F446939

General Info

Members Datasets Scaffolds Average Seq Length
452 194 452 182

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10462783|Ga0068870_104627832
Length 219
Sequence MTKENNKPADILKFLLRIGLHSYEFLKIPQIYIPFVKIYTAMPINSLAVFCGSKNGNNPLFKEHTIQLGKLLAKHSVTLIYGGGNVGIMGHIADTVMEHGGKVTGVIPQVLVAWERQHDGISELFIVDDMHVRKKKMYELCDAAIILPGGFGTLDELFEMVTWNQLSIHDKLIFILNSGGFYEHLIAHINRMQEENFLYEAARKRIVILDSPVELIPHL

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
160 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 1.11
Rhizosphere 96.68
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10035509 3300001991 Bacteria 991
2 rootH2_10009025 3300003320 Bacteria 27408
3 rootL2_10037652 3300003322 Bacteria 5396
4 rootL2_10335767 3300003322 Unclassified 1204
5 Ga0065714_10165733 3300005288 Unclassified 1029
6 Ga0065712_10000371 3300005290 Bacteria 12361
7 Ga0065712_10082089 3300005290 Bacteria 2947
8 Ga0065707_10117438 3300005295 Bacteria 2211
9 Ga0065707_10134359 3300005295 Bacteria 1866
10 Ga0070658_10149613 3300005327 Bacteria 1954
11 Ga0070658_10400305 3300005327 Bacteria 1179
12 Ga0070658_10766135 3300005327 Unclassified 838
13 Ga0070676_10007303 3300005328 Bacteria 5928
14 Ga0070676_10026338 3300005328 Bacteria 3292
15 Ga0070683_100000900 3300005329 Bacteria 22101
16 Ga0070683_100037020 3300005329 Bacteria 4465
17 Ga0070683_100473590 3300005329 Unclassified 1196
18 Ga0070683_100567066 3300005329 Bacteria 1086
19 Ga0070690_100145261 3300005330 Bacteria 1613
20 Ga0070690_100245409 3300005330 Bacteria 1264
21 Ga0070670_100017090 3300005331 Bacteria 6225
22 Ga0070670_100019064 3300005331 Bacteria 5883
23 Ga0070670_100039648 3300005331 Bacteria 4050
24 Ga0070670_100045982 3300005331 Bacteria 3753
25 Ga0070670_100278423 3300005331 Unclassified 1461
26 Ga0070670_100322794 3300005331 Bacteria 1353
27 Ga0070670_100413436 3300005331 Unclassified 1192
28 Ga0070670_101285825 3300005331 Bacteria 669
29 Ga0068869_100008483 3300005334 Bacteria 6629
30 Ga0068869_100044495 3300005334 Bacteria 3193
31 Ga0070666_10025398 3300005335 Unclassified 3862
32 Ga0070666_10047761 3300005335 Bacteria 2874
33 Ga0068868_100002558 3300005338 Bacteria 12641
34 Ga0068868_100082058 3300005338 Bacteria 2585
35 Ga0068868_100122506 3300005338 Unclassified 2122
36 Ga0068868_100123110 3300005338 Bacteria 2116
37 Ga0070689_100013635 3300005340 Bacteria 5887
38 Ga0070689_100191667 3300005340 Bacteria 1665
39 Ga0070687_100056550 3300005343 Bacteria 2053
40 Ga0070661_100019193 3300005344 Bacteria 4869
41 Ga0070661_100687565 3300005344 Bacteria 833
42 Ga0070668_100365593 3300005347 Bacteria 1224
43 Ga0070668_100480250 3300005347 Unclassified 1073
44 Ga0070669_100011634 3300005353 Bacteria 6242
45 Ga0070669_101042945 3300005353 Bacteria 703
46 Ga0070669_101118890 3300005353 Unclassified 679
47 Ga0070675_100001682 3300005354 Bacteria 16324
48 Ga0070675_100010652 3300005354 Bacteria 7188
49 Ga0070675_100622590 3300005354 Bacteria 980
50 Ga0070671_100011941 3300005355 Bacteria 6987
51 Ga0070671_100084360 3300005355 Bacteria 2657
52 Ga0070671_100144312 3300005355 Bacteria 2009
53 Ga0070671_100160542 3300005355 Bacteria 1900
54 Ga0070671_100312683 3300005355 Bacteria 1338
55 Ga0070673_100041603 3300005364 Unclassified 3536
56 Ga0070673_100052875 3300005364 Bacteria 3188
57 Ga0070673_100191507 3300005364 Bacteria 1757
58 Ga0070673_100891211 3300005364 Unclassified 825
59 Ga0070688_100000511 3300005365 Bacteria 19580
60 Ga0070688_100097048 3300005365 Bacteria 1937
61 Ga0070688_100186893 3300005365 Unclassified 1441
62 Ga0070667_100020035 3300005367 Bacteria 5553
63 Ga0070667_100446841 3300005367 Bacteria 1181
64 Ga0070667_100476146 3300005367 Bacteria 1143
65 Ga0070701_10023652 3300005438 Bacteria 2963
66 Ga0070700_100087915 3300005441 Bacteria 2021
67 Ga0070678_100016643 3300005456 Bacteria 4709
68 Ga0070678_100303420 3300005456 Unclassified 1358
69 Ga0070678_101545791 3300005456 Unclassified 622
70 Ga0070662_100002049 3300005457 Bacteria 12347
71 Ga0070662_100012841 3300005457 Bacteria 5564
72 Ga0070662_100031009 3300005457 Bacteria 3748
73 Ga0070662_100056959 3300005457 Unclassified 2838
74 Ga0070662_100166340 3300005457 Bacteria 1728
75 Ga0068867_100042739 3300005459 Bacteria 3317
76 Ga0070685_10053951 3300005466 Bacteria 2331
77 Ga0070685_10140960 3300005466 Bacteria 1517
78 Ga0070685_10230576 3300005466 Unclassified 1218
79 Ga0070698_100002362 3300005471 Bacteria 20822
80 Ga0070684_100003715 3300005535 Bacteria 11518
81 Ga0070684_100017036 3300005535 Bacteria 5955
82 Ga0070684_100050121 3300005535 Bacteria 3626
83 Ga0070684_100342774 3300005535 Bacteria 1374
84 Ga0070684_100384659 3300005535 Unclassified 1293
85 Ga0070684_100603936 3300005535 Bacteria 1020
86 Ga0068853_100054547 3300005539 Bacteria 3445
87 Ga0068853_100070002 3300005539 Bacteria 3053
88 Ga0068853_100186924 3300005539 Unclassified 1881
89 Ga0070672_100147374 3300005543 Bacteria 1945
90 Ga0070672_100398670 3300005543 Bacteria 1179
91 Ga0070672_101066167 3300005543 Bacteria 717
92 Ga0070695_100591501 3300005545 Unclassified 870
93 Ga0070665_100745541 3300005548 Bacteria 992
94 Ga0068855_100000210 3300005563 Bacteria 74786
95 Ga0068855_100224126 3300005563 Unclassified 2107
96 Ga0068855_100783834 3300005563 Bacteria 1014
97 Ga0068855_101227479 3300005563 Bacteria 779
98 Ga0070664_100002699 3300005564 Bacteria 14319
99 Ga0070664_100098050 3300005564 Bacteria 2546
100 Ga0070664_100099292 3300005564 Bacteria 2530
101 Ga0070664_100130052 3300005564 Unclassified 2211
102 Ga0068857_100014888 3300005577 Bacteria 6783
103 Ga0068857_100128712 3300005577 Bacteria 2282
104 Ga0068857_100297880 3300005577 Bacteria 1486
105 Ga0068857_100397451 3300005577 Bacteria 1282
106 Ga0068854_100113380 3300005578 Bacteria 2048
107 Ga0068854_100187133 3300005578 Bacteria 1621
108 Ga0068854_100335890 3300005578 Bacteria 1233
109 Ga0068854_100539261 3300005578 Unclassified 988
110 Ga0068854_100633517 3300005578 Unclassified 916
111 Ga0068856_100021467 3300005614 Bacteria 6276
112 Ga0070702_100175257 3300005615 Bacteria 1398
113 Ga0068852_100000566 3300005616 Bacteria 24414
114 Ga0068852_100018294 3300005616 Bacteria 5519
115 Ga0068852_100135798 3300005616 Bacteria 2271
116 Ga0068852_100168697 3300005616 Bacteria 2050
117 Ga0068852_100175627 3300005616 Bacteria 2011
118 Ga0068852_100426961 3300005616 Unclassified 1308
119 Ga0068852_100625179 3300005616 Bacteria 1083
120 Ga0068852_100787545 3300005616 Bacteria 964
121 Ga0068852_100826591 3300005616 Unclassified 941
122 Ga0068859_100014736 3300005617 Bacteria 7856
123 Ga0068859_100045711 3300005617 Bacteria 4399
124 Ga0068859_100056590 3300005617 Bacteria 3948
125 Ga0068859_100102116 3300005617 Bacteria 2925
126 Ga0068859_100650088 3300005617 Bacteria 1146
127 Ga0068864_100049002 3300005618 Bacteria 3633
128 Ga0068864_100110185 3300005618 Bacteria 2451
129 Ga0068864_100343550 3300005618 Bacteria 1407
130 Ga0068864_101061281 3300005618 Bacteria 805
131 Ga0068866_10015879 3300005718 Bacteria 3354
132 Ga0068866_10237693 3300005718 Unclassified 1108
133 Ga0068866_10630364 3300005718 Unclassified 727
