 Bacteria 5746
81 Ga0070697_100040287 3300005536 Bacteria 3778
82 Ga0068853_100028394 3300005539 Bacteria 4705
83 Ga0068853_101015361 3300005539 Bacteria 799
84 Ga0070672_100018907 3300005543 Bacteria 4991
85 Ga0070686_100146014 3300005544 Bacteria 1652
86 Ga0070686_100217351 3300005544 Bacteria 1379
87 Ga0070686_100826165 3300005544 Bacteria 749
88 Ga0070695_100000252 3300005545 Bacteria 26824
89 Ga0070696_100000291 3300005546 Bacteria 30308
90 Ga0070704_100000572 3300005549 Bacteria 17742
91 Ga0068855_100297609 3300005563 Bacteria 1788
92 Ga0068855_100554671 3300005563 Bacteria 1243
93 Ga0068857_100020169 3300005577 Bacteria 5860
94 Ga0068857_100045034 3300005577 Bacteria 3913
95 Ga0068857_100907333 3300005577 Bacteria 845
96 Ga0068854_100032721 3300005578 Bacteria 3620
97 Ga0068856_100000052 3300005614 Bacteria 107163
98 Ga0068856_100033745 3300005614 Bacteria 5012
99 Ga0068856_101032677 3300005614 Bacteria 840
100 Ga0070702_100214231 3300005615 Bacteria 1284
101 Ga0068852_100047060 3300005616 Bacteria 3678
102 Ga0068852_100136424 3300005616 Bacteria 2266
103 Ga0068859_100005637 3300005617 Bacteria 12763
104 Ga0068859_100061751 3300005617 Bacteria 3776
105 Ga0068864_100121218 3300005618 Bacteria 2338
106 Ga0068866_10049668 3300005718 Bacteria 2127
107 Ga0068861_100064239 3300005719 Bacteria 2824
108 Ga0068861_100272946 3300005719 Bacteria 1453
109 Ga0068870_10230965 3300005840 Bacteria 1137
110 Ga0068863_100081386 3300005841 Bacteria 3067
111 Ga0068858_101243549 3300005842 Bacteria 732
112 Ga0068860_100005359 3300005843 Bacteria 13015
113 Ga0068862_100020652 3300005844 Bacteria 5502
114 Ga0081540_1000054 3300005983 Bacteria 122877
115 Ga0081539_10000798 3300005985 Bacteria 61226
116 Ga0081539_10274201 3300005985 Bacteria 737
117 Ga0075363_100327455 3300006048 Bacteria 892
118 Ga0075363_100619765 3300006048 Bacteria 649
119 Ga0070712_100171719 3300006175 Bacteria 1683
120 Ga0070712_100794190 3300006175 Bacteria 812
121 Ga0075362_10034161 3300006177 Bacteria 2216
122 Ga0075366_10238782 3300006195 Bacteria 1108
123 Ga0097621_101003273 3300006237 Bacteria 781
124 Ga0075428_100016387 3300006844 Bacteria 8189
125 Ga0075430_100009311 3300006846 Bacteria 8302
126 Ga0075431_100004515 3300006847 Bacteria 13665
127 Ga0075431_101288677 3300006847 Bacteria 692
128 Ga0075434_100102300 3300006871 Bacteria 2872
129 Ga0075434_100895109 3300006871 Bacteria 902
130 Ga0075429_100002526 3300006880 Bacteria 15402
131 Ga0068865_100141844 3300006881 Bacteria 1812
132 Ga0097620_100005637 3300006931 Bacteria 12763
133 Ga0097620_100061753 3300006931 Bacteria 3776
134 Ga0075435_100062188 3300007076 Bacteria 3030
135 Ga0075435_100325648 3300007076 Bacteria 1315
136 Ga0105251_10166672 3300009011 Bacteria 993
137 Ga0105250_10084786 3300009092 Bacteria 1286
138 Ga0105240_10009719 3300009093 Bacteria 13582
139 Ga0105240_10313309 3300009093 Bacteria 1791
140 Ga0111539_10003032 3300009094 Bacteria 22269
141 Ga0111539_12411675 3300009094 Bacteria 610
142 Ga0105245_10076524 3300009098 Bacteria 3049
143 Ga0105247_10030765 3300009101 Bacteria 3255
144 Ga0105247_10706662 3300009101 Bacteria 759
145 Ga0114129_10001297 3300009147 Bacteria 33328
146 Ga0114129_12039140 3300009147 Bacteria 693
147 Ga0114129_13187140 3300009147 Bacteria 534
148 Ga0105243_10007851 3300009148 Bacteria 8200
149 Ga0105243_10110930 3300009148 Bacteria 2295
150 Ga0105243_10194604 3300009148 Bacteria 1774
151 Ga0105243_10505870 3300009148 Bacteria 1146
152 Ga0105242_11423738 3300009176 Bacteria 721
153 Ga0105237_11832530 3300009545 Bacteria 614
154 Ga0105238_10021837 3300009551 Bacteria 6520
155 Ga0105238_10062062 3300009551 Bacteria 3739
156 Ga0105238_10136066 3300009551 Bacteria 2435
