F447124

General Info

Members Datasets Scaffolds Average Seq Length
453 248 906 385

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10141857|Ga0070666_101418571
Length 468
Sequence VQGSFATGDVGGEIISARSLALTRRCRVRLSPRERIEVRAAGAKRTRILRGATRRFEVKDFAKQMAAMPRHVSIASRPSDSMFLTHLSCTSCGLHHDWTKLQNLCTACRKPLLAVYDLERAGRALRHEELSTRAEKSLWRYRELLPVPIETAPVSLGEGGTPLLRAGTFGASLQMQDLRVKDESQNPTQSFKARGMSVAVSMAKHLGASKLVAPSAGNAASALAAYAARAGLEAHVFMPRDTPRANIIECRELGARVTLIDGLITDCAAEIGRRKENWFDVSTLKEPYRIEGKKTLGYELAEQLNWDLPDVIIYPTGGGTGLIGMWKAFDEMEKLGWIGQKRPRMFSVQAEGCAPIVRAFEAGENSAAEFPNAHTLAAGLRVPKAIGDFLILNILRQSNGGAIAVNDAEMIRVAAEVASSEGLFVAPEGAACFAALKSLLSSGKISPDQSVVIFNTGSGIKYLDCYDS

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.64
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 11.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10141857 3300005335 Unclassified 1673
2 JGI24035J26624_1001027 3300002126 Bacteria 2646
3 JGI25406J46586_10016691 3300003203 Bacteria 3055
4 Ga0065704_10015009 3300005289 Bacteria 1893
5 Ga0065704_10138970 3300005289 Unclassified 1538
6 Ga0065712_10000560 3300005290 Bacteria 12859
7 Ga0065712_10119512 3300005290 Bacteria 1691
8 Ga0065715_10107293 3300005293 Unclassified 2773
9 Ga0070683_100007167 3300005329 Bacteria 9403
10 Ga0070690_100023302 3300005330 Bacteria 3796
11 Ga0070690_100073362 3300005330 Unclassified 2227
12 Ga0068869_100003799 3300005334 Bacteria 9306
13 Ga0070666_10009157 3300005335 Bacteria 6172
14 Ga0070666_10106186 3300005335 Bacteria 1940
15 Ga0070666_10109186 3300005335 Bacteria 1912
16 Ga0070680_100145318 3300005336 Bacteria 1989
17 Ga0070682_100058211 3300005337 Bacteria 2437
18 Ga0068868_100024770 3300005338 Unclassified 4555
19 Ga0068868_100128648 3300005338 Bacteria 2071
20 Ga0070660_100012244 3300005339 Bacteria 6122
21 Ga0070660_100034544 3300005339 Bacteria 3821
22 Ga0070660_100130489 3300005339 Bacteria 2011
23 Ga0070689_100026976 3300005340 Bacteria 4328
24 Ga0070687_100038647 3300005343 Unclassified 2393
25 Ga0070687_100040639 3300005343 Unclassified 2345
26 Ga0070687_100140018 3300005343 Bacteria 1408
27 Ga0070668_100065410 3300005347 Unclassified 2820
28 Ga0070668_100068527 3300005347 Unclassified 2758
29 Ga0070675_100000055 3300005354 Bacteria 68147
30 Ga0070675_100019544 3300005354 Bacteria 5400
31 Ga0070675_100023517 3300005354 Unclassified 4929
32 Ga0070675_100050869 3300005354 Bacteria 3403
33 Ga0070675_100079689 3300005354 Unclassified 2729
34 Ga0070671_100180463 3300005355 Bacteria 1787
35 Ga0070671_100256481 3300005355 Bacteria 1486
36 Ga0070673_100021665 3300005364 Bacteria 4665
37 Ga0070673_100047388 3300005364 Unclassified 3344
38 Ga0070688_100004871 3300005365 Bacteria 7022
39 Ga0070659_100015139 3300005366 Bacteria 5769
40 Ga0070703_10006804 3300005406 Bacteria 3210
41 Ga0070714_100069429 3300005435 Unclassified 3043
42 Ga0070701_10039973 3300005438 Bacteria 2382
43 Ga0070711_100082656 3300005439 Bacteria 2292
44 Ga0070711_100108719 3300005439 Unclassified 2032
45 Ga0070705_100045752 3300005440 Bacteria 2520
46 Ga0070700_100003649 3300005441 Bacteria 7956
47 Ga0070700_100026879 3300005441 Bacteria 3405
48 Ga0070694_100038539 3300005444 Bacteria 3177
49 Ga0070708_100007375 3300005445 Bacteria 8799
50 Ga0070708_100148128 3300005445 Bacteria 2181
51 Ga0070708_100221882 3300005445 Bacteria 1773
52 Ga0070663_100019678 3300005455 Bacteria 4456
53 Ga0070662_100018367 3300005457 Unclassified 4729
54 Ga0070681_10022019 3300005458 Bacteria 6395
55 Ga0070681_10106697 3300005458 Bacteria 2742
56 Ga0068867_100201175 3300005459 Bacteria 1595
57 Ga0070685_10024160 3300005466 Bacteria 3336
58 Ga0070706_100000385 3300005467 Bacteria 52907
59 Ga0070706_100007097 3300005467 Bacteria 10544
60 Ga0070706_100013047 3300005467 Bacteria 7690
61 Ga0070706_100032075 3300005467 Bacteria 4845
62 Ga0070707_100022384 3300005468 Bacteria 5975
63 Ga0070707_100048099 3300005468 Bacteria 4085
64 Ga0070707_100093154 3300005468 Bacteria 2917
65 Ga0070707_100096445 3300005468 Bacteria 2864
66 Ga0070698_100003008 3300005471 Bacteria 18566
67 Ga0070698_100003707 3300005471 Bacteria 16768
68 Ga0070698_100008610 3300005471 Bacteria 10996
69 Ga0070699_100011351 3300005518 Bacteria 7691
70 Ga0070697_100029490 3300005536 Bacteria 4399
71 Ga0070697_100117634 3300005536 Bacteria 2220
72 Ga0070697_100121507 3300005536 Bacteria 2185
73 Ga0068853_100001701 3300005539 Bacteria 16118