134 Ga0068861_100000923 3300005719 Bacteria 17840
135 Ga0068861_100005218 3300005719 Bacteria 8753
136 Ga0068851_10046605 3300005834 Unclassified 2193
137 Ga0068851_10275958 3300005834 Unclassified 960
138 Ga0068870_10462783 3300005840 Bacteria 838
139 Ga0068863_100254825 3300005841 Bacteria 1696
140 Ga0068858_100071565 3300005842 Bacteria 3217
141 Ga0068860_100093494 3300005843 Bacteria 2866
142 Ga0068860_100149831 3300005843 Bacteria 2246
143 Ga0068860_101513833 3300005843 Bacteria 693
144 Ga0068862_100448491 3300005844 Unclassified 1216
145 Ga0075366_10019321 3300006195 Bacteria 3940
146 Ga0097621_100021773 3300006237 Bacteria 4966
147 Ga0097621_100678475 3300006237 Bacteria 947
148 Ga0068871_100006474 3300006358 Bacteria 8288
149 Ga0068871_100085832 3300006358 Bacteria 2615
150 Ga0068871_100817613 3300006358 Bacteria 860
151 Ga0068871_100854567 3300006358 Unclassified 841
152 Ga0075428_100057632 3300006844 Bacteria 4252
153 Ga0075430_100041630 3300006846 Bacteria 3886
154 Ga0075431_100017437 3300006847 Bacteria 7296
155 Ga0075434_100329378 3300006871 Unclassified 1548
156 Ga0075434_100783308 3300006871 Bacteria 970
157 Ga0075429_100741911 3300006880 Bacteria 860
158 Ga0068865_100203922 3300006881 Bacteria 1537
159 Ga0068865_100281806 3300006881 Bacteria 1323
160 Ga0068865_100493939 3300006881 Bacteria 1019
161 Ga0097620_100014735 3300006931 Bacteria 7856
162 Ga0097620_100045711 3300006931 Bacteria 4399
163 Ga0097620_100056590 3300006931 Bacteria 3948
164 Ga0097620_100102111 3300006931 Bacteria 2925
165 Ga0097620_100245867 3300006931 Bacteria 1879
166 Ga0097620_100650098 3300006931 Bacteria 1146
167 Ga0111539_10002087 3300009094 Bacteria 26711
168 Ga0105247_10083006 3300009101 Bacteria 2023
169 Ga0114129_10511627 3300009147 Bacteria 1566
170 Ga0105243_10456283 3300009148 Bacteria 1200
171 Ga0105241_10103244 3300009174 Bacteria 2270
172 Ga0105241_10196356 3300009174 Bacteria 1683
173 Ga0105241_11041957 3300009174 Bacteria 767
174 Ga0105242_10022981 3300009176 Bacteria 4912
175 Ga0105242_10062643 3300009176 Unclassified 3061
176 Ga0105242_10121377 3300009176 Bacteria 2243
177 Ga0105242_10434183 3300009176 Bacteria 1234
178 Ga0105242_10558318 3300009176 Bacteria 1099
179 Ga0105248_11051983 3300009177 Bacteria 920
180 Ga0105237_10031528 3300009545 Bacteria 5372
181 Ga0105237_10349186 3300009545 Bacteria 1484
182 Ga0105237_10620966 3300009545 Unclassified 1088
183 Ga0105238_10144161 3300009551 Bacteria 2358
184 Ga0105249_10003314 3300009553 Bacteria 13943
185 Ga0105249_10018154 3300009553 Bacteria 6253
186 Ga0105249_10330659 3300009553 Bacteria 1538
187 Ga0105249_11388822 3300009553 Bacteria 774
188 Ga0105239_10207962 3300010375 Bacteria 2193
189 Ga0105246_10098437 3300011119 Bacteria 2125
190 Ga0157373_10142683 3300013100 Bacteria 1685
191 Ga0157373_10249812 3300013100 Bacteria 1254
192 Ga0157371_10004245 3300013102 Bacteria 12598
193 Ga0157371_10041366 3300013102 Bacteria 3289
194 Ga0157371_10298562 3300013102 Bacteria 1166
195 Ga0157370_10008901 3300013104 Bacteria 10786
196 Ga0157370_10096305 3300013104 Bacteria 2777
197 Ga0157369_10032048 3300013105 Bacteria 5782
198 Ga0157369_10071727 3300013105 Bacteria 3717
199 Ga0157369_10414900 3300013105 Unclassified 1396
200 Ga0157374_10021746 3300013296 Bacteria 5713
201 Ga0157374_10030791 3300013296 Bacteria 4874
202 Ga0157374_10031994 3300013296 Bacteria 4786
203 Ga0157374_10075606 3300013296 Unclassified 3182
204 Ga0157374_10123369 3300013296 Bacteria 2502
205 Ga0157374_11241556 3300013296 Unclassified 767
206 Ga0157378_10026651 3300013297 Bacteria 5094
207 Ga0157378_10107725 3300013297 Bacteria 2550
208 Ga0157378_11243885 3300013297 Bacteria 785
209 Ga0163162_10013839 3300013306 Bacteria 7882
210 Ga0163162_10044861 3300013306 Bacteria 4429
211 Ga0163162_10079470 3300013306 Bacteria 3346
212 Ga0163162_10092745 3300013306 Bacteria 3104
213 Ga0163162_10225860 3300013306 Unclassified 2002
214 Ga0157372_10000255 3300013307 Bacteria 58805
215 Ga0157372_10056600 3300013307 Bacteria 4381
216 Ga0157372_10112625 3300013307 Bacteria 3117
217 Ga0157372_10133860 3300013307 Bacteria 2853
218 Ga0157372_10147546 3300013307 Bacteria 2713
219 Ga0157372_10234397 3300013307 Bacteria 2128
220 Ga0157372_10401972 3300013307 Bacteria 1596
221 Ga0157372_10472150 3300013307 Bacteria 1462
222 Ga0157372_10592720 3300013307 Bacteria 1292
223 Ga0157372_10691034 3300013307 Bacteria 1187
224 Ga0157372_11859765 3300013307 Bacteria 692
225 Ga0157375_10002328 3300013308 Bacteria 16414
226 Ga0157375_10085112 3300013308 Unclassified 3212
227 Ga0157375_10101642 3300013308 Bacteria 2958
228 Ga0157375_10230228 3300013308 Bacteria 2012
229 Ga0157375_10699773 3300013308 Bacteria 1167
230 Ga0157375_10777134 3300013308 Bacteria 1108
231 Ga0163163_10019305 3300014325 Bacteria 6400
232 Ga0163163_10032557 3300014325 Bacteria 5035
233 Ga0163163_10184389 3300014325 Unclassified 2134
234 Ga0163163_11956525 3300014325 Bacteria 646
235 Ga0157380_10017444 3300014326 Bacteria 5312
236 Ga0157380_10415744 3300014326 Unclassified 1281
237 Ga0157377_10000562 3300014745 Bacteria 15548
238 Ga0157377_10180869 3300014745 Bacteria 1326
239 Ga0157377_10260571 3300014745 Bacteria 1128
240 Ga0157379_10094317 3300014968 Bacteria 2685
241 Ga0157379_10154185 3300014968 Bacteria 2072
242 Ga0157379_10178515 3300014968 Bacteria 1918
243 Ga0157379_10245713 3300014968 Bacteria 1623
244 Ga0157379_10608059 3300014968 Bacteria 1021
245 Ga0157376_10003040 3300014969 Bacteria 11491
246 Ga0157376_10291046 3300014969 Bacteria 1542
247 Ga0163161_10006316 3300017792 Bacteria 8203
248 Ga0163161_10651826 3300017792 Unclassified 872
249 Ga0207697_10065608 3300025315 Bacteria 1515
250 Ga0207656_10035879 3300025321 Unclassified 2079
251 Ga0207656_10447795 3300025321 Bacteria 652
252 Ga0207642_10014016 3300025899 Bacteria 2944
253 Ga0207642_10056609 3300025899 Bacteria 1799
254 Ga0207688_10032407 3300025901 Bacteria 2888
255 Ga0207680_10067416 3300025903 Unclassified 2204
256 Ga0207680_10295997 3300025903 Unclassified 1127
257 Ga0207680_10733980 3300025903 Bacteria 708
258 Ga0207647_10000403 3300025904 Bacteria 35357
259 Ga0207647_10007311 3300025904 Bacteria 7990
260 Ga0207647_10050808 3300025904 Bacteria 2565
261 Ga0207645_10000935 3300025907 Bacteria 24224
262 Ga0207645_10000985 3300025907 Bacteria 23535
263 Ga0207645_10171403 3300025907 Bacteria 1423
264 Ga0207643_10006500 3300025908 Bacteria 6259
265 Ga0207643_10065777 3300025908 Bacteria 2077
266 Ga0207705_10340247 3300025909 Unclassified 1155
267 Ga0207705_10408361 3300025909 Unclassified 1051
268 Ga0207654_10160448 3300025911 Bacteria 1452
269 Ga0207654_10237252 3300025911 Bacteria 1217
270 Ga0207695_10000568 3300025913 Bacteria 75553
271 Ga0207671_10009981 3300025914 Bacteria 7887
272 Ga0207671_10017295 3300025914 Bacteria 5563
273 Ga0207671_10260271 3300025914 Bacteria 1365
274 Ga0207662_10035921 3300025918 Unclassified 2895
275 Ga0207662_10053613 3300025918 Bacteria 2403
276 Ga0207662_10360110 3300025918 Unclassified 979
277 Ga0207649_10165256 3300025920 Bacteria 1537
278 Ga0207649_10201014 3300025920 Bacteria 1408