157 Ga0105238_11427176 3300009551 Bacteria 720
158 Ga0105238_12094276 3300009551 Bacteria 600
159 Ga0105249_10050406 3300009553 Bacteria 3795
160 Ga0105249_10158189 3300009553 Bacteria 2187
161 Ga0105147_105625 3300009982 Bacteria 1055
162 Ga0105239_10547325 3300010375 Bacteria 1318
163 Ga0105246_10038090 3300011119 Bacteria 3230
164 Ga0105246_10196168 3300011119 Bacteria 1566
165 Ga0105246_10300498 3300011119 Bacteria 1296
166 Ga0157373_10132481 3300013100 Bacteria 1753
167 Ga0157369_10002393 3300013105 Bacteria 22529
168 Ga0157378_10286208 3300013297 Bacteria 1590
169 Ga0163162_11242553 3300013306 Bacteria 846
170 Ga0157372_10857957 3300013307 Bacteria 1054
171 Ga0157380_10980156 3300014326 Bacteria 877
172 Ga0157380_11464402 3300014326 Bacteria 735
173 Ga0182008_10019867 3300014497 Bacteria 3463
174 Ga0157376_10045903 3300014969 Bacteria 3600
175 Ga0157376_11312317 3300014969 Bacteria 754
176 Ga0182006_1017997 3300015261 Bacteria 2992
177 Ga0182006_1061610 3300015261 Bacteria 1414
178 Ga0182006_1155058 3300015261 Bacteria 775
179 Ga0182007_10005254 3300015262 Bacteria 5715
180 Ga0182007_10076728 3300015262 Bacteria 1095
181 Ga0163161_10108833 3300017792 Bacteria 2070
182 Ga0213872_10192661 3300021361 Bacteria 877
183 Ga0213874_10034098 3300021377 Bacteria 1488
184 Ga0213876_10242273 3300021384 Bacteria 958
185 Ga0209435_100021 3300025206 Bacteria 223961
186 Ga0209674_101454 3300025226 Bacteria 6254
187 Ga0209672_100084 3300025228 Bacteria 129975
188 Ga0209672_103858 3300025228 Bacteria 2964
189 Ga0209147_100004 3300025229 Bacteria 1371850
190 Ga0209147_100008 3300025229 Bacteria 777096
191 Ga0207427_100031 3300025231 Bacteria 350866
192 Ga0209437_100045 3300025233 Bacteria 429809
193 Ga0209437_100061 3300025233 Bacteria 350866
194 Ga0209258_100013 3300025242 Bacteria 777096
195 Ga0209258_100083 3300025242 Bacteria 246008
196 Ga0209258_100188 3300025242 Bacteria 130022
197 Ga0209646_1000074 3300025246 Bacteria 223961
198 Ga0209646_1000784 3300025246 Bacteria 10955
199 Ga0209026_1000058 3300025250 Bacteria 228656
200 Ga0209026_1000564 3300025250 Bacteria 25164
201 Ga0209026_1003550 3300025250 Bacteria 5047
202 Ga0209677_100875 3300025253 Bacteria 14783
203 Ga0209148_1000063 3300025254 Bacteria 346881
204 Ga0209148_1010784 3300025254 Bacteria 1722
205 Ga0209759_1000046 3300025256 Bacteria 230149
206 Ga0209759_1000137 3300025256 Bacteria 125216
207 Ga0209233_1000076 3300025261 Bacteria 350866
208 Ga0209455_1000130 3300025272 Bacteria 161669
209 Ga0209455_1000142 3300025272 Bacteria 138027
210 Ga0209455_1000165 3300025272 Bacteria 113465
211 Ga0209455_1000532 3300025272 Bacteria 26493
212 Ga0209455_1003399 3300025272 Bacteria 5644
213 Ga0209455_1006647 3300025272 Bacteria 3390
214 Ga0207697_10101415 3300025315 Bacteria 1227
215 Ga0207653_10001542 3300025885 Bacteria 7459
216 Ga0207682_10002152 3300025893 Bacteria 8934
217 Ga0207642_10770493 3300025899 Bacteria 610
218 Ga0207710_10021526 3300025900 Bacteria 2764
219 Ga0207688_10162616 3300025901 Bacteria 1324
220 Ga0207680_10676426 3300025903 Bacteria 739
221 Ga0207647_10216192 3300025904 Bacteria 1106
222 Ga0207645_10101903 3300025907 Bacteria 1852
223 Ga0207643_10099138 3300025908 Bacteria 1707
224 Ga0207684_10093345 3300025910 Bacteria 2566
225 Ga0207654_10466995 3300025911 Bacteria 887
226 Ga0207654_11126971 3300025911 Bacteria 572
227 Ga0207695_10004054 3300025913 Bacteria 20140
228 Ga0207693_10106308 3300025915 Bacteria 2201
229 Ga0207660_10003462 3300025917 Bacteria 10286
230 Ga0207662_10091476 3300025918 Bacteria 1872
231 Ga0207662_10146610 3300025918 Bacteria 1498
232 Ga0207681_10020340 3300025923 Bacteria 4204
233 Ga0207694_10011727 3300025924 Bacteria 6612
234 Ga0207694_10076984 3300025924 Bacteria 2613