74 Ga0068853_100179561 3300005539 Bacteria 1919
75 Ga0070672_100025083 3300005543 Unclassified 4417
76 Ga0070672_100254273 3300005543 Bacteria 1480
77 Ga0070695_100010718 3300005545 Bacteria 5477
78 Ga0070696_100000678 3300005546 Bacteria 21810
79 Ga0070696_100103050 3300005546 Bacteria 2047
80 Ga0070665_100007412 3300005548 Bacteria 11160
81 Ga0070665_100009152 3300005548 Bacteria 10029
82 Ga0070665_100022983 3300005548 Bacteria 6278
83 Ga0070665_100028494 3300005548 Bacteria 5624
84 Ga0070704_100005200 3300005549 Bacteria 7569
85 Ga0070704_100119554 3300005549 Bacteria 2021
86 Ga0068855_100011002 3300005563 Bacteria 10919
87 Ga0068855_100074489 3300005563 Bacteria 3942
88 Ga0068857_100018767 3300005577 Bacteria 6067
89 Ga0068854_100029903 3300005578 Bacteria 3775
90 Ga0070702_100002977 3300005615 Bacteria 7485
91 Ga0068852_100324668 3300005616 Unclassified 1496
92 Ga0068859_100004354 3300005617 Bacteria 14448
93 Ga0068859_100089850 3300005617 Bacteria 3122
94 Ga0068859_100091550 3300005617 Bacteria 3092
95 Ga0068859_100279188 3300005617 Bacteria 1763
96 Ga0068864_100014824 3300005618 Bacteria 6475
97 Ga0068866_10042614 3300005718 Bacteria 2260
98 Ga0068866_10092645 3300005718 Bacteria 1649
99 Ga0068861_100177134 3300005719 Bacteria 1772
100 Ga0068863_100008058 3300005841 Bacteria 10289
101 Ga0068863_100121261 3300005841 Bacteria 2493
102 Ga0068858_100072447 3300005842 Bacteria 3196
103 Ga0068858_100091585 3300005842 Bacteria 2830
104 Ga0068860_100014380 3300005843 Bacteria 7756
105 Ga0068860_100044707 3300005843 Unclassified 4221
106 Ga0081455_10001685 3300005937 Bacteria 26794
107 Ga0081455_10010335 3300005937 Bacteria 9484
108 Ga0081540_1000020 3300005983 Bacteria 163043
109 Ga0081540_1021969 3300005983 Unclassified 3778
110 Ga0081539_10000998 3300005985 Bacteria 52505
111 Ga0081539_10009375 3300005985 Bacteria 8199
112 Ga0081539_10021462 3300005985 Bacteria 4313
113 Ga0070717_10082047 3300006028 Unclassified 2708
114 Ga0070717_10188845 3300006028 Bacteria 1799
115 Ga0070715_10020412 3300006163 Bacteria 2555
116 Ga0070715_10067461 3300006163 Unclassified 1588
117 Ga0070716_100076942 3300006173 Unclassified 1979
118 Ga0097621_100004862 3300006237 Bacteria 9415
119 Ga0068871_100015954 3300006358 Bacteria 5643
120 Ga0068871_100027029 3300006358 Bacteria 4484
121 Ga0075428_100001974 3300006844 Bacteria 22089
122 Ga0075431_100015287 3300006847 Bacteria 7778
123 Ga0075431_100041904 3300006847 Bacteria 4721
124 Ga0075433_10010491 3300006852 Bacteria 7437
125 Ga0075434_100000260 3300006871 Bacteria 37408
126 Ga0075434_100049926 3300006871 Bacteria 4155
127 Ga0075434_100115642 3300006871 Bacteria 2695
128 Ga0075434_100119221 3300006871 Bacteria 2653
129 Ga0075434_100131724 3300006871 Bacteria 2520
130 Ga0068865_100032362 3300006881 Bacteria 3492
131 Ga0068865_100144236 3300006881 Bacteria 1799
132 Ga0097620_100004354 3300006931 Bacteria 14448
133 Ga0097620_100089839 3300006931 Bacteria 3122
134 Ga0097620_100091552 3300006931 Bacteria 3092
135 Ga0097620_100279183 3300006931 Bacteria 1763
136 Ga0075435_100000064 3300007076 Bacteria 54706
137 Ga0075435_100001486 3300007076 Bacteria 15064
138 Ga0099795_10019824 3300007788 Bacteria 2182
139 Ga0105250_10054894 3300009092 Bacteria 1599
140 Ga0105240_10043908 3300009093 Bacteria 5684
141 Ga0105240_10090533 3300009093 Bacteria 3739
142 Ga0111539_10002962 3300009094 Bacteria 22512
143 Ga0111539_10255482 3300009094 Bacteria 2041
144 Ga0105245_10057739 3300009098 Bacteria 3492
145 Ga0105245_10129527 3300009098 Bacteria 2366
146 Ga0105245_10273518 3300009098 Unclassified 1648
147 Ga0114129_10028743 3300009147 Bacteria 7877
148 Ga0114129_10032021 3300009147 Bacteria 7433
149 Ga0114129_10087717 3300009147 Bacteria 4314
150 Ga0105243_10016344 3300009148 Bacteria 5614
151 Ga0105243_10096969 3300009148 Unclassified 2440
152 Ga0105241_10228093 3300009174 Bacteria 1569
153 Ga0105242_10001351 3300009176 Bacteria 19349
154 Ga0105242_10004733 3300009176 Bacteria 10540
155 Ga0105242_10046270 3300009176 Bacteria 3530
156 Ga0105242_10242722 3300009176 Bacteria 1620
157 Ga0105248_10050235 3300009177 Bacteria 4676
158 Ga0105237_10000059 3300009545 Bacteria 146569
159 Ga0105237_10154385 3300009545 Bacteria 2292
160 Ga0105238_10019563 3300009551 Bacteria 6895
161 Ga0105238_10044669 3300009551 Bacteria 4479
162 Ga0105249_10000003 3300009553 Bacteria 370855