279 Ga0207649_10909175 3300025920 Bacteria 690
280 Ga0207652_10257097 3300025921 Bacteria 1575
281 Ga0207681_10011293 3300025923 Bacteria 5487
282 Ga0207681_10038381 3300025923 Bacteria 3173
283 Ga0207681_10235530 3300025923 Bacteria 1423
284 Ga0207681_10892581 3300025923 Bacteria 744
285 Ga0207681_10971234 3300025923 Unclassified 712
286 Ga0207694_10725745 3300025924 Bacteria 838
287 Ga0207650_10007187 3300025925 Bacteria 7588
288 Ga0207650_10056996 3300025925 Bacteria 2905
289 Ga0207650_10095451 3300025925 Unclassified 2279
290 Ga0207650_10279881 3300025925 Bacteria 1358
291 Ga0207650_10317568 3300025925 Bacteria 1275
292 Ga0207659_10502385 3300025926 Bacteria 1027
293 Ga0207644_10159167 3300025931 Unclassified 1754
294 Ga0207644_10204696 3300025931 Bacteria 1558
295 Ga0207644_10730879 3300025931 Bacteria 826
296 Ga0207690_10045039 3300025932 Bacteria 2912
297 Ga0207690_10098978 3300025932 Bacteria 2078
298 Ga0207706_10000633 3300025933 Bacteria 37294
299 Ga0207706_10016106 3300025933 Bacteria 6753
300 Ga0207706_10032597 3300025933 Bacteria 4640
301 Ga0207706_10047922 3300025933 Bacteria 3780
302 Ga0207706_10053997 3300025933 Unclassified 3546
303 Ga0207706_10099423 3300025933 Archaea 2560
304 Ga0207686_10037868 3300025934 Bacteria 2914
305 Ga0207686_10094389 3300025934 Unclassified 1983
306 Ga0207686_10190889 3300025934 Unclassified 1460
307 Ga0207670_10027056 3300025936 Unclassified 3622
308 Ga0207670_10050062 3300025936 Bacteria 2797
309 Ga0207670_10058345 3300025936 Bacteria 2622
310 Ga0207670_10139585 3300025936 Bacteria 1786
311 Ga0207704_11012474 3300025938 Bacteria 703
312 Ga0207691_10024454 3300025940 Bacteria 5680
313 Ga0207691_10037973 3300025940 Bacteria 4457
314 Ga0207691_11076852 3300025940 Bacteria 669
315 Ga0207689_10013167 3300025942 Bacteria 7058
316 Ga0207689_10035997 3300025942 Bacteria 4109
317 Ga0207689_10036600 3300025942 Bacteria 4074
318 Ga0207661_10002589 3300025944 Bacteria 12434
319 Ga0207661_10088930 3300025944 Bacteria 2568
320 Ga0207661_10112384 3300025944 Bacteria 2306
321 Ga0207661_10522208 3300025944 Bacteria 1086
322 Ga0207661_10651044 3300025944 Bacteria 968
323 Ga0207661_11002206 3300025944 Bacteria 769
324 Ga0207679_10000967 3300025945 Bacteria 18465
325 Ga0207679_10214856 3300025945 Bacteria 1615
326 Ga0207679_10370463 3300025945 Bacteria 1253
327 Ga0207667_10000133 3300025949 Bacteria 112994
328 Ga0207667_11300328 3300025949 Unclassified 704
329 Ga0207651_10012252 3300025960 Unclassified 4844
330 Ga0207651_10091863 3300025960 Bacteria 2224
331 Ga0207651_10097316 3300025960 Bacteria 2173
332 Ga0207651_10122372 3300025960 Bacteria 1976
333 Ga0207651_10483733 3300025960 Bacteria 1067
334 Ga0207651_10686508 3300025960 Bacteria 901
335 Ga0207712_10023005 3300025961 Bacteria 4109
336 Ga0207712_10758979 3300025961 Bacteria 850
337 Ga0207668_10230066 3300025972 Bacteria 1494
338 Ga0207640_10086500 3300025981 Unclassified 2158
339 Ga0207640_10086569 3300025981 Bacteria 2158
340 Ga0207640_10103164 3300025981 Bacteria 2005
341 Ga0207640_10156085 3300025981 Bacteria 1682
342 Ga0207640_10418260 3300025981 Unclassified 1096
343 Ga0207658_10269573 3300025986 Bacteria 1454
344 Ga0207658_10323195 3300025986 Unclassified 1336
345 Ga0207658_10784811 3300025986 Unclassified 864
346 Ga0207677_10016512 3300026023 Bacteria 4376
347 Ga0207703_10480197 3300026035 Bacteria 1164
348 Ga0207639_10030386 3300026041 Bacteria 3962
349 Ga0207639_10715641 3300026041 Bacteria 929
350 Ga0207708_10438150 3300026075 Bacteria 1086
351 Ga0207708_10457256 3300026075 Bacteria 1064
352 Ga0207702_10020374 3300026078 Bacteria 5493
353 Ga0207702_10521254 3300026078 Bacteria 1160
354 Ga0207641_10519754 3300026088 Bacteria 1158
355 Ga0207648_10007982 3300026089 Bacteria 10325
356 Ga0207648_10019528 3300026089 Bacteria 6116
357 Ga0207648_10036228 3300026089 Unclassified 4346
358 Ga0207648_10279950 3300026089 Bacteria 1491
359 Ga0207648_11326361 3300026089 Bacteria 676
360 Ga0207676_10077907 3300026095 Unclassified 2683
361 Ga0207676_10186046 3300026095 Bacteria 1823
362 Ga0207676_10193270 3300026095 Bacteria 1792
363 Ga0207676_10326365 3300026095 Bacteria 1411
364 Ga0207674_10010036 3300026116 Bacteria 10775
365 Ga0207674_10023536 3300026116 Bacteria 6595
366 Ga0207674_10036029 3300026116 Bacteria 5160
367 Ga0207674_10142876 3300026116 Bacteria 2353
368 Ga0207674_10382575 3300026116 Bacteria 1360
369 Ga0207674_10394150 3300026116 Bacteria 1338
370 Ga0207675_100000224 3300026118 Bacteria 53231
371 Ga0207675_100014802 3300026118 Bacteria 7279
372 Ga0207675_100185711 3300026118 Bacteria 1993
373 Ga0207675_101001213 3300026118 Bacteria 854
374 Ga0207683_10005839 3300026121 Bacteria 10554
375 Ga0207683_10052629 3300026121 Bacteria 3568
376 Ga0207683_11194901 3300026121 Bacteria 705
377 Ga0207698_10045764 3300026142 Bacteria 3299
378 Ga0207698_10068457 3300026142 Bacteria 2803
379 Ga0207698_10134800 3300026142 Bacteria 2117
380 Ga0207698_10149313 3300026142 Bacteria 2026
381 Ga0207698_10155722 3300026142 Unclassified 1990
382 Ga0207698_10268783 3300026142 Bacteria 1571
383 Ga0207698_10375660 3300026142 Unclassified 1351
384 Ga0207698_10430303 3300026142 Bacteria 1269
385 Ga0207698_10509436 3300026142 Bacteria 1172
386 Ga0207698_10524742 3300026142 Bacteria 1156
387 Ga0207698_10751886 3300026142 Bacteria 974
388 Ga0268266_10161639 3300028379 Bacteria 2027
389 Ga0268265_10648319 3300028380 Bacteria 1015
390 Ga0268264_10032800 3300028381 Bacteria 4262
391 Ga0268264_10062570 3300028381 Bacteria 3125
392 Ga0307515_10000002 3300028794 Bacteria 1231751
393 Ga0307515_10000107 3300028794 Bacteria 197046
394 Ga0307511_10000930 3300030521 Bacteria 30913
395 Ga0265327_10013769 3300031251 Bacteria 5345
396 Ga0265327_10065153 3300031251 Bacteria 1844
397 Ga0307414_10333939 3300032004 Bacteria 1295
398 Ga0307510_10361642 3300033180 Bacteria 899
399 Ga0373957_0208070 3300035120 Bacteria 817
400 Ga0373924_0037961 3300035410 Bacteria 1963
401 Ga0373937_0123261 3300036401 Unclassified 2416
402 Ga0395900_0081990 3300037418 Unclassified 3314
403 Ga0395898_0059677 3300037466 Unclassified 3710
404 Ga0395905_0003048 3300037471 Bacteria 18147
405 Ga0395905_0037188 3300037471 Unclassified 4572
406 Ga0395905_0114862 3300037471 Unclassified 2530
407 Ga0395901_0123489 3300038443 Unclassified 2721
408 Ga0395901_0198553 3300038443 Bacteria 2103
409 Ga0439439_0064788 3300041406 Unclassified 974
410 Ga0439465_0020297 3300041413 Unclassified 2080
411 Ga0439441_049788 3300042001 Unclassified 860
412 Ga0439445_0010614 3300042004 Unclassified 2183
413 Ga0439445_0069152 3300042004 Bacteria 975
414 Ga0439457_007062 3300042014 Unclassified 2710
415 Ga0439462_0077325 3300042015 Bacteria 907
416 Ga0450897_001395 3300042128 Bacteria 1645
417 Ga0439444_0100609 3300042437 Bacteria 655
418 Ga0451577_0012934 3300042876 Bacteria 7833
419 Ga0466972_0067016 3300044658 Bacteria 1716
420 Ga0453684_0106521 3300044712 Bacteria 3416
421 Ga0466959_0035564 3300045049 Bacteria 3683
422 Ga0451576_0367461 3300045051 Bacteria 1507
423 Ga0495643_0018177 3300046522 Bacteria 4092