235 Ga0207694_10259555 3300025924 Bacteria 1423
236 Ga0207650_10151391 3300025925 Bacteria 1831
237 Ga0207650_10177976 3300025925 Bacteria 1694
238 Ga0207659_10031337 3300025926 Bacteria 3639
239 Ga0207687_10043939 3300025927 Bacteria 3081
240 Ga0207700_10487275 3300025928 Bacteria 1090
241 Ga0207690_10002224 3300025932 Bacteria 11831
242 Ga0207709_10689143 3300025935 Bacteria 817
243 Ga0207670_10223523 3300025936 Bacteria 1443
244 Ga0207670_10268800 3300025936 Bacteria 1324
245 Ga0207669_10002493 3300025937 Bacteria 7851
246 Ga0207704_10461212 3300025938 Bacteria 1016
247 Ga0207665_10227685 3300025939 Bacteria 1369
248 Ga0207691_10003899 3300025940 Bacteria 14490
249 Ga0207689_10021651 3300025942 Bacteria 5406
250 Ga0207661_10139029 3300025944 Bacteria 2088
251 Ga0207679_10444007 3300025945 Bacteria 1149
252 Ga0207667_10126273 3300025949 Bacteria 2635
253 Ga0207667_10295254 3300025949 Bacteria 1656
254 Ga0207667_10795066 3300025949 Bacteria 943
255 Ga0207667_10886666 3300025949 Bacteria 884
256 Ga0207712_10031435 3300025961 Bacteria 3576
257 Ga0207668_10315034 3300025972 Bacteria 1296
258 Ga0207640_10012601 3300025981 Bacteria 4822
259 Ga0207640_11368539 3300025981 Bacteria 633
260 Ga0207658_10170622 3300025986 Bacteria 1792
261 Ga0207658_10275840 3300025986 Bacteria 1439
262 Ga0207677_10497793 3300026023 Bacteria 1053
263 Ga0207703_10589215 3300026035 Bacteria 1051
264 Ga0207639_10019474 3300026041 Bacteria 4841
265 Ga0207639_11078377 3300026041 Bacteria 753
266 Ga0207678_10040798 3300026067 Bacteria 4024
267 Ga0207708_10010530 3300026075 Bacteria 6864
268 Ga0207702_10000176 3300026078 Bacteria 77063
269 Ga0207702_10016515 3300026078 Bacteria 6110
270 Ga0207641_10088421 3300026088 Bacteria 2705
271 Ga0207648_10027091 3300026089 Bacteria 5091
272 Ga0207676_10088433 3300026095 Bacteria 2536
273 Ga0207674_10021861 3300026116 Bacteria 6883
274 Ga0207674_10038272 3300026116 Bacteria 4981
275 Ga0207674_10948381 3300026116 Bacteria 829
276 Ga0207675_100095976 3300026118 Bacteria 2791
277 Ga0207675_100207434 3300026118 Bacteria 1883
278 Ga0207683_10004339 3300026121 Bacteria 12242
279 Ga0207698_10025925 3300026142 Bacteria 4140
280 Ga0209974_10001784 3300027876 Bacteria 7851
281 Ga0207428_10014002 3300027907 Bacteria 6985
282 Ga0268265_10069268 3300028380 Bacteria 2738
283 Ga0268264_10014332 3300028381 Bacteria 6519
284 Ga0307408_100000107 3300031548 Bacteria 91378
285 Ga0307406_10000377 3300031901 Bacteria 25667
286 Ga0307411_10296111 3300032005 Bacteria 1295
287 Ga0373938_0122215 3300034957 Bacteria 672
288 Ga0373936_0246240 3300035113 Bacteria 797
289 Ga0373939_0193057 3300035114 Bacteria 766
290 Ga0373956_0470686 3300035119 Bacteria 600
291 Ga0373957_0532481 3300035120 Bacteria 513
292 Ga0373937_0045659 3300036401 Bacteria 4004
293 Ga0395900_1597704 3300037418 Bacteria 563
294 Ga0436364_0065012 3300037853 Bacteria 649
295 Ga0436364_0974950 3300037853 Bacteria 1154
296 Ga0436365_0169698 3300039437 Bacteria 4318
297 Ga0436365_1114975 3300039437 Bacteria 573
298 Ga0436361_0519167 3300039447 Bacteria 5353
299 Ga0436361_0592121 3300039447 Bacteria 1933
300 Ga0436363_0536700 3300039450 Bacteria 2296
301 Ga0436363_1686322 3300039450 Unclassified 818
302 Ga0451843_1024429 3300041509 Bacteria 634
303 Ga0450917_021664 3300042120 Bacteria 577
304 Ga0450900_052012 3300042136 Bacteria 628
305 Ga0439460_0265656 3300042461 Bacteria 595
306 Ga0466988_0004102 3300044536 Bacteria 6189
307 Ga0466969_0004351 3300044656 Bacteria 7538
308 Ga0466989_0047076 3300044663 Bacteria 2630
309 Ga0466989_0423199 3300044663 Bacteria 699
310 Ga0466978_0067488 3300044671 Bacteria 2231
311 Ga0466982_0057391 3300044672 Bacteria 2391