163 Ga0105249_10003176 3300009553 Bacteria 14209
164 Ga0105249_10068453 3300009553 Bacteria 3274
165 Ga0105249_10091916 3300009553 Unclassified 2840
166 Ga0105249_10113504 3300009553 Bacteria 2564
167 Ga0157373_10003516 3300013100 Bacteria 11845
168 Ga0157369_10215702 3300013105 Bacteria 2010
169 Ga0157374_10032283 3300013296 Bacteria 4766
170 Ga0157374_10077227 3300013296 Bacteria 3151
171 Ga0157374_10092232 3300013296 Bacteria 2890
172 Ga0157378_10039669 3300013297 Unclassified 4177
173 Ga0157378_10079596 3300013297 Bacteria 2959
174 Ga0157378_10224371 3300013297 Bacteria 1787
175 Ga0163162_10000020 3300013306 Bacteria 220558
176 Ga0163162_10006602 3300013306 Bacteria 11236
177 Ga0163162_10026298 3300013306 Bacteria 5751
178 Ga0163162_10061586 3300013306 Bacteria 3790
179 Ga0163162_10125807 3300013306 Unclassified 2669
180 Ga0163162_10184335 3300013306 Bacteria 2214
181 Ga0163162_10326698 3300013306 Unclassified 1666
182 Ga0163162_10383042 3300013306 Bacteria 1540
183 Ga0163162_10383888 3300013306 Bacteria 1538
184 Ga0157372_10031585 3300013307 Bacteria 5798
185 Ga0157372_10114845 3300013307 Unclassified 3087
186 Ga0157375_10016088 3300013308 Bacteria 6710
187 Ga0157375_10069974 3300013308 Bacteria 3517
188 Ga0157375_10115650 3300013308 Unclassified 2785
189 Ga0163163_10006749 3300014325 Bacteria 10061
190 Ga0163163_10068066 3300014325 Bacteria 3542
191 Ga0163163_10142721 3300014325 Bacteria 2437
192 Ga0157380_10007556 3300014326 Bacteria 7721
193 Ga0157380_10056779 3300014326 Unclassified 3115
194 Ga0157377_10009046 3300014745 Bacteria 4879
195 Ga0157379_10008011 3300014968 Bacteria 9166
196 Ga0157376_10021091 3300014969 Bacteria 5056
197 Ga0213876_10098312 3300021384 Unclassified 1551
198 Ga0207697_10001283 3300025315 Bacteria 13782
199 Ga0207697_10002124 3300025315 Bacteria 10399
200 Ga0207697_10002829 3300025315 Bacteria 8828
201 Ga0207697_10002957 3300025315 Bacteria 8578
202 Ga0207697_10004083 3300025315 Bacteria 7060
203 Ga0207653_10007927 3300025885 Bacteria 3310
204 Ga0207692_10081849 3300025898 Bacteria 1728
205 Ga0207642_10027711 3300025899 Bacteria 2322
206 Ga0207688_10010687 3300025901 Bacteria 4996
207 Ga0207688_10030184 3300025901 Bacteria 2989
208 Ga0207680_10014285 3300025903 Bacteria 4104
209 Ga0207647_10015283 3300025904 Bacteria 5268
210 Ga0207685_10034418 3300025905 Unclassified 1840
211 Ga0207685_10057930 3300025905 Unclassified 1522
212 Ga0207645_10000666 3300025907 Bacteria 28512
213 Ga0207645_10008517 3300025907 Bacteria 7149
214 Ga0207645_10060326 3300025907 Bacteria 2422
215 Ga0207645_10117166 3300025907 Bacteria 1727
216 Ga0207684_10010488 3300025910 Bacteria 8154
217 Ga0207684_10199647 3300025910 Bacteria 1725
218 Ga0207707_10063397 3300025912 Bacteria 3217
219 Ga0207707_10086157 3300025912 Bacteria 2745
220 Ga0207695_10033247 3300025913 Bacteria 5629
221 Ga0207671_10003293 3300025914 Bacteria 16246
222 Ga0207671_10163406 3300025914 Bacteria 1725
223 Ga0207693_10075053 3300025915 Bacteria 2648
224 Ga0207693_10107621 3300025915 Bacteria 2187
225 Ga0207693_10159714 3300025915 Bacteria 1773
226 Ga0207663_10059272 3300025916 Bacteria 2421
227 Ga0207662_10000497 3300025918 Bacteria 17604
228 Ga0207662_10035326 3300025918 Bacteria 2919
229 Ga0207657_10024028 3300025919 Bacteria 5659
230 Ga0207657_10071791 3300025919 Bacteria 2930
231 Ga0207646_10000363 3300025922 Bacteria 61054
232 Ga0207646_10042536 3300025922 Bacteria 4081
233 Ga0207646_10044740 3300025922 Unclassified 3973
234 Ga0207646_10143705 3300025922 Bacteria 2149
235 Ga0207646_10168297 3300025922 Unclassified 1979
236 Ga0207681_10001007 3300025923 Bacteria 18378
237 Ga0207650_10069602 3300025925 Bacteria 2644
238 Ga0207659_10001218 3300025926 Bacteria 15394
239 Ga0207659_10013188 3300025926 Bacteria 5287
240 Ga0207659_10014932 3300025926 Bacteria 5021
241 Ga0207687_10168700 3300025927 Bacteria 1686
242 Ga0207700_10000553 3300025928 Bacteria 21988
243 Ga0207664_10066483 3300025929 Unclassified 2890
244 Ga0207644_10023930 3300025931 Bacteria 4189
245 Ga0207644_10040027 3300025931 Bacteria 3311
246 Ga0207690_10009358 3300025932 Bacteria 5818
247 Ga0207706_10013350 3300025933 Bacteria 7472
248 Ga0207686_10009346 3300025934 Bacteria 5317
249 Ga0207686_10232443 3300025934 Bacteria 1337
250 Ga0207709_10002384 3300025935 Bacteria 11844
251 Ga0207709_10050643 3300025935 Bacteria 2541
252 Ga0207670_10007600 3300025936 Bacteria 6061