424 Ga0495652_0742031 3300046529 Bacteria 658
425 Ga0495667_0050764 3300046559 Bacteria 2738
426 Ga0495634_0068426 3300046642 Bacteria 2346
427 Ga0495611_0174834 3300046648 Bacteria 1003
428 Ga0495672_0014426 3300047320 Bacteria 5411
429 Ga0495686_0198547 3300047472 Bacteria 1152
430 Ga0496108_0379270 3300048911 Bacteria 1235
431 Ga0496109_0417487 3300048912 Bacteria 1268
432 Ga0496110_0775834 3300048913 Bacteria 862
433 Ga0496111_0115510 3300048914 Bacteria 1979
434 Ga0496111_0376389 3300048914 Bacteria 1050
435 Ga0501031_0016131 3300049568 Bacteria 4851
436 Ga0501033_0361800 3300049570 Unclassified 1015
437 Ga0501034_0000002 3300049571 Bacteria 565510
438 Ga0501039_0008959 3300049575 Bacteria 7625
439 Ga0501043_0003624 3300049579 Bacteria 12688
440 Ga0501047_0254356 3300049581 Bacteria 1605
441 Ga0501069_0384732 3300049585 Bacteria 829
442 Ga0501202_154034 3300049652 Unclassified 603
443 Ga0501253_030050 3300049683 Unclassified 1030
444 Ga0501080_0117355 3300049742 Bacteria 2467
445 Ga0501035_0040771 3300049822 Bacteria 4194
446 Ga0501044_0047152 3300049823 Bacteria 4458
447 nmdc:mga0k408_79808_c1 3300050493 Bacteria 1915
448 nmdc:mga0qj67_758524_c1 3300050509 Bacteria 770
449 nmdc:mga06r32_499310_c1 3300050510 Bacteria 1194
450 nmdc:mga08y16_55628_c1 3300050511 Bacteria 4134
451 nmdc:mga0n895_366421_c1 3300050512 Unclassified 1459
452 Ga0500568_0009378 3300053139 Unclassified 4656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100002362 Ga0070698_10000236210 174
2 3300006844 Ga0075428_100057632 Ga0075428_1000576322 174
3 3300009147 Ga0114129_10511627 Ga0114129_105116272 174
4 3300003322 rootL2_10335767 rootL2_103357672 175
5 3300005364 Ga0070673_100191507 Ga0070673_1001915072 175
6 3300005719 Ga0068861_100005218 Ga0068861_1000052183 175
7 3300006846 Ga0075430_100041630 Ga0075430_1000416302 175
8 3300006847 Ga0075431_100017437 Ga0075431_1000174375 175
9 3300013307 Ga0157372_10147546 Ga0157372_101475462 175
10 3300014326 Ga0157380_10415744 Ga0157380_104157442 175
11 3300025918 Ga0207662_10035921 Ga0207662_100359213 175
12 3300025960 Ga0207651_10122372 Ga0207651_101223721 175
13 3300026089 Ga0207648_11326361 Ga0207648_113263612 175
14 3300026118 Ga0207675_100014802 Ga0207675_1000148023 175
15 3300050509 nmdc:mga0qj67_758524_c1 nmdc:mga0qj67_758524_c1_133_666 175
16 3300050510 nmdc:mga06r32_499310_c1 nmdc:mga06r32_499310_c1_379_912 175
17 3300003322 rootL2_10037652 rootL2_100376523 176
18 3300005288 Ga0065714_10165733 Ga0065714_101657331 176
19 3300005290 Ga0065712_10082089 Ga0065712_100820892 176
20 3300005295 Ga0065707_10134359 Ga0065707_101343592 176
21 3300005327 Ga0070658_10400305 Ga0070658_104003052 176
22 3300005327 Ga0070658_10766135 Ga0070658_107661352 176
23 3300005329 Ga0070683_100000900 Ga0070683_1000009008 176
24 3300005329 Ga0070683_100037020 Ga0070683_1000370204 176
25 3300005330 Ga0070690_100145261 Ga0070690_1001452612 176
26 3300005331 Ga0070670_100019064 Ga0070670_1000190644 176
27 3300005331 Ga0070670_100278423 Ga0070670_1002784232 176
28 3300005331 Ga0070670_101285825 Ga0070670_1012858251 176
29 3300005338 Ga0068868_100122506 Ga0068868_1001225062 176
30 3300005344 Ga0070661_100687565 Ga0070661_1006875651 176
31 3300005355 Ga0070671_100011941 Ga0070671_1000119415 176
32 3300005355 Ga0070671_100084360 Ga0070671_1000843603 176
33 3300005355 Ga0070671_100160542 Ga0070671_1001605422 176
34 3300005364 Ga0070673_100041603 Ga0070673_1000416032 176
35 3300005367 Ga0070667_100476146 Ga0070667_1004761462 176
36 3300005456 Ga0070678_101545791 Ga0070678_1015457911 176
37 3300005535 Ga0070684_100003715 Ga0070684_1000037157 176
38 3300005535 Ga0070684_100050121 Ga0070684_1000501214 176
39 3300005539 Ga0068853_100070002 Ga0068853_1000700022 176
40 3300005539 Ga0068853_100186924 Ga0068853_1001869242 176
41 3300005543 Ga0070672_100398670 Ga0070672_1003986702 176
42 3300005563 Ga0068855_100000210 Ga0068855_1000002105 176
43 3300005563 Ga0068855_100783834 Ga0068855_1007838342 176
44 3300005564 Ga0070664_100002699 Ga0070664_1000026995 176
45 3300005577 Ga0068857_100397451 Ga0068857_1003974512 176
46 3300005578 Ga0068854_100633517 Ga0068854_1006335172 176
47 3300005615 Ga0070702_100175257 Ga0070702_1001752572 176
48 3300005616 Ga0068852_100018294 Ga0068852_1000182945 176
49 3300005616 Ga0068852_100135798 Ga0068852_1001357982 176
50 3300005616 Ga0068852_100175627 Ga0068852_1001756272 176
51 3300005616 Ga0068852_100826591 Ga0068852_1008265912 176
52 3300005618 Ga0068864_100343550 Ga0068864_1003435502 176
53 3300005718 Ga0068866_10630364 Ga0068866_106303641 176
54 3300005719 Ga0068861_100000923 Ga0068861_1000009234 176
55 3300005834 Ga0068851_10046605 Ga0068851_100466052 176
56 3300006358 Ga0068871_100854567 Ga0068871_1008545672 176
57 3300009174 Ga0105241_11041957 Ga0105241_110419571 176
58 3300009176 Ga0105242_10434183 Ga0105242_104341832 176
59 3300010375 Ga0105239_10207962 Ga0105239_102079622 176
60 3300013100 Ga0157373_10249812 Ga0157373_102498121 176
61 3300013102 Ga0157371_10298562 Ga0157371_102985622 176
62 3300013104 Ga0157370_10008901 Ga0157370_100089018 176
63 3300013105 Ga0157369_10071727 Ga0157369_100717274 176
64 3300013105 Ga0157369_10414900 Ga0157369_104149002 176
65 3300013296 Ga0157374_10075606 Ga0157374_100756063 176
66 3300013297 Ga0157378_11243885 Ga0157378_112438852 176
67 3300013307 Ga0157372_10056600 Ga0157372_100566001 176
68 3300013307 Ga0157372_10401972 Ga0157372_104019722 176
69 3300013307 Ga0157372_10691034 Ga0157372_106910342 176
70 3300013307 Ga0157372_11859765 Ga0157372_118597651 176
71 3300013308 Ga0157375_10085112 Ga0157375_100851122 176
72 3300014325 Ga0163163_10032557 Ga0163163_100325572 176
73 3300025321 Ga0207656_10035879 Ga0207656_100358792 176
74 3300025321 Ga0207656_10447795 Ga0207656_104477951 176
75 3300025904 Ga0207647_10000403 Ga0207647_1000040312 176
76 3300025909 Ga0207705_10408361 Ga0207705_104083611 176
77 3300025913 Ga0207695_10000568 Ga0207695_100005686 176
78 3300025920 Ga0207649_10165256 Ga0207649_101652562 176
79 3300025921 Ga0207652_10257097 Ga0207652_102570972 176
80 3300025923 Ga0207681_10892581 Ga0207681_108925812 176
81 3300025925 Ga0207650_10007187 Ga0207650_100071874 176
82 3300025925 Ga0207650_10279881 Ga0207650_102798812 176
83 3300025931 Ga0207644_10159167 Ga0207644_101591672 176
84 3300025931 Ga0207644_10204696 Ga0207644_102046962 176
85 3300025932 Ga0207690_10045039 Ga0207690_100450392 176
86 3300025940 Ga0207691_10037973 Ga0207691_100379735 176
87 3300025944 Ga0207661_10002589 Ga0207661_100025895 176
88 3300025944 Ga0207661_11002206 Ga0207661_110022062 176
89 3300025949 Ga0207667_11300328 Ga0207667_113003281 176
90 3300025960 Ga0207651_10012252 Ga0207651_100122522 176
91 3300025981 Ga0207640_10103164 Ga0207640_101031643 176
92 3300025986 Ga0207658_10784811 Ga0207658_107848111 176
93 3300026041 Ga0207639_10030386 Ga0207639_100303864 176
94 3300026095 Ga0207676_10326365 Ga0207676_103263652 176
95 3300026116 Ga0207674_10382575 Ga0207674_103825752 176
96 3300026116 Ga0207674_10394150 Ga0207674_103941501 176
97 3300026142 Ga0207698_10045764 Ga0207698_100457643 176