312 Ga0466965_0059042 3300044683 Bacteria 1913
313 Ga0466966_0025998 3300044684 Bacteria 3822
314 Ga0466961_0000452 3300044693 Bacteria 26070
315 Ga0466961_0011791 3300044693 Bacteria 5586
316 Ga0466963_0019738 3300044694 Bacteria 4233
317 Ga0466971_0006005 3300044719 Bacteria 5284
318 Ga0466971_0012054 3300044719 Bacteria 3788
319 Ga0466968_0002968 3300044735 Bacteria 6267
320 Ga0466970_0000809 3300044765 Bacteria 15074
321 Ga0466957_0017876 3300044842 Bacteria 4159
322 Ga0466960_0037266 3300044901 Bacteria 2281
323 Ga0466959_0002258 3300045049 Bacteria 12281
324 Ga0466959_0004477 3300045049 Bacteria 9361
325 Ga0466958_0274274 3300045836 Bacteria 1080
326 Ga0466967_0583891 3300045976 Bacteria 1102
327 Ga0466967_0986747 3300045976 Bacteria 838
328 Ga0495605_0011176 3300046474 Bacteria 5016
329 Ga0495640_0399655 3300046533 Bacteria 844
330 Ga0495621_0008782 3300046539 Bacteria 3042
331 Ga0495634_0246571 3300046642 Bacteria 1094
332 Ga0495657_0827701 3300046675 Bacteria 528
333 Ga0495613_0293712 3300046689 Bacteria 1126
334 Ga0495671_0379021 3300046692 Bacteria 678
335 Ga0495674_0124331 3300047319 Bacteria 2178
336 Ga0495680_0148463 3300047322 Bacteria 1711
337 Ga0495602_0469458 3300048088 Bacteria 885
338 Ga0495615_0069460 3300048090 Bacteria 946
339 Ga0496101_0199230 3300048904 Bacteria 1547
340 Ga0496102_0001064 3300048905 Bacteria 25416
341 Ga0496103_0499295 3300048906 Bacteria 778
342 Ga0496104_0713770 3300048907 Bacteria 910
343 Ga0496106_0000463 3300048909 Bacteria 29093
344 Ga0496107_0156149 3300048910 Bacteria 1689
345 Ga0496108_0541316 3300048911 Bacteria 1016
346 Ga0496110_0968684 3300048913 Bacteria 758
347 Ga0496115_0039176 3300048918 Bacteria 3763
348 Ga0496116_0007373 3300048919 Bacteria 9776
349 Ga0496116_0188894 3300048919 Bacteria 1093
350 Ga0496117_0043266 3300048920 Bacteria 3277
351 Ga0496118_0047093 3300048921 Bacteria 3347
352 Ga0496118_0049238 3300048921 Bacteria 3247
353 Ga0496118_0209072 3300048921 Bacteria 1147
354 Ga0496119_0492821 3300048922 Bacteria 571
355 Ga0496121_0196593 3300048924 Bacteria 1441
356 Ga0496122_0001387 3300048925 Bacteria 39286
357 Ga0496123_0000180 3300048926 Bacteria 127726
358 Ga0496123_0481202 3300048926 Bacteria 546
359 Ga0496124_0112107 3300048927 Bacteria 2194
360 Ga0496125_0007387 3300048928 Bacteria 11696
361 Ga0496125_0065495 3300048928 Bacteria 2878
362 Ga0496125_0278097 3300048928 Bacteria 1039
363 Ga0501031_0014448 3300049568 Bacteria 5131
364 Ga0501031_0070930 3300049568 Bacteria 2269
365 Ga0501032_0076774 3300049569 Bacteria 2224
366 Ga0501033_0001540 3300049570 Bacteria 20386
367 Ga0501033_0017572 3300049570 Bacteria 5403
368 Ga0501033_0339021 3300049570 Bacteria 1054
369 Ga0501033_0597239 3300049570 Bacteria 757
370 Ga0501034_0758739 3300049571 Bacteria 865
371 Ga0501036_0078192 3300049572 Bacteria 2798
372 Ga0501037_0586673 3300049573 Bacteria 749
373 Ga0501038_0134428 3300049574 Bacteria 2027
374 Ga0501038_0613156 3300049574 Bacteria 822
375 Ga0501039_0074408 3300049575 Bacteria 2640
376 Ga0501039_0200661 3300049575 Bacteria 1568
377 Ga0501040_0227867 3300049576 Bacteria 1327
378 Ga0501040_0262555 3300049576 Bacteria 1232
379 Ga0501041_0183148 3300049577 Bacteria 1311
380 Ga0501042_0459066 3300049578 Bacteria 924
381 Ga0501043_0015034 3300049579 Bacteria 6061
382 Ga0501043_0077443 3300049579 Bacteria 2613
383 Ga0501046_0037729 3300049580 Bacteria 3882
384 Ga0501046_0079641 3300049580 Bacteria 2532
385 Ga0501047_0050301 3300049581 Bacteria 4024
386 Ga0501047_0079547 3300049581 Bacteria 3151
387 Ga0501047_0162218 3300049581 Bacteria 2107
388 Ga0501047_0927490 3300049581 Bacteria 684
389 Ga0501048_0060560 3300049582 Bacteria 2683
390 Ga0501048_0124797 3300049582 Bacteria 1820