253 Ga0207670_10057012 3300025936 Unclassified 2647
254 Ga0207669_10250856 3300025937 Bacteria 1318
255 Ga0207704_10061147 3300025938 Bacteria 2335
256 Ga0207704_10194857 3300025938 Bacteria 1477
257 Ga0207665_10012342 3300025939 Bacteria 5612
258 Ga0207665_10101115 3300025939 Bacteria 2013
259 Ga0207691_10015150 3300025940 Bacteria 7336
260 Ga0207691_10057995 3300025940 Bacteria 3522
261 Ga0207689_10011916 3300025942 Bacteria 7450
262 Ga0207661_10068216 3300025944 Bacteria 2895
263 Ga0207679_10218829 3300025945 Bacteria 1601
264 Ga0207667_10060191 3300025949 Bacteria 3975
265 Ga0207667_10158124 3300025949 Bacteria 2332
266 Ga0207651_10019434 3300025960 Bacteria 4071
267 Ga0207651_10066246 3300025960 Bacteria 2537
268 Ga0207712_10000096 3300025961 Bacteria 102247
269 Ga0207712_10005716 3300025961 Bacteria 7838
270 Ga0207668_10018086 3300025972 Bacteria 4428
271 Ga0207668_10018335 3300025972 Bacteria 4402
272 Ga0207668_10134104 3300025972 Bacteria 1895
273 Ga0207658_10021818 3300025986 Bacteria 4451
274 Ga0207658_10026079 3300025986 Bacteria 4095
275 Ga0207658_10044176 3300025986 Unclassified 3243
276 Ga0207658_10179586 3300025986 Bacteria 1751
277 Ga0207677_10045513 3300026023 Unclassified 2931
278 Ga0207677_10055757 3300026023 Unclassified 2704
279 Ga0207677_10092868 3300026023 Bacteria 2198
280 Ga0207703_10008636 3300026035 Bacteria 8038
281 Ga0207703_10039756 3300026035 Bacteria 3760
282 Ga0207639_10005948 3300026041 Bacteria 8274
283 Ga0207708_10008363 3300026075 Bacteria 7660
284 Ga0207708_10032701 3300026075 Bacteria 3949
285 Ga0207641_10014125 3300026088 Bacteria 6544
286 Ga0207641_10050682 3300026088 Bacteria 3513
287 Ga0207641_10108259 3300026088 Bacteria 2460
288 Ga0207648_10037115 3300026089 Bacteria 4292
289 Ga0207648_10152841 3300026089 Bacteria 2037
290 Ga0207674_10209417 3300026116 Unclassified 1899
291 Ga0207683_10043538 3300026121 Unclassified 3923
292 Ga0268266_10014266 3300028379 Bacteria 6834
293 Ga0268266_10015911 3300028379 Bacteria 6437
294 Ga0268266_10036010 3300028379 Bacteria 4210
295 Ga0268264_10023684 3300028381 Bacteria 5006
296 Ga0268264_10096924 3300028381 Unclassified 2556
297 Ga0265338_10000523 3300028800 Bacteria 67683
298 Ga0265327_10018230 3300031251 Bacteria 4362
299 Ga0307513_10196471 3300031456 Bacteria 1863
300 Ga0307405_10017015 3300031731 Bacteria 3981
301 Ga0307405_10046616 3300031731 Bacteria 2664
302 Ga0307413_10010115 3300031824 Bacteria 4555
303 Ga0307413_10068391 3300031824 Bacteria 2224
304 Ga0307410_10004058 3300031852 Bacteria 7486
305 Ga0307412_10008019 3300031911 Bacteria 6022
306 Ga0307412_10038547 3300031911 Bacteria 3078
307 Ga0307409_100047575 3300031995 Bacteria 3257
308 Ga0307409_100289435 3300031995 Bacteria 1518
309 Ga0307416_100031529 3300032002 Bacteria 3991
310 Ga0307416_100077310 3300032002 Bacteria 2795
311 Ga0307411_10005826 3300032005 Bacteria 6105
312 Ga0307411_10016038 3300032005 Bacteria 4230
313 Ga0307411_10032269 3300032005 Bacteria 3234
314 Ga0307411_10090152 3300032005 Bacteria 2138
315 Ga0307415_100121628 3300032126 Bacteria 1958
316 Ga0373958_0014130 3300034819 Bacteria 1392
317 Ga0373928_0001191 3300035084 Bacteria 5133
318 Ga0373929_0000268 3300035085 Bacteria 9647
319 Ga0373951_0001312 3300035091 Bacteria 6564
320 Ga0373951_0007517 3300035091 Bacteria 2473
321 Ga0373932_0001811 3300035112 Bacteria 5750
322 Ga0373939_0000488 3300035114 Bacteria 10011
323 Ga0373941_0009542 3300035115 Bacteria 2448
324 Ga0373954_0102659 3300035118 Bacteria 1381
325 Ga0373956_0009887 3300035119 Bacteria 3888
326 Ga0373957_0007526 3300035120 Bacteria 3486
327 Ga0373960_0000652 3300035121 Bacteria 7134
328 Ga0373943_0083347 3300035170 Bacteria 1643
329 Ga0373946_0079638 3300035171 Bacteria 1432
330 Ga0373946_0086480 3300035171 Bacteria 1382
331 Ga0373955_0003983 3300035172 Bacteria 6520
332 Ga0373942_0000122 3300035207 Bacteria 18181
333 Ga0373961_0001097 3300035241 Bacteria 8607
334 Ga0373962_0000586 3300035242 Bacteria 8220
335 Ga0373931_0000769 3300035691 Bacteria 13414
336 Ga0373935_0002318 3300035692 Bacteria 10867
337 Ga0373935_0016157 3300035692 Bacteria 4518
338 Ga0373935_0109925 3300035692 Bacteria 1828
339 Ga0373933_0010133 3300035724 Bacteria 5160
340 Ga0373947_0022622 3300035725 Bacteria 3647
341 Ga0373937_0002505 3300036401 Bacteria 15255
342 Ga0373937_0027692 3300036401 Bacteria 5128