98 3300026142 Ga0207698_10149313 Ga0207698_101493132 176
99 3300026142 Ga0207698_10155722 Ga0207698_101557222 176
100 3300026142 Ga0207698_10524742 Ga0207698_105247422 176
101 3300028794 Ga0307515_10000002 Ga0307515_10000002362 176
102 3300032004 Ga0307414_10333939 Ga0307414_103339392 176
103 3300037418 Ga0395900_0081990 Ga0395900_0081990_1204_1743 176
104 3300037466 Ga0395898_0059677 Ga0395898_0059677_3031_3570 176
105 3300037471 Ga0395905_0114862 Ga0395905_0114862_139_678 176
106 3300038443 Ga0395901_0198553 Ga0395901_0198553_1486_2025 176
107 3300041406 Ga0439439_0064788 Ga0439439_0064788_188_724 176
108 3300042004 Ga0439445_0010614 Ga0439445_0010614_290_826 176
109 3300042014 Ga0439457_007062 Ga0439457_007062_1322_1858 176
110 3300042015 Ga0439462_0077325 Ga0439462_0077325_91_627 176
111 3300042128 Ga0450897_001395 Ga0450897_001395_639_1175 176
112 3300044712 Ga0453684_0106521 Ga0453684_0106521_2045_2584 176
113 3300045051 Ga0451576_0367461 Ga0451576_0367461_880_1419 176
114 3300046522 Ga0495643_0018177 Ga0495643_0018177_515_1051 176
115 3300049585 Ga0501069_0384732 Ga0501069_0384732_267_803 176
116 3300003320 rootH2_10009025 rootH2_100090255 177
117 3300005327 Ga0070658_10149613 Ga0070658_101496133 177
118 3300005328 Ga0070676_10026338 Ga0070676_100263382 177
119 3300005329 Ga0070683_100473590 Ga0070683_1004735902 177
120 3300005329 Ga0070683_100567066 Ga0070683_1005670662 177
121 3300005330 Ga0070690_100245409 Ga0070690_1002454091 177
122 3300005331 Ga0070670_100017090 Ga0070670_1000170905 177
123 3300005331 Ga0070670_100045982 Ga0070670_1000459824 177
124 3300005331 Ga0070670_100322794 Ga0070670_1003227941 177
125 3300005331 Ga0070670_100413436 Ga0070670_1004134362 177
126 3300005334 Ga0068869_100008483 Ga0068869_1000084833 177
127 3300005334 Ga0068869_100044495 Ga0068869_1000444953 177
128 3300005335 Ga0070666_10025398 Ga0070666_100253982 177
129 3300005335 Ga0070666_10047761 Ga0070666_100477613 177
130 3300005338 Ga0068868_100002558 Ga0068868_10000255811 177
131 3300005338 Ga0068868_100082058 Ga0068868_1000820582 177
132 3300005338 Ga0068868_100123110 Ga0068868_1001231103 177
133 3300005340 Ga0070689_100013635 Ga0070689_1000136354 177
134 3300005340 Ga0070689_100191667 Ga0070689_1001916672 177
135 3300005344 Ga0070661_100019193 Ga0070661_1000191935 177
136 3300005347 Ga0070668_100365593 Ga0070668_1003655932 177
137 3300005347 Ga0070668_100480250 Ga0070668_1004802502 177
138 3300005353 Ga0070669_101042945 Ga0070669_1010429451 177
139 3300005353 Ga0070669_101118890 Ga0070669_1011188901 177
140 3300005354 Ga0070675_100010652 Ga0070675_1000106523 177
141 3300005354 Ga0070675_100622590 Ga0070675_1006225901 177
142 3300005355 Ga0070671_100144312 Ga0070671_1001443122 177
143 3300005355 Ga0070671_100312683 Ga0070671_1003126832 177
144 3300005364 Ga0070673_100052875 Ga0070673_1000528752 177
145 3300005364 Ga0070673_100891211 Ga0070673_1008912112 177
146 3300005365 Ga0070688_100097048 Ga0070688_1000970482 177
147 3300005365 Ga0070688_100186893 Ga0070688_1001868931 177
148 3300005367 Ga0070667_100020035 Ga0070667_1000200354 177
149 3300005367 Ga0070667_100446841 Ga0070667_1004468412 177
150 3300005456 Ga0070678_100016643 Ga0070678_1000166431 177
151 3300005456 Ga0070678_100303420 Ga0070678_1003034202 177
152 3300005457 Ga0070662_100002049 Ga0070662_1000020495 177
153 3300005457 Ga0070662_100031009 Ga0070662_1000310093 177
154 3300005457 Ga0070662_100056959 Ga0070662_1000569592 177
155 3300005457 Ga0070662_100166340 Ga0070662_1001663402 177
156 3300005459 Ga0068867_100042739 Ga0068867_1000427392 177
157 3300005466 Ga0070685_10053951 Ga0070685_100539512 177
158 3300005466 Ga0070685_10140960 Ga0070685_101409602 177
159 3300005466 Ga0070685_10230576 Ga0070685_102305761 177
160 3300005535 Ga0070684_100017036 Ga0070684_1000170362 177
161 3300005535 Ga0070684_100342774 Ga0070684_1003427742 177
162 3300005535 Ga0070684_100384659 Ga0070684_1003846591 177
163 3300005535 Ga0070684_100603936 Ga0070684_1006039362 177
164 3300005539 Ga0068853_100054547 Ga0068853_1000545475 177
165 3300005543 Ga0070672_100147374 Ga0070672_1001473743 177
166 3300005543 Ga0070672_101066167 Ga0070672_1010661671 177
167 3300005545 Ga0070695_100591501 Ga0070695_1005915011 177
168 3300005548 Ga0070665_100745541 Ga0070665_1007455411 177
169 3300005563 Ga0068855_100224126 Ga0068855_1002241262 177
170 3300005563 Ga0068855_101227479 Ga0068855_1012274792 177
171 3300005564 Ga0070664_100099292 Ga0070664_1000992923 177
172 3300005564 Ga0070664_100130052 Ga0070664_1001300523 177
173 3300005577 Ga0068857_100014888 Ga0068857_1000148885 177
174 3300005577 Ga0068857_100297880 Ga0068857_1002978802 177
175 3300005578 Ga0068854_100113380 Ga0068854_1001133802 177
176 3300005578 Ga0068854_100335890 Ga0068854_1003358902 177
177 3300005578 Ga0068854_100539261 Ga0068854_1005392612 177
178 3300005614 Ga0068856_100021467 Ga0068856_1000214674 177
179 3300005616 Ga0068852_100000566 Ga0068852_1000005663 177
180 3300005616 Ga0068852_100168697 Ga0068852_1001686972 177
181 3300005616 Ga0068852_100426961 Ga0068852_1004269612 177
182 3300005616 Ga0068852_100625179 Ga0068852_1006251792 177
183 3300005616 Ga0068852_100787545 Ga0068852_1007875452 177
184 3300005617 Ga0068859_100014736 Ga0068859_1000147365 177
185 3300005617 Ga0068859_100045711 Ga0068859_1000457112 177
186 3300005617 Ga0068859_100102116 Ga0068859_1001021162 177
187 3300005617 Ga0068859_100650088 Ga0068859_1006500882 177
188 3300005618 Ga0068864_100049002 Ga0068864_1000490023 177
189 3300005618 Ga0068864_100110185 Ga0068864_1001101852 177
190 3300005618 Ga0068864_101061281 Ga0068864_1010612812 177
191 3300005718 Ga0068866_10015879 Ga0068866_100158792 177
192 3300005718 Ga0068866_10237693 Ga0068866_102376932 177
193 3300005834 Ga0068851_10275958 Ga0068851_102759582 177
194 3300005841 Ga0068863_100254825 Ga0068863_1002548252 177
195 3300005842 Ga0068858_100071565 Ga0068858_1000715653 177
196 3300005843 Ga0068860_100093494 Ga0068860_1000934942 177
197 3300005843 Ga0068860_100149831 Ga0068860_1001498311 177
198 3300005843 Ga0068860_101513833 Ga0068860_1015138332 177
199 3300005844 Ga0068862_100448491 Ga0068862_1004484912 177
200 3300006237 Ga0097621_100021773 Ga0097621_1000217731 177
201 3300006237 Ga0097621_100678475 Ga0097621_1006784751 177
202 3300006358 Ga0068871_100006474 Ga0068871_1000064746 177
203 3300006358 Ga0068871_100085832 Ga0068871_1000858322 177
204 3300006358 Ga0068871_100817613 Ga0068871_1008176132 177
205 3300006871 Ga0075434_100329378 Ga0075434_1003293782 177
206 3300006871 Ga0075434_100783308 Ga0075434_1007833082 177
207 3300006881 Ga0068865_100203922 Ga0068865_1002039222 177
208 3300006881 Ga0068865_100281806 Ga0068865_1002818062 177
209 3300006931 Ga0097620_100014735 Ga0097620_1000147355 177
210 3300006931 Ga0097620_100045711 Ga0097620_1000457116 177
211 3300006931 Ga0097620_100102111 Ga0097620_1001021113 177
212 3300006931 Ga0097620_100245867 Ga0097620_1002458672 177
213 3300006931 Ga0097620_100650098 Ga0097620_1006500982 177
214 3300009101 Ga0105247_10083006 Ga0105247_100830063 177
215 3300009148 Ga0105243_10456283 Ga0105243_104562832 177