391 Ga0501048_0186455 3300049582 Bacteria 1470
392 Ga0501070_0135662 3300049586 Bacteria 2032
393 Ga0501075_0055362 3300049591 Bacteria 2985
394 Ga0501076_0176182 3300049592 Bacteria 1743
395 Ga0501077_0076645 3300049593 Bacteria 2118
396 Ga0501223_043178 3300049663 Bacteria 875
397 Ga0501249_041557 3300049679 Bacteria 1043
398 Ga0501221_139441 3300049704 Bacteria 634
399 Ga0501079_0828623 3300049741 Bacteria 728
400 Ga0501080_0100049 3300049742 Bacteria 2690
401 Ga0501081_0110490 3300049743 Bacteria 1950
402 Ga0501083_1086404 3300049744 Bacteria 521
403 Ga0501279_010442 3300049775 Bacteria 1249
404 Ga0501035_0026921 3300049822 Bacteria 5257
405 Ga0501035_0029994 3300049822 Bacteria 4960
406 Ga0501035_0112315 3300049822 Bacteria 2387
407 Ga0501035_0128924 3300049822 Bacteria 2206
408 Ga0501035_0339912 3300049822 Bacteria 1258
409 Ga0501044_0034629 3300049823 Bacteria 5294
410 Ga0501044_0141060 3300049823 Bacteria 2398
411 Ga0501044_1105256 3300049823 Bacteria 662
412 Ga0501045_0165241 3300049824 Bacteria 1648
413 Ga0501226_011719 3300049853 Bacteria 971
414 nmdc:mga03683_26639_c1 3300050489 Bacteria 1797
415 nmdc:mga03n38_605460_c1 3300050490 Bacteria 624
416 nmdc:mga03n38_740172_c1 3300050490 Bacteria 569
417 nmdc:mga06z11_710826_c1 3300050494 Bacteria 612
418 nmdc:mga05p37_901_c1 3300050507 Bacteria 33493
419 nmdc:mga09592_69137_c1 3300050508 Bacteria 2996
420 nmdc:mga0qj67_16040_c1 3300050509 Bacteria 5674
421 nmdc:mga06r32_256841_c1 3300050510 Bacteria 1735
422 nmdc:mga06r32_4437_c1 3300050510 Bacteria 12559
423 nmdc:mga08y16_1083_c1 3300050511 Bacteria 26813
424 nmdc:mga0n895_312902_c1 3300050512 Bacteria 1591
425 nmdc:mga0n895_329872_c1 3300050512 Bacteria 1546
426 nmdc:mga08x19_901314_c1 3300050514 Bacteria 628
427 nmdc:mga0a205_599053_c1 3300050515 Bacteria 955
428 nmdc:mga0a205_736950_c1 3300050515 Bacteria 834
429 Ga0495595_0381299 3300053084 Bacteria 713
430 Ga0500646_0081719 3300053090 Bacteria 987
431 Ga0500568_0253839 3300053139 Bacteria 640
432 Ga0500577_0337856 3300053142 Bacteria 658
433 Ga0501084_0091446 3300054114 Bacteria 2555
434 Ga0501082_0000040 3300060353 Bacteria 91596
435 Ga0466962_0002805 3300061719 Bacteria 8290
436 Ga0466962_0064585 3300061719 Bacteria 1748
437 Ga0530510_0154184 3300061734 Bacteria 1697
438 2548499522 2547132374 Bacteria 5530232
439 2550692471 2548876994 Bacteria 4904866
440 2599445035 2599185178 Bacteria 5365746
441 2644061968 2643221609 Bacteria 6756331
442 2644648187 2643221717 Bacteria 5676132
443 2739245037 2738543012 Bacteria 7115078
444 2816474604 2816332133 Bacteria 7249298
445 2819592186 2818991445 Bacteria 4955017
446 2821446168 2821443989 Bacteria 7658172
447 2884816108 2884811622 Bacteria 5552861
448 2884840392 2884836552 Bacteria 5219991
449 2884855648 2884852848 Bacteria 5221161
450 2885270486 2885266251 Bacteria 4796748
451 2896157426 2896154374 Bacteria 5221518
452 2900580608 2900577576 Bacteria 5438534
453 2928060191 2928058823 Bacteria 5520022
454 Ga0105248_10496564
455 JGI24740J21852_10000335
456 JGI24751J29686_10007107
457 JGI25155J39150_1000284
458 JGI25156J39149_1000110
459 JGI25156J39149_1001546
460 JGI25162J39368_1000210
461 JGI25162J39368_1009735
462 JGI25154J39366_1000231
463 JGI25154J39366_1003628
464 JGI25157J39369_1000705
465 JGI25157J39369_1001603
466 JGI25164J39214_1000004
467 JGI25406J46586_10061138
468 JGI25406J46586_10169735
469 JGI25165J46597_1000164
470 rootL2_10034869
471 rootH1_10067788
472 JGI26145J50221_1021737
473 JGI25404J52841_10017514
474 Ga0055532_1000015
475 Ga0055527_1000553
476 Ga0055535_1000516
477 Ga0055542_1000380
478 Ga0055529_1000102
479 Ga0055529_1002472
480 Ga0055529_1003300
481 Ga0055529_1009463
482 Ga0065712_10056276
483 Ga0065712_10243264