343 Ga0373937_0253825 3300036401 Bacteria 1658
344 Ga0373925_0117718 3300037068 Unclassified 2059
345 Ga0395900_0002374 3300037418 Bacteria 20811
346 Ga0395900_0328784 3300037418 Unclassified 1507
347 Ga0395898_0003582 3300037466 Bacteria 17316
348 Ga0395905_0022319 3300037471 Bacteria 5987
349 Ga0395901_0004495 3300038443 Bacteria 14063
350 Ga0242420_014445 3300038996 Bacteria 1355
351 Ga0436365_1242861 3300039437 Bacteria 2016
352 Ga0436365_1900329 3300039437 Bacteria 2960
353 Ga0453683_0016217 3300044673 Bacteria 4813
354 Ga0453684_0093486 3300044712 Unclassified 3704
355 Ga0453684_0104841 3300044712 Bacteria 3450
356 Ga0451576_0011014 3300045051 Bacteria 10326
357 Ga0451576_0079987 3300045051 Bacteria 3401
358 Ga0451576_0447202 3300045051 Unclassified 1356
359 Ga0495651_0013301 3300046462 Bacteria 6365
360 Ga0495653_0060858 3300046463 Bacteria 2859
361 Ga0495653_0172414 3300046463 Bacteria 1492
362 Ga0495639_0063707 3300046475 Bacteria 1693
363 Ga0495662_0143687 3300046476 Bacteria 1175
364 Ga0495618_0038492 3300046514 Bacteria 3006
365 Ga0495628_0296465 3300046516 Bacteria 1198
366 Ga0495630_0011988 3300046517 Bacteria 6285
367 Ga0495652_0022389 3300046529 Bacteria 5606
368 Ga0495587_0073919 3300046536 Bacteria 1980
369 Ga0495645_0002003 3300046543 Bacteria 13863
370 Ga0495645_0050878 3300046543 Bacteria 3015
371 Ga0495635_0140470 3300046663 Bacteria 1645
372 Ga0495669_0115680 3300046684 Bacteria 1255
373 Ga0495600_0085716 3300046809 Bacteria 2055
374 Ga0495581_0054432 3300047315 Bacteria 2310
375 Ga0495672_0039674 3300047320 Bacteria 2862
376 Ga0495680_0029456 3300047322 Bacteria 4496
377 Ga0495684_0007584 3300047471 Bacteria 8396
378 Ga0495684_0008965 3300047471 Bacteria 7724
379 Ga0496102_0024133 3300048905 Bacteria 5405
380 Ga0496102_0145610 3300048905 Unclassified 2223
381 Ga0496106_0045713 3300048909 Unclassified 3289
382 Ga0496106_0111852 3300048909 Unclassified 2127
383 Ga0496108_0004565 3300048911 Bacteria 11156
384 Ga0496108_0089934 3300048911 Bacteria 2610
385 Ga0496108_0092060 3300048911 Bacteria 2578
386 Ga0496108_0163912 3300048911 Bacteria 1922
387 Ga0496109_0001915 3300048912 Bacteria 17286
388 Ga0496109_0022056 3300048912 Bacteria 5637
389 Ga0496112_0022194 3300048915 Bacteria 6049
390 Ga0496112_0024237 3300048915 Bacteria 5807
391 Ga0496112_0058699 3300048915 Bacteria 3790
392 Ga0496112_0067435 3300048915 Bacteria 3532
393 Ga0496112_0067768 3300048915 Bacteria 3523
394 Ga0496112_0082677 3300048915 Bacteria 3175
395 Ga0496113_0006960 3300048916 Bacteria 7227
396 Ga0496113_0113813 3300048916 Bacteria 2109
397 Ga0496113_0267847 3300048916 Bacteria 1365
398 Ga0496114_0013985 3300048917 Bacteria 6433
399 Ga0496114_0170209 3300048917 Bacteria 1898
400 Ga0501036_0033400 3300049572 Bacteria 4352
401 Ga0501038_0082348 3300049574 Bacteria 2710
402 Ga0501039_0039939 3300049575 Bacteria 3623
403 Ga0501040_0011037 3300049576 Bacteria 5906
404 Ga0501042_0004856 3300049578 Bacteria 8594
405 Ga0501042_0048830 3300049578 Bacteria 3018
406 Ga0501046_0042396 3300049580 Bacteria 3629
407 Ga0501047_0035333 3300049581 Bacteria 4828
408 Ga0501068_0015437 3300049584 Bacteria 4387
409 Ga0501069_0058264 3300049585 Bacteria 2154
410 Ga0501069_0106792 3300049585 Bacteria 1592
411 Ga0501072_0023704 3300049588 Bacteria 4768
412 Ga0501073_0074311 3300049589 Bacteria 2367
413 Ga0501075_0000528 3300049591 Bacteria 23105
414 Ga0501076_0000391 3300049592 Bacteria 27401
415 Ga0501076_0022419 3300049592 Bacteria 4854
416 Ga0501076_0151173 3300049592 Bacteria 1889
417 Ga0501076_0193743 3300049592 Bacteria 1659
418 Ga0501077_0031505 3300049593 Bacteria 3374
419 Ga0501079_0016221 3300049741 Bacteria 5694
420 Ga0501079_0247248 3300049741 Bacteria 1394
421 Ga0501080_0020165 3300049742 Bacteria 6171
422 Ga0501081_0000897 3300049743 Bacteria 17649
423 Ga0501081_0026241 3300049743 Bacteria 3927
424 Ga0501035_0015105 3300049822 Bacteria 7125
425 Ga0501045_0023713 3300049824 Bacteria 4401
426 nmdc:mga05p37_104502_c1 3300050507 Bacteria 3485
427 nmdc:mga05p37_18492_c1 3300050507 Bacteria 8419
428 nmdc:mga05p37_56816_c1 3300050507 Bacteria 4819
429 nmdc:mga06r32_107455_c1 3300050510 Bacteria 2742
430 nmdc:mga06r32_11471_c1 3300050510 Bacteria 7981
431 nmdc:mga08y16_284479_c1 3300050511 Bacteria 1705
432 nmdc:mga08y16_559_c1 3300050511 Bacteria 34447
433 nmdc:mga0n895_130_c1 3300050512 Bacteria 44769
434 nmdc:mga0n895_16380_c1 3300050512 Bacteria 6799