216 3300009174 Ga0105241_10103244 Ga0105241_101032442 177
217 3300009174 Ga0105241_10196356 Ga0105241_101963562 177
218 3300009176 Ga0105242_10022981 Ga0105242_100229814 177
219 3300009176 Ga0105242_10062643 Ga0105242_100626433 177
220 3300009176 Ga0105242_10121377 Ga0105242_101213772 177
221 3300009176 Ga0105242_10558318 Ga0105242_105583182 177
222 3300009177 Ga0105248_11051983 Ga0105248_110519832 177
223 3300009545 Ga0105237_10031528 Ga0105237_100315281 177
224 3300009545 Ga0105237_10349186 Ga0105237_103491862 177
225 3300009545 Ga0105237_10620966 Ga0105237_106209661 177
226 3300009551 Ga0105238_10144161 Ga0105238_101441612 177
227 3300009553 Ga0105249_10018154 Ga0105249_100181545 177
228 3300009553 Ga0105249_10330659 Ga0105249_103306593 177
229 3300009553 Ga0105249_11388822 Ga0105249_113888221 177
230 3300011119 Ga0105246_10098437 Ga0105246_100984372 177
231 3300013100 Ga0157373_10142683 Ga0157373_101426831 177
232 3300013102 Ga0157371_10041366 Ga0157371_100413662 177
233 3300013104 Ga0157370_10096305 Ga0157370_100963052 177
234 3300013105 Ga0157369_10032048 Ga0157369_100320482 177
235 3300013296 Ga0157374_10021746 Ga0157374_100217466 177
236 3300013296 Ga0157374_10030791 Ga0157374_100307913 177
237 3300013296 Ga0157374_10031994 Ga0157374_100319944 177
238 3300013296 Ga0157374_10123369 Ga0157374_101233692 177
239 3300013296 Ga0157374_11241556 Ga0157374_112415561 177
240 3300013297 Ga0157378_10026651 Ga0157378_100266512 177
241 3300013297 Ga0157378_10107725 Ga0157378_101077253 177
242 3300013306 Ga0163162_10013839 Ga0163162_100138398 177
243 3300013306 Ga0163162_10044861 Ga0163162_100448615 177
244 3300013306 Ga0163162_10092745 Ga0163162_100927453 177
245 3300013306 Ga0163162_10225860 Ga0163162_102258602 177
246 3300013307 Ga0157372_10000255 Ga0157372_1000025541 177
247 3300013307 Ga0157372_10234397 Ga0157372_102343972 177
248 3300013307 Ga0157372_10472150 Ga0157372_104721503 177
249 3300013307 Ga0157372_10592720 Ga0157372_105927202 177
250 3300013308 Ga0157375_10002328 Ga0157375_1000232810 177
251 3300013308 Ga0157375_10101642 Ga0157375_101016422 177
252 3300013308 Ga0157375_10230228 Ga0157375_102302282 177
253 3300013308 Ga0157375_10699773 Ga0157375_106997732 177
254 3300013308 Ga0157375_10777134 Ga0157375_107771342 177
255 3300014325 Ga0163163_10019305 Ga0163163_100193055 177
256 3300014325 Ga0163163_10184389 Ga0163163_101843892 177
257 3300014325 Ga0163163_11956525 Ga0163163_119565251 177
258 3300014745 Ga0157377_10180869 Ga0157377_101808692 177
259 3300014745 Ga0157377_10260571 Ga0157377_102605711 177
260 3300014968 Ga0157379_10094317 Ga0157379_100943172 177
261 3300014968 Ga0157379_10154185 Ga0157379_101541852 177
262 3300014968 Ga0157379_10178515 Ga0157379_101785151 177
263 3300014968 Ga0157379_10245713 Ga0157379_102457132 177
264 3300014968 Ga0157379_10608059 Ga0157379_106080592 177
265 3300014969 Ga0157376_10003040 Ga0157376_100030402 177
266 3300014969 Ga0157376_10291046 Ga0157376_102910461 177
267 3300017792 Ga0163161_10006316 Ga0163161_100063163 177
268 3300017792 Ga0163161_10651826 Ga0163161_106518262 177
269 3300025899 Ga0207642_10014016 Ga0207642_100140162 177
270 3300025899 Ga0207642_10056609 Ga0207642_100566092 177
271 3300025901 Ga0207688_10032407 Ga0207688_100324072 177
272 3300025903 Ga0207680_10067416 Ga0207680_100674163 177
273 3300025903 Ga0207680_10295997 Ga0207680_102959972 177
274 3300025903 Ga0207680_10733980 Ga0207680_107339802 177
275 3300025904 Ga0207647_10007311 Ga0207647_100073116 177
276 3300025904 Ga0207647_10050808 Ga0207647_100508082 177
277 3300025907 Ga0207645_10000935 Ga0207645_1000093514 177
278 3300025907 Ga0207645_10000985 Ga0207645_1000098519 177
279 3300025908 Ga0207643_10065777 Ga0207643_100657773 177
280 3300025911 Ga0207654_10160448 Ga0207654_101604482 177
281 3300025911 Ga0207654_10237252 Ga0207654_102372521 177
282 3300025914 Ga0207671_10009981 Ga0207671_100099817 177
283 3300025914 Ga0207671_10017295 Ga0207671_100172956 177
284 3300025914 Ga0207671_10260271 Ga0207671_102602712 177
285 3300025918 Ga0207662_10360110 Ga0207662_103601101 177
286 3300025920 Ga0207649_10201014 Ga0207649_102010142 177
287 3300025920 Ga0207649_10909175 Ga0207649_109091751 177
288 3300025923 Ga0207681_10038381 Ga0207681_100383814 177
289 3300025923 Ga0207681_10235530 Ga0207681_102355301 177
290 3300025923 Ga0207681_10971234 Ga0207681_109712341 177
291 3300025924 Ga0207694_10725745 Ga0207694_107257451 177
292 3300025925 Ga0207650_10095451 Ga0207650_100954512 177
293 3300025925 Ga0207650_10317568 Ga0207650_103175681 177
294 3300025926 Ga0207659_10502385 Ga0207659_105023851 177
295 3300025931 Ga0207644_10730879 Ga0207644_107308792 177
296 3300025932 Ga0207690_10098978 Ga0207690_100989781 177
297 3300025933 Ga0207706_10000633 Ga0207706_1000063323 177
298 3300025933 Ga0207706_10032597 Ga0207706_100325973 177
299 3300025933 Ga0207706_10047922 Ga0207706_100479224 177
300 3300025933 Ga0207706_10053997 Ga0207706_100539971 177
301 3300025933 Ga0207706_10099423 Ga0207706_100994232 177
302 3300025934 Ga0207686_10037868 Ga0207686_100378682 177
303 3300025934 Ga0207686_10094389 Ga0207686_100943892 177
304 3300025934 Ga0207686_10190889 Ga0207686_101908891 177
305 3300025936 Ga0207670_10027056 Ga0207670_100270562 177
306 3300025936 Ga0207670_10050062 Ga0207670_100500622 177
307 3300025936 Ga0207670_10058345 Ga0207670_100583453 177
308 3300025938 Ga0207704_11012474 Ga0207704_110124741 177
309 3300025940 Ga0207691_10024454 Ga0207691_100244542 177
310 3300025940 Ga0207691_11076852 Ga0207691_110768521 177
311 3300025942 Ga0207689_10013167 Ga0207689_100131675 177
312 3300025942 Ga0207689_10035997 Ga0207689_100359972 177
313 3300025942 Ga0207689_10036600 Ga0207689_100366005 177
314 3300025944 Ga0207661_10088930 Ga0207661_100889301 177
315 3300025944 Ga0207661_10112384 Ga0207661_101123842 177
316 3300025944 Ga0207661_10522208 Ga0207661_105222082 177
317 3300025944 Ga0207661_10651044 Ga0207661_106510441 177
318 3300025945 Ga0207679_10000967 Ga0207679_100009672 177
319 3300025945 Ga0207679_10214856 Ga0207679_102148563 177
320 3300025949 Ga0207667_10000133 Ga0207667_1000013321 177
321 3300025960 Ga0207651_10091863 Ga0207651_100918632 177
322 3300025960 Ga0207651_10483733 Ga0207651_104837332 177
323 3300025960 Ga0207651_10686508 Ga0207651_106865081 177
324 3300025961 Ga0207712_10758979 Ga0207712_107589792 177
325 3300025972 Ga0207668_10230066 Ga0207668_102300662 177
326 3300025981 Ga0207640_10086500 Ga0207640_100865002 177
327 3300025981 Ga0207640_10156085 Ga0207640_101560852 177
328 3300025981 Ga0207640_10418260 Ga0207640_104182601 177
329 3300025986 Ga0207658_10269573 Ga0207658_102695732 177
330 3300025986 Ga0207658_10323195 Ga0207658_103231952 177
331 3300026023 Ga0207677_10016512 Ga0207677_100165122 177
332 3300026035 Ga0207703_10480197 Ga0207703_104801972 177
333 3300026041 Ga0207639_10715641 Ga0207639_107156412 177
334 3300026075 Ga0207708_10438150 Ga0207708_104381502 177
335 3300026075 Ga0207708_10457256 Ga0207708_104572562 177
336 3300026078 Ga0207702_10020374 Ga0207702_100203744 177