484 Ga0065715_10056134
485 Ga0065715_10284119
486 Ga0070676_10489759
487 Ga0070683_100304525
488 Ga0070690_100223903
489 Ga0070690_100540913
490 Ga0070670_100110427
491 Ga0070670_100828314
492 Ga0070677_10010341
493 Ga0068869_100053264
494 Ga0068869_100115965
495 Ga0070666_10815547
496 Ga0070680_100003110
497 Ga0070682_100080162
498 Ga0070682_100571977
499 Ga0068868_100095074
500 Ga0068868_101608232
501 Ga0070660_100199147
502 Ga0070689_100050635
503 Ga0070687_100018174
504 Ga0070687_100022793
505 Ga0070692_10262778
506 Ga0070668_100099067
507 Ga0070669_100093313
508 Ga0070669_100664087
509 Ga0070675_100102967
510 Ga0070671_101547986
511 Ga0070674_100089264
512 Ga0070673_100095580
513 Ga0070688_100247662
514 Ga0070659_100014826
515 Ga0070667_100056080
516 Ga0070667_100198854
517 Ga0070667_100391021
518 Ga0070703_10002972
519 Ga0070713_100356959
520 Ga0070701_10494247
521 Ga0070705_100000904
522 Ga0070700_100014147
523 Ga0070694_100001032
524 Ga0070708_100006701
525 Ga0070663_100025760
526 Ga0070663_101941966
527 Ga0070678_100075211
528 Ga0070662_100078273
529 Ga0070681_10130902
530 Ga0068867_100111919
531 Ga0070706_100122926
532 Ga0070699_100000310
533 Ga0070679_100025982
534 Ga0070697_100040287
535 Ga0068853_100028394
536 Ga0068853_101015361
537 Ga0070672_100018907
538 Ga0070686_100146014
539 Ga0070686_100217351
540 Ga0070686_100826165
541 Ga0070695_100000252
542 Ga0070696_100000291
543 Ga0070704_100000572
544 Ga0068855_100297609
545 Ga0068855_100554671
546 Ga0068857_100020169
547 Ga0068857_100045034
548 Ga0068857_100907333
549 Ga0068854_100032721
550 Ga0068856_100000052
551 Ga0068856_100033745
552 Ga0068856_101032677
553 Ga0070702_100214231
554 Ga0068852_100047060
555 Ga0068852_100136424
556 Ga0068859_100005637
557 Ga0068859_100061751
558 Ga0068864_100121218
559 Ga0068866_10049668
560 Ga0068861_100064239
561 Ga0068861_100272946
562 Ga0068870_10230965
563 Ga0068863_100081386
564 Ga0068858_101243549
565 Ga0068860_100005359
566 Ga0068862_100020652
567 Ga0081540_1000054
568 Ga0081539_10000798
569 Ga0081539_10274201
570 Ga0075363_100327455
571 Ga0075363_100619765
572 Ga0070712_100171719
573 Ga0070712_100794190
574 Ga0075362_10034161
575 Ga0075366_10238782
576 Ga0097621_101003273
577 Ga0075428_100016387
578 Ga0075430_100009311
579 Ga0075431_100004515
580 Ga0075431_101288677
581 Ga0075434_100102300
582 Ga0075434_100895109
583 Ga0075429_100002526
584 Ga0068865_100141844
585 Ga0097620_100005637
586 Ga0097620_100061753
587 Ga0075435_100062188
588 Ga0075435_100325648
589 Ga0105251_10166672
590 Ga0105250_10084786
591 Ga0105240_10009719
592 Ga0105240_10313309
593 Ga0111539_10003032
594 Ga0111539_12411675
595 Ga0105245_10076524
596 Ga0105247_10030765
597 Ga0105247_10706662
598 Ga0114129_10001297
599 Ga0114129_12039140
600 Ga0114129_13187140
601 Ga0105243_10007851
602 Ga0105243_10110930
603 Ga0105243_10194604
604 Ga0105243_10505870
605 Ga0105242_11423738
606 Ga0105237_11832530
607 Ga0105238_10021837
608 Ga0105238_10062062
609 Ga0105238_10136066
610 Ga0105238_11427176
611 Ga0105238_12094276
612 Ga0105249_10050406
613 Ga0105249_10158189
614 Ga0105147_105625
615 Ga0105239_10547325
616 Ga0105246_10038090
617 Ga0105246_10196168
618 Ga0105246_10300498
619 Ga0157373_10132481
620 Ga0157369_10002393
621 Ga0157378_10286208
622 Ga0163162_11242553
623 Ga0157372_10857957
624 Ga0157380_10980156
625 Ga0157380_11464402
626 Ga0182008_10019867
627 Ga0157376_10045903
628 Ga0157376_11312317
629 Ga0182006_1017997
630 Ga0182006_1061610
631 Ga0182006_1155058
632 Ga0182007_10005254
633 Ga0182007_10076728
634 Ga0163161_10108833
635 Ga0213872_10192661
636 Ga0213874_10034098
637 Ga0213876_10242273
638 Ga0209435_100021
639 Ga0209674_101454
640 Ga0209672_100084
641 Ga0209672_103858