435 nmdc:mga0n895_176309_c1 3300050512 Bacteria 2168
436 nmdc:mga0n895_318789_c1 3300050512 Bacteria 1575
437 nmdc:mga0n895_54417_c1 3300050512 Bacteria 3936
438 nmdc:mga0rr50_5415_c1 3300050513 Bacteria 7609
439 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
440 nmdc:mga0rr50_8176_c1 3300050513 Bacteria 6496
441 nmdc:mga08x19_17692_c1 3300050514 Bacteria 4365
442 nmdc:mga08x19_270_c1 3300050514 Bacteria 39380
443 nmdc:mga08x19_7693_c1 3300050514 Bacteria 6397
444 nmdc:mga0a205_126305_c1 3300050515 Bacteria 2458
445 nmdc:mga0a205_26312_c1 3300050515 Bacteria 5547
446 nmdc:mga0a205_348334_c1 3300050515 Bacteria 1349
447 Ga0495601_0077508 3300053077 Bacteria 2129
448 Ga0495619_0069919 3300053085 Bacteria 2347
449 Ga0495619_0123188 3300053085 Bacteria 1778
450 Ga0501084_0013275 3300054114 Bacteria 6816
451 Ga0501082_0194439 3300060353 Bacteria 1764
452 Ga0501082_0319764 3300060353 Bacteria 1352
453 Ga0530510_0049753 3300061734 Bacteria 3027
454 Ga0070666_10141857
455 JGI24035J26624_1001027
456 JGI25406J46586_10016691
457 Ga0065704_10015009
458 Ga0065704_10138970
459 Ga0065712_10000560
460 Ga0065712_10119512
461 Ga0065715_10107293
462 Ga0070683_100007167
463 Ga0070690_100023302
464 Ga0070690_100073362
465 Ga0068869_100003799
466 Ga0070666_10009157
467 Ga0070666_10106186
468 Ga0070666_10109186
469 Ga0070680_100145318
470 Ga0070682_100058211
471 Ga0068868_100024770
472 Ga0068868_100128648
473 Ga0070660_100012244
474 Ga0070660_100034544
475 Ga0070660_100130489
476 Ga0070689_100026976
477 Ga0070687_100038647
478 Ga0070687_100040639
479 Ga0070687_100140018
480 Ga0070668_100065410
481 Ga0070668_100068527
482 Ga0070675_100000055
483 Ga0070675_100019544
484 Ga0070675_100023517
485 Ga0070675_100050869
486 Ga0070675_100079689
487 Ga0070671_100180463
488 Ga0070671_100256481
489 Ga0070673_100021665
490 Ga0070673_100047388
491 Ga0070688_100004871
492 Ga0070659_100015139
493 Ga0070703_10006804
494 Ga0070714_100069429
495 Ga0070701_10039973
496 Ga0070711_100082656
497 Ga0070711_100108719
498 Ga0070705_100045752
499 Ga0070700_100003649
500 Ga0070700_100026879
501 Ga0070694_100038539
502 Ga0070708_100007375
503 Ga0070708_100148128
504 Ga0070708_100221882
505 Ga0070663_100019678
506 Ga0070662_100018367
507 Ga0070681_10022019
508 Ga0070681_10106697
509 Ga0068867_100201175
510 Ga0070685_10024160
511 Ga0070706_100000385
512 Ga0070706_100007097
513 Ga0070706_100013047
514 Ga0070706_100032075
515 Ga0070707_100022384
516 Ga0070707_100048099
517 Ga0070707_100093154
518 Ga0070707_100096445
519 Ga0070698_100003008
520 Ga0070698_100003707
521 Ga0070698_100008610
522 Ga0070699_100011351
523 Ga0070697_100029490
524 Ga0070697_100117634
525 Ga0070697_100121507
526 Ga0068853_100001701
527 Ga0068853_100179561
528 Ga0070672_100025083
529 Ga0070672_100254273
530 Ga0070695_100010718
531 Ga0070696_100000678
532 Ga0070696_100103050
533 Ga0070665_100007412
534 Ga0070665_100009152
535 Ga0070665_100022983
536 Ga0070665_100028494
537 Ga0070704_100005200
538 Ga0070704_100119554
539 Ga0068855_100011002
540 Ga0068855_100074489
541 Ga0068857_100018767
542 Ga0068854_100029903
543 Ga0070702_100002977
544 Ga0068852_100324668
545 Ga0068859_100004354
546 Ga0068859_100089850
547 Ga0068859_100091550
548 Ga0068859_100279188
549 Ga0068864_100014824
550 Ga0068866_10042614
551 Ga0068866_10092645
552 Ga0068861_100177134
553 Ga0068863_100008058
554 Ga0068863_100121261
555 Ga0068858_100072447
556 Ga0068858_100091585
557 Ga0068860_100014380
558 Ga0068860_100044707
559 Ga0081455_10001685
560 Ga0081455_10010335
561 Ga0081540_1000020
562 Ga0081540_1021969
563 Ga0081539_10000998
564 Ga0081539_10009375
565 Ga0081539_10021462
566 Ga0070717_10082047
567 Ga0070717_10188845
568 Ga0070715_10020412
569 Ga0070715_10067461
570 Ga0070716_100076942
571 Ga0097621_100004862
572 Ga0068871_100015954
573 Ga0068871_100027029
574 Ga0075428_100001974
575 Ga0075431_100015287
576 Ga0075431_100041904
577 Ga0075433_10010491
578 Ga0075434_100000260
579 Ga0075434_100049926
580 Ga0075434_100115642
581 Ga0075434_100119221
582 Ga0075434_100131724
583 Ga0068865_100032362
584 Ga0068865_100144236
585 Ga0097620_100004354
586 Ga0097620_100089839
587 Ga0097620_100091552
588 Ga0097620_100279183
589 Ga0075435_100000064
590 Ga0075435_100001486
591 Ga0099795_10019824
592 Ga0105250_10054894
593 Ga0105240_10043908
594 Ga0105240_10090533
595 Ga0111539_10002962