337 3300026078 Ga0207702_10521254 Ga0207702_105212542 177
338 3300026088 Ga0207641_10519754 Ga0207641_105197541 177
339 3300026089 Ga0207648_10007982 Ga0207648_100079826 177
340 3300026089 Ga0207648_10019528 Ga0207648_100195283 177
341 3300026089 Ga0207648_10036228 Ga0207648_100362284 177
342 3300026089 Ga0207648_10279950 Ga0207648_102799502 177
343 3300026095 Ga0207676_10077907 Ga0207676_100779073 177
344 3300026095 Ga0207676_10186046 Ga0207676_101860462 177
345 3300026095 Ga0207676_10193270 Ga0207676_101932702 177
346 3300026116 Ga0207674_10010036 Ga0207674_100100362 177
347 3300026116 Ga0207674_10023536 Ga0207674_100235363 177
348 3300026116 Ga0207674_10142876 Ga0207674_101428763 177
349 3300026118 Ga0207675_100185711 Ga0207675_1001857112 177
350 3300026118 Ga0207675_101001213 Ga0207675_1010012131 177
351 3300026121 Ga0207683_10005839 Ga0207683_1000583910 177
352 3300026121 Ga0207683_10052629 Ga0207683_100526292 177
353 3300026121 Ga0207683_11194901 Ga0207683_111949012 177
354 3300026142 Ga0207698_10068457 Ga0207698_100684571 177
355 3300026142 Ga0207698_10134800 Ga0207698_101348002 177
356 3300026142 Ga0207698_10268783 Ga0207698_102687831 177
357 3300026142 Ga0207698_10430303 Ga0207698_104303032 177
358 3300026142 Ga0207698_10509436 Ga0207698_105094361 177
359 3300026142 Ga0207698_10751886 Ga0207698_107518862 177
360 3300028379 Ga0268266_10161639 Ga0268266_101616392 177
361 3300028380 Ga0268265_10648319 Ga0268265_106483191 177
362 3300028381 Ga0268264_10032800 Ga0268264_100328003 177
363 3300028381 Ga0268264_10062570 Ga0268264_100625702 177
364 3300028794 Ga0307515_10000107 Ga0307515_1000010729 177
365 3300030521 Ga0307511_10000930 Ga0307511_100009307 177
366 3300031251 Ga0265327_10013769 Ga0265327_100137692 177
367 3300031251 Ga0265327_10065153 Ga0265327_100651532 177
368 3300033180 Ga0307510_10361642 Ga0307510_103616422 177
369 3300035120 Ga0373957_0208070 Ga0373957_0208070_86_625 177
370 3300035410 Ga0373924_0037961 Ga0373924_0037961_582_1121 177
371 3300036401 Ga0373937_0123261 Ga0373937_0123261_779_1318 177
372 3300037471 Ga0395905_0003048 Ga0395905_0003048_6350_6898 177
373 3300037471 Ga0395905_0037188 Ga0395905_0037188_471_1019 177
374 3300038443 Ga0395901_0123489 Ga0395901_0123489_1811_2359 177
375 3300041413 Ga0439465_0020297 Ga0439465_0020297_1434_1976 177
376 3300042001 Ga0439441_049788 Ga0439441_049788_52_591 177
377 3300042004 Ga0439445_0069152 Ga0439445_0069152_335_877 177
378 3300042437 Ga0439444_0100609 Ga0439444_0100609_71_610 177
379 3300042876 Ga0451577_0012934 Ga0451577_0012934_7104_7649 177
380 3300044658 Ga0466972_0067016 Ga0466972_0067016_1137_1676 177
381 3300045049 Ga0466959_0035564 Ga0466959_0035564_852_1400 177
382 3300046529 Ga0495652_0742031 Ga0495652_0742031_69_608 177
383 3300046559 Ga0495667_0050764 Ga0495667_0050764_813_1352 177
384 3300046642 Ga0495634_0068426 Ga0495634_0068426_449_988 177
385 3300046648 Ga0495611_0174834 Ga0495611_0174834_213_752 177
386 3300047320 Ga0495672_0014426 Ga0495672_0014426_4764_5324 177
387 3300048911 Ga0496108_0379270 Ga0496108_0379270_396_935 177
388 3300048912 Ga0496109_0417487 Ga0496109_0417487_114_653 177
389 3300048913 Ga0496110_0775834 Ga0496110_0775834_304_843 177
390 3300048914 Ga0496111_0115510 Ga0496111_0115510_715_1254 177
391 3300048914 Ga0496111_0376389 Ga0496111_0376389_59_598 177
392 3300049568 Ga0501031_0016131 Ga0501031_0016131_934_1473 177
393 3300049570 Ga0501033_0361800 Ga0501033_0361800_458_997 177
394 3300049571 Ga0501034_0000002 Ga0501034_0000002_397019_397558 177
395 3300049575 Ga0501039_0008959 Ga0501039_0008959_2942_3481 177
396 3300049579 Ga0501043_0003624 Ga0501043_0003624_3664_4203 177
397 3300049581 Ga0501047_0254356 Ga0501047_0254356_423_962 177
398 3300049652 Ga0501202_154034 Ga0501202_154034_22_570 177
399 3300049683 Ga0501253_030050 Ga0501253_030050_457_1005 177
400 3300049742 Ga0501080_0117355 Ga0501080_0117355_300_839 177
401 3300049822 Ga0501035_0040771 Ga0501035_0040771_3010_3549 177
402 3300049823 Ga0501044_0047152 Ga0501044_0047152_3353_3892 177
403 3300050512 nmdc:mga0n895_366421_c1 nmdc:mga0n895_366421_c1_111_650 177
404 3300053139 Ga0500568_0009378 Ga0500568_0009378_20_559 177
405 3300013102 Ga0157371_10004245 Ga0157371_100042454 178
406 3300006195 Ga0075366_10019321 Ga0075366_100193212 180
407 3300025909 Ga0207705_10340247 Ga0207705_103402472 180
408 3300047472 Ga0495686_0198547 Ga0495686_0198547_87_635 180
409 3300050493 nmdc:mga0k408_79808_c1 nmdc:mga0k408_79808_c1_992_1540 180
410 3300005290 Ga0065712_10000371 Ga0065712_1000037110 182
411 3300005295 Ga0065707_10117438 Ga0065707_101174382 182
412 3300005328 Ga0070676_10007303 Ga0070676_100073034 182
413 3300005331 Ga0070670_100039648 Ga0070670_1000396484 182
414 3300005343 Ga0070687_100056550 Ga0070687_1000565503 182
415 3300005353 Ga0070669_100011634 Ga0070669_1000116344 182
416 3300005354 Ga0070675_100001682 Ga0070675_10000168210 182
417 3300005365 Ga0070688_100000511 Ga0070688_1000005114 182
418 3300005438 Ga0070701_10023652 Ga0070701_100236523 182
419 3300005441 Ga0070700_100087915 Ga0070700_1000879153 182
420 3300005457 Ga0070662_100012841 Ga0070662_1000128412 182
421 3300005564 Ga0070664_100098050 Ga0070664_1000980503 182
422 3300005577 Ga0068857_100128712 Ga0068857_1001287123 182
423 3300005578 Ga0068854_100187133 Ga0068854_1001871332 182
424 3300005617 Ga0068859_100056590 Ga0068859_1000565904 182
425 3300005840 Ga0068870_10462783 Ga0068870_104627832 182
426 3300006880 Ga0075429_100741911 Ga0075429_1007419111 182
427 3300006881 Ga0068865_100493939 Ga0068865_1004939391 182
428 3300006931 Ga0097620_100056590 Ga0097620_1000565902 182
429 3300009094 Ga0111539_10002087 Ga0111539_1000208714 182
430 3300009553 Ga0105249_10003314 Ga0105249_100033144 182
431 3300013306 Ga0163162_10079470 Ga0163162_100794702 182
432 3300014326 Ga0157380_10017444 Ga0157380_100174441 182
433 3300014745 Ga0157377_10000562 Ga0157377_1000056210 182
434 3300025315 Ga0207697_10065608 Ga0207697_100656082 182
435 3300025907 Ga0207645_10171403 Ga0207645_101714032 182
436 3300025908 Ga0207643_10006500 Ga0207643_100065004 182
437 3300025918 Ga0207662_10053613 Ga0207662_100536133 182
438 3300025923 Ga0207681_10011293 Ga0207681_100112934 182
439 3300025925 Ga0207650_10056996 Ga0207650_100569963 182
440 3300025933 Ga0207706_10016106 Ga0207706_100161062 182
441 3300025936 Ga0207670_10139585 Ga0207670_101395851 182
442 3300025945 Ga0207679_10370463 Ga0207679_103704632 182
443 3300025960 Ga0207651_10097316 Ga0207651_100973162 182
444 3300025961 Ga0207712_10023005 Ga0207712_100230054 182
445 3300025981 Ga0207640_10086569 Ga0207640_100865692 182
446 3300026116 Ga0207674_10036029 Ga0207674_100360294 182
447 3300026118 Ga0207675_100000224 Ga0207675_10000022447 182
448 3300050511 nmdc:mga08y16_55628_c1 nmdc:mga08y16_55628_c1_290_949 182
449 3300001991 JGI24743J22301_10035509 JGI24743J22301_100355092 183
450 3300013307 Ga0157372_10112625 Ga0157372_101126252 183
451 3300013307 Ga0157372_10133860 Ga0157372_101338603 183
452 3300026142 Ga0207698_10375660 Ga0207698_103756602 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