642 Ga0209147_100004
643 Ga0209147_100008
644 Ga0207427_100031
645 Ga0209437_100045
646 Ga0209437_100061
647 Ga0209258_100013
648 Ga0209258_100083
649 Ga0209258_100188
650 Ga0209646_1000074
651 Ga0209646_1000784
652 Ga0209026_1000058
653 Ga0209026_1000564
654 Ga0209026_1003550
655 Ga0209677_100875
656 Ga0209148_1000063
657 Ga0209148_1010784
658 Ga0209759_1000046
659 Ga0209759_1000137
660 Ga0209233_1000076
661 Ga0209455_1000130
662 Ga0209455_1000142
663 Ga0209455_1000165
664 Ga0209455_1000532
665 Ga0209455_1003399
666 Ga0209455_1006647
667 Ga0207697_10101415
668 Ga0207653_10001542
669 Ga0207682_10002152
670 Ga0207642_10770493
671 Ga0207710_10021526
672 Ga0207688_10162616
673 Ga0207680_10676426
674 Ga0207647_10216192
675 Ga0207645_10101903
676 Ga0207643_10099138
677 Ga0207684_10093345
678 Ga0207654_10466995
679 Ga0207654_11126971
680 Ga0207695_10004054
681 Ga0207693_10106308
682 Ga0207660_10003462
683 Ga0207662_10091476
684 Ga0207662_10146610
685 Ga0207681_10020340
686 Ga0207694_10011727
687 Ga0207694_10076984
688 Ga0207694_10259555
689 Ga0207650_10151391
690 Ga0207650_10177976
691 Ga0207659_10031337
692 Ga0207687_10043939
693 Ga0207700_10487275
694 Ga0207690_10002224
695 Ga0207709_10689143
696 Ga0207670_10223523
697 Ga0207670_10268800
698 Ga0207669_10002493
699 Ga0207704_10461212
700 Ga0207665_10227685
701 Ga0207691_10003899
702 Ga0207689_10021651
703 Ga0207661_10139029
704 Ga0207679_10444007
705 Ga0207667_10126273
706 Ga0207667_10295254
707 Ga0207667_10795066
708 Ga0207667_10886666
709 Ga0207712_10031435
710 Ga0207668_10315034
711 Ga0207640_10012601
712 Ga0207640_11368539
713 Ga0207658_10170622
714 Ga0207658_10275840
715 Ga0207677_10497793
716 Ga0207703_10589215
717 Ga0207639_10019474
718 Ga0207639_11078377
719 Ga0207678_10040798
720 Ga0207708_10010530
721 Ga0207702_10000176
722 Ga0207702_10016515
723 Ga0207641_10088421
724 Ga0207648_10027091
725 Ga0207676_10088433
726 Ga0207674_10021861
727 Ga0207674_10038272
728 Ga0207674_10948381
729 Ga0207675_100095976
730 Ga0207675_100207434
731 Ga0207683_10004339
732 Ga0207698_10025925
733 Ga0209974_10001784
734 Ga0207428_10014002
735 Ga0268265_10069268
736 Ga0268264_10014332
737 Ga0307408_100000107
738 Ga0307406_10000377
739 Ga0307411_10296111
740 Ga0373938_0122215
741 Ga0373936_0246240
742 Ga0373939_0193057
743 Ga0373956_0470686
744 Ga0373957_0532481
745 Ga0373937_0045659
746 Ga0395900_1597704
747 Ga0436364_0065012
748 Ga0436364_0974950
749 Ga0436365_0169698
750 Ga0436365_1114975
751 Ga0436361_0519167
752 Ga0436361_0592121
753 Ga0436363_0536700
754 Ga0436363_1686322
755 Ga0451843_1024429
756 Ga0450917_021664
757 Ga0450900_052012
758 Ga0439460_0265656
759 Ga0466988_0004102
760 Ga0466969_0004351
761 Ga0466989_0047076
762 Ga0466989_0423199
763 Ga0466978_0067488
764 Ga0466982_0057391
765 Ga0466965_0059042
766 Ga0466966_0025998
767 Ga0466961_0000452
768 Ga0466961_0011791
769 Ga0466963_0019738
770 Ga0466971_0006005
771 Ga0466971_0012054
772 Ga0466968_0002968
773 Ga0466970_0000809
774 Ga0466957_0017876
775 Ga0466960_0037266
776 Ga0466959_0002258
777 Ga0466959_0004477
778 Ga0466958_0274274
779 Ga0466967_0583891
780 Ga0466967_0986747
781 Ga0495605_0011176
782 Ga0495640_0399655
783 Ga0495621_0008782
784 Ga0495634_0246571
785 Ga0495657_0827701
786 Ga0495613_0293712
787 Ga0495671_0379021
788 Ga0495674_0124331
789 Ga0495680_0148463
790 Ga0495602_0469458
791 Ga0495615_0069460
792 Ga0496101_0199230
793 Ga0496102_0001064
794 Ga0496103_0499295
795 Ga0496104_0713770
796 Ga0496106_0000463
797 Ga0496107_0156149
798 Ga0496108_0541316
799 Ga0496110_0968684
800 Ga0496115_0039176
801 Ga0496116_0007373
802 Ga0496116_0188894
803 Ga0496117_0043266
804 Ga0496118_0047093
805 Ga0496118_0049238
806 Ga0496118_0209072