596 Ga0111539_10255482
597 Ga0105245_10057739
598 Ga0105245_10129527
599 Ga0105245_10273518
600 Ga0114129_10028743
601 Ga0114129_10032021
602 Ga0114129_10087717
603 Ga0105243_10016344
604 Ga0105243_10096969
605 Ga0105241_10228093
606 Ga0105242_10001351
607 Ga0105242_10004733
608 Ga0105242_10046270
609 Ga0105242_10242722
610 Ga0105248_10050235
611 Ga0105237_10000059
612 Ga0105237_10154385
613 Ga0105238_10019563
614 Ga0105238_10044669
615 Ga0105249_10000003
616 Ga0105249_10003176
617 Ga0105249_10068453
618 Ga0105249_10091916
619 Ga0105249_10113504
620 Ga0157373_10003516
621 Ga0157369_10215702
622 Ga0157374_10032283
623 Ga0157374_10077227
624 Ga0157374_10092232
625 Ga0157378_10039669
626 Ga0157378_10079596
627 Ga0157378_10224371
628 Ga0163162_10000020
629 Ga0163162_10006602
630 Ga0163162_10026298
631 Ga0163162_10061586
632 Ga0163162_10125807
633 Ga0163162_10184335
634 Ga0163162_10326698
635 Ga0163162_10383042
636 Ga0163162_10383888
637 Ga0157372_10031585
638 Ga0157372_10114845
639 Ga0157375_10016088
640 Ga0157375_10069974
641 Ga0157375_10115650
642 Ga0163163_10006749
643 Ga0163163_10068066
644 Ga0163163_10142721
645 Ga0157380_10007556
646 Ga0157380_10056779
647 Ga0157377_10009046
648 Ga0157379_10008011
649 Ga0157376_10021091
650 Ga0213876_10098312
651 Ga0207697_10001283
652 Ga0207697_10002124
653 Ga0207697_10002829
654 Ga0207697_10002957
655 Ga0207697_10004083
656 Ga0207653_10007927
657 Ga0207692_10081849
658 Ga0207642_10027711
659 Ga0207688_10010687
660 Ga0207688_10030184
661 Ga0207680_10014285
662 Ga0207647_10015283
663 Ga0207685_10034418
664 Ga0207685_10057930
665 Ga0207645_10000666
666 Ga0207645_10008517
667 Ga0207645_10060326
668 Ga0207645_10117166
669 Ga0207684_10010488
670 Ga0207684_10199647
671 Ga0207707_10063397
672 Ga0207707_10086157
673 Ga0207695_10033247
674 Ga0207671_10003293
675 Ga0207671_10163406
676 Ga0207693_10075053
677 Ga0207693_10107621
678 Ga0207693_10159714
679 Ga0207663_10059272
680 Ga0207662_10000497
681 Ga0207662_10035326
682 Ga0207657_10024028
683 Ga0207657_10071791
684 Ga0207646_10000363
685 Ga0207646_10042536
686 Ga0207646_10044740
687 Ga0207646_10143705
688 Ga0207646_10168297
689 Ga0207681_10001007
690 Ga0207650_10069602
691 Ga0207659_10001218
692 Ga0207659_10013188
693 Ga0207659_10014932
694 Ga0207687_10168700
695 Ga0207700_10000553
696 Ga0207664_10066483
697 Ga0207644_10023930
698 Ga0207644_10040027
699 Ga0207690_10009358
700 Ga0207706_10013350
701 Ga0207686_10009346
702 Ga0207686_10232443
703 Ga0207709_10002384
704 Ga0207709_10050643
705 Ga0207670_10007600
706 Ga0207670_10057012
707 Ga0207669_10250856
708 Ga0207704_10061147
709 Ga0207704_10194857
710 Ga0207665_10012342
711 Ga0207665_10101115
712 Ga0207691_10015150
713 Ga0207691_10057995
714 Ga0207689_10011916
715 Ga0207661_10068216
716 Ga0207679_10218829
717 Ga0207667_10060191
718 Ga0207667_10158124
719 Ga0207651_10019434
720 Ga0207651_10066246
721 Ga0207712_10000096
722 Ga0207712_10005716
723 Ga0207668_10018086
724 Ga0207668_10018335
725 Ga0207668_10134104
726 Ga0207658_10021818
727 Ga0207658_10026079
728 Ga0207658_10044176
729 Ga0207658_10179586
730 Ga0207677_10045513
731 Ga0207677_10055757
732 Ga0207677_10092868
733 Ga0207703_10008636
734 Ga0207703_10039756
735 Ga0207639_10005948
736 Ga0207708_10008363
737 Ga0207708_10032701
738 Ga0207641_10014125
739 Ga0207641_10050682
740 Ga0207641_10108259
741 Ga0207648_10037115
742 Ga0207648_10152841
743 Ga0207674_10209417
744 Ga0207683_10043538
745 Ga0268266_10014266
746 Ga0268266_10015911
747 Ga0268266_10036010
748 Ga0268264_10023684
749 Ga0268264_10096924
750 Ga0265338_10000523
751 Ga0265327_10018230
752 Ga0307513_10196471
753 Ga0307405_10017015
754 Ga0307405_10046616
755 Ga0307413_10010115
756 Ga0307413_10068391
757 Ga0307410_10004058
758 Ga0307412_10008019
759 Ga0307412_10038547
760 Ga0307409_100047575
761 Ga0307409_100289435
762 Ga0307416_100031529
763 Ga0307416_100077310
764 Ga0307411_10005826
765 Ga0307411_10016038
766 Ga0307411_10032269
767 Ga0307411_10090152
768 Ga0307415_100121628
769 Ga0373958_0014130
770 Ga0373928_0001191
771 Ga0373929_0000268
772 Ga0373951_0001312
773 Ga0373951_0007517
774 Ga0373932_0001811
775 Ga0373939_0000488
776 Ga0373941_0009542
777 Ga0373954_0102659
778 Ga0373956_0009887
779 Ga0373957_0007526
780 Ga0373960_0000652
781 Ga0373943_0083347
782 Ga0373946_0079638
783 Ga0373946_0086480
784 Ga0373955_0003983
785 Ga0373942_0000122
786 Ga0373961_0001097