89

219

0.98

PF18306

LDcluster4

SLOG cluster4 family

46

210

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zbl-assembly1.cif.gz_B crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.8996 3 181
5zbl-assembly2.cif.gz_C crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.8937 3 179
5zbl-assembly2.cif.gz_D crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.8936 3 179
5zbj-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 0.8871 2 181
5its-assembly2.cif.gz_C crystal structure of log from corynebacterium glutamicum 0.8822 3 181
ID Description Score Start End Superfamily
5zblB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8996 3 181 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8612 1 179 3.40.50.450
af_A0A1D6K2U3_1_187_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.86 2 181 3.40.50.450
af_A4HXF6_126_320_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8506 2 181 3.40.50.450
5zblB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8454 3 181 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A1G6T4V6-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9341 2 180 GO:0005829
GO:0009691
GO:0016799
AF-A0A839MSM8-F1-model_v4 deleted 0.9249 2 177
AF-A0A4U3KTI3-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9207 2 181 GO:0005829
GO:0009691
GO:0016799
AF-A0A3D0FLU9-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9199 28 182 GO:0005829
GO:0009691
GO:0016799
AF-A0A2S0UMD8-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9195 21 181 GO:0005829
GO:0008714
GO:0009691

Feature Viewer

pLDDT pTM Quality
83.52 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map