807 Ga0496119_0492821
808 Ga0496121_0196593
809 Ga0496122_0001387
810 Ga0496123_0000180
811 Ga0496123_0481202
812 Ga0496124_0112107
813 Ga0496125_0007387
814 Ga0496125_0065495
815 Ga0496125_0278097
816 Ga0501031_0014448
817 Ga0501031_0070930
818 Ga0501032_0076774
819 Ga0501033_0001540
820 Ga0501033_0017572
821 Ga0501033_0339021
822 Ga0501033_0597239
823 Ga0501034_0758739
824 Ga0501036_0078192
825 Ga0501037_0586673
826 Ga0501038_0134428
827 Ga0501038_0613156
828 Ga0501039_0074408
829 Ga0501039_0200661
830 Ga0501040_0227867
831 Ga0501040_0262555
832 Ga0501041_0183148
833 Ga0501042_0459066
834 Ga0501043_0015034
835 Ga0501043_0077443
836 Ga0501046_0037729
837 Ga0501046_0079641
838 Ga0501047_0050301
839 Ga0501047_0079547
840 Ga0501047_0162218
841 Ga0501047_0927490
842 Ga0501048_0060560
843 Ga0501048_0124797
844 Ga0501048_0186455
845 Ga0501070_0135662
846 Ga0501075_0055362
847 Ga0501076_0176182
848 Ga0501077_0076645
849 Ga0501223_043178
850 Ga0501249_041557
851 Ga0501221_139441
852 Ga0501079_0828623
853 Ga0501080_0100049
854 Ga0501081_0110490
855 Ga0501083_1086404
856 Ga0501279_010442
857 Ga0501035_0026921
858 Ga0501035_0029994
859 Ga0501035_0112315
860 Ga0501035_0128924
861 Ga0501035_0339912
862 Ga0501044_0034629
863 Ga0501044_0141060
864 Ga0501044_1105256
865 Ga0501045_0165241
866 Ga0501226_011719
867 nmdc:mga03683_26639_c1
868 nmdc:mga03n38_605460_c1
869 nmdc:mga03n38_740172_c1
870 nmdc:mga06z11_710826_c1
871 nmdc:mga05p37_901_c1
872 nmdc:mga09592_69137_c1
873 nmdc:mga0qj67_16040_c1
874 nmdc:mga06r32_256841_c1
875 nmdc:mga06r32_4437_c1
876 nmdc:mga08y16_1083_c1
877 nmdc:mga0n895_312902_c1
878 nmdc:mga0n895_329872_c1
879 nmdc:mga08x19_901314_c1
880 nmdc:mga0a205_599053_c1
881 nmdc:mga0a205_736950_c1
882 Ga0495595_0381299
883 Ga0500646_0081719
884 Ga0500568_0253839
885 Ga0500577_0337856
886 Ga0501084_0091446
887 Ga0501082_0000040
888 Ga0466962_0002805
889 Ga0466962_0064585
890 Ga0530510_0154184
891 2548499522
892 2550692471
893 2599445035
894 2644061968
895 2644648187
896 2739245037
897 2816474604
898 2819592186
899 2821446168
900 2884816108
901 2884840392
902 2884855648
903 2885270486
904 2896157426
905 2900580608
906 2928060191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14552

Tautomerase_2

Tautomerase enzyme

59

140

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lho-assembly1.cif.gz_A crystal structure of fg41malonate semialdehyde decarboxylase inhibited by 3-bromopropiolate 0.9394 3 128
2aaj-assembly1.cif.gz_A crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities 0.9389 3 128
2aag-assembly1.cif.gz_C crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities 0.938 3 128
4lkb-assembly1.cif.gz_B crystal structure of a putative 4-oxalocrotonate tautomerase from nostoc sp. pcc 7120 0.9288 1 118
7tvk-assembly1.cif.gz_C structural, kinetic, and mechanistic analysis of the wild-type and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities 0.9286 3 118
ID Description Score Start End Superfamily
2aagB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9383 3 128 3.30.429.10
3mjzB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.938 3 128 3.30.429.10
4lkbC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9237 1 118 3.30.429.10
3mjzB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8968 3 128 3.30.429.10
3n4hA00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8924 4 118 3.30.429.10
ID Description Score Start End GO Terms
AF-A0A2Z6TJ72-F1-model_v4 deleted 0.9988 8 126
AF-A0A105YW39-F1-model_v4 deleted 0.9982 1 126
AF-A0A238H2A9-F1-model_v4 4-oxalocrotonate tautomerase 0.9963 1 125
AF-A0A0B1YDD4-F1-model_v4 4-oxalocrotonate tautomerase 0.996 1 125
AF-A0A4R8KFJ4-F1-model_v4 deleted 0.9959 1 126

Map