787 Ga0373962_0000586
788 Ga0373931_0000769
789 Ga0373935_0002318
790 Ga0373935_0016157
791 Ga0373935_0109925
792 Ga0373933_0010133
793 Ga0373947_0022622
794 Ga0373937_0002505
795 Ga0373937_0027692
796 Ga0373937_0253825
797 Ga0373925_0117718
798 Ga0395900_0002374
799 Ga0395900_0328784
800 Ga0395898_0003582
801 Ga0395905_0022319
802 Ga0395901_0004495
803 Ga0242420_014445
804 Ga0436365_1242861
805 Ga0436365_1900329
806 Ga0453683_0016217
807 Ga0453684_0093486
808 Ga0453684_0104841
809 Ga0451576_0011014
810 Ga0451576_0079987
811 Ga0451576_0447202
812 Ga0495651_0013301
813 Ga0495653_0060858
814 Ga0495653_0172414
815 Ga0495639_0063707
816 Ga0495662_0143687
817 Ga0495618_0038492
818 Ga0495628_0296465
819 Ga0495630_0011988
820 Ga0495652_0022389
821 Ga0495587_0073919
822 Ga0495645_0002003
823 Ga0495645_0050878
824 Ga0495635_0140470
825 Ga0495669_0115680
826 Ga0495600_0085716
827 Ga0495581_0054432
828 Ga0495672_0039674
829 Ga0495680_0029456
830 Ga0495684_0007584
831 Ga0495684_0008965
832 Ga0496102_0024133
833 Ga0496102_0145610
834 Ga0496106_0045713
835 Ga0496106_0111852
836 Ga0496108_0004565
837 Ga0496108_0089934
838 Ga0496108_0092060
839 Ga0496108_0163912
840 Ga0496109_0001915
841 Ga0496109_0022056
842 Ga0496112_0022194
843 Ga0496112_0024237
844 Ga0496112_0058699
845 Ga0496112_0067435
846 Ga0496112_0067768
847 Ga0496112_0082677
848 Ga0496113_0006960
849 Ga0496113_0113813
850 Ga0496113_0267847
851 Ga0496114_0013985
852 Ga0496114_0170209
853 Ga0501036_0033400
854 Ga0501038_0082348
855 Ga0501039_0039939
856 Ga0501040_0011037
857 Ga0501042_0004856
858 Ga0501042_0048830
859 Ga0501046_0042396
860 Ga0501047_0035333
861 Ga0501068_0015437
862 Ga0501069_0058264
863 Ga0501069_0106792
864 Ga0501072_0023704
865 Ga0501073_0074311
866 Ga0501075_0000528
867 Ga0501076_0000391
868 Ga0501076_0022419
869 Ga0501076_0151173
870 Ga0501076_0193743
871 Ga0501077_0031505
872 Ga0501079_0016221
873 Ga0501079_0247248
874 Ga0501080_0020165
875 Ga0501081_0000897
876 Ga0501081_0026241
877 Ga0501035_0015105
878 Ga0501045_0023713
879 nmdc:mga05p37_104502_c1
880 nmdc:mga05p37_18492_c1
881 nmdc:mga05p37_56816_c1
882 nmdc:mga06r32_107455_c1
883 nmdc:mga06r32_11471_c1
884 nmdc:mga08y16_284479_c1
885 nmdc:mga08y16_559_c1
886 nmdc:mga0n895_130_c1
887 nmdc:mga0n895_16380_c1
888 nmdc:mga0n895_176309_c1
889 nmdc:mga0n895_318789_c1
890 nmdc:mga0n895_54417_c1
891 nmdc:mga0rr50_5415_c1
892 nmdc:mga0rr50_5_c1
893 nmdc:mga0rr50_8176_c1
894 nmdc:mga08x19_17692_c1
895 nmdc:mga08x19_270_c1
896 nmdc:mga08x19_7693_c1
897 nmdc:mga0a205_126305_c1
898 nmdc:mga0a205_26312_c1
899 nmdc:mga0a205_348334_c1
900 Ga0495601_0077508
901 Ga0495619_0069919
902 Ga0495619_0123188
903 Ga0501084_0013275
904 Ga0501082_0194439
905 Ga0501082_0319764
906 Ga0530510_0049753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

154

457

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cgq-assembly1.cif.gz_B-2 threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9424 53 389
1uin-assembly1.cif.gz_A crystal structure of threonine synthase from thermus thermophilus hb8, trigonal crystal form 0.9224 52 386
2c2b-assembly2.cif.gz_C crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine 0.9199 5 384
3aey-assembly1.cif.gz_B apo form of threonine synthase from thermus thermophilus hb8 0.9176 53 380
1uin-assembly1.cif.gz_B crystal structure of threonine synthase from thermus thermophilus hb8, trigonal crystal form 0.9168 56 380
ID Description Score Start End Superfamily
1pwhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9338 119 202 3.40.50.1100
3x44B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9328 103 199 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9319 111 200 3.40.50.1100
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9277 216 384 3.40.50.1100
3vc3B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.922 103 202 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A520JB37-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9945 217 381
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9919 218 324
AF-A0A2V7C9G3-F1-model_v4 Threonine synthase 0.9904 2 381 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A2V6TKF0-F1-model_v4 Threonine synthase 0.9903 2 381 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A346Y1Y8-F1-model_v4 Threonine synthase 0.9858 3 381 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0030170

Map