F446828

General Info

Members Datasets Scaffolds Average Seq Length
451 143 902 332

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_1282927|Ga0436362_1282927_58_1095
Length 345
Sequence MALERDKHIAERALLTMDETQLVELYRSMVLIRRFEEKTAEMYARGKITGFCHLYAGEEAVAVGAISALYDKDYVVSTYREHGHCLAKGASARAVMAELFGKVTGISRGHGGSMHLFDPNLRFMGGYAIVGGGLPLAAGLGLSIMYKEEPEVVCCFFGDGALPQGAFHESLNMASLWKLPVIFICENNFYGMGTLVQNAICQQELYRFAEPYKMPGVRVDGMDALDVYGAVTEAAARAREGDGPSLIEAVTYRFRGHSMSDPAEYRSRREERIWQERDPIKSLRRKILQDRRASESRLDEVDAEVAAVIDDAVKFAEESPEPALDELGSFVYADHRTDHGNRPIS

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
77 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
78 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
79 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
80 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
87 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
88 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
89 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
95 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
96 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 99.78
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_1282927 3300039453 Unclassified 1477
2 JGI25406J46586_10029364 3300003203 Bacteria 2082
3 Ga0065707_10156245 3300005295 Bacteria 1606
4 Ga0070680_100026404 3300005336 Bacteria 4646
5 Ga0070680_100093157 3300005336 Bacteria 2496
6 Ga0070680_100272993 3300005336 Bacteria 1432
7 Ga0070687_100088517 3300005343 Bacteria 1707
8 Ga0070692_10018781 3300005345 Bacteria 3330
9 Ga0070668_100101529 3300005347 Bacteria 2280
10 Ga0070669_100111317 3300005353 Bacteria 2078
11 Ga0070667_100180470 3300005367 Bacteria 1867
12 Ga0070703_10011539 3300005406 Bacteria 2497
13 Ga0070701_10001288 3300005438 Bacteria 9218
14 Ga0070705_100007533 3300005440 Bacteria 5361
15 Ga0070705_100032780 3300005440 Bacteria 2889
16 Ga0070705_100218640 3300005440 Bacteria 1318
17 Ga0070694_100026831 3300005444 Bacteria 3736
18 Ga0070694_100102494 3300005444 Bacteria 2027
19 Ga0070708_100008507 3300005445 Bacteria 8245
20 Ga0070708_100023372 3300005445 Bacteria 5257
21 Ga0070708_100076469 3300005445 Bacteria 3023
22 Ga0070708_100091913 3300005445 Bacteria 2764
23 Ga0070708_100105657 3300005445 Bacteria 2583
24 Ga0070662_100121084 3300005457 Bacteria 2006
25 Ga0070706_100022726 3300005467 Bacteria 5776
26 Ga0070706_100073814 3300005467 Bacteria 3158
27 Ga0070706_100086832 3300005467 Bacteria 2899
28 Ga0070706_100229149 3300005467 Bacteria 1734
29 Ga0070707_100020011 3300005468 Bacteria 6310
30 Ga0070707_100056870 3300005468 Bacteria 3752
31 Ga0070698_100025779 3300005471 Bacteria 6126
32 Ga0070698_100120132 3300005471 Bacteria 2588
33 Ga0070698_100214230 3300005471 Bacteria 1860
34 Ga0070699_100004968 3300005518 Bacteria 11727
35 Ga0070699_100005082 3300005518 Bacteria 11582
36 Ga0070699_100095626 3300005518 Bacteria 2601
37 Ga0070699_100284339 3300005518 Bacteria 1482
38 Ga0070699_100338302 3300005518 Bacteria 1354
39 Ga0070697_100018013 3300005536 Bacteria 5565
40 Ga0070697_100023533 3300005536 Bacteria 4898
41 Ga0070697_100093580 3300005536 Bacteria 2489
42 Ga0070695_100002058 3300005545 Bacteria 11502
43 Ga0070695_100007595 3300005545 Bacteria 6423
44 Ga0070696_100013092 3300005546 Bacteria 5565
45 Ga0070696_100022777 3300005546 Bacteria 4257
46 Ga0070704_100077525 3300005549 Bacteria 2435
47 Ga0070704_100359219 3300005549 Bacteria 1232
48 Ga0068859_100112825 3300005617 Bacteria 2782
49 Ga0068866_10138202 3300005718 Bacteria 1395
50 Ga0068858_100241072 3300005842 Bacteria 1716
51 Ga0068862_100050828 3300005844 Bacteria 3544
52 Ga0068862_100121292 3300005844 Bacteria 2304
53 Ga0081539_10000035 3300005985 Bacteria 302689
54 Ga0075428_100001055 3300006844 Bacteria 29285
55 Ga0075428_100004726 3300006844 Bacteria 15077
56 Ga0075428_100036220 3300006844 Bacteria 5436
57 Ga0075428_100065016 3300006844 Bacteria 3995
58 Ga0075428_100083527 3300006844 Bacteria 3485
59 Ga0075428_100572597 3300006844 Bacteria 1207
60 Ga0075430_100000188 3300006846 Bacteria 41506
61 Ga0075430_100000330 3300006846 Bacteria 33985
62 Ga0075430_100024831 3300006846 Bacteria 5098
63 Ga0075430_100031632 3300006846 Bacteria 4490
64 Ga0075431_100000322 3300006847 Bacteria 37762
65 Ga0075431_100000570 3300006847 Bacteria 31149
66 Ga0075431_100008332 3300006847 Bacteria 10369
67 Ga0075431_100008578 3300006847 Bacteria 10233
68 Ga0075431_100019087 3300006847 Bacteria 6985
69 Ga0075431_100027163 3300006847 Bacteria 5871
70 Ga0075431_100037896 3300006847 Bacteria 4964
71 Ga0075431_100043338 3300006847 Bacteria 4643
72 Ga0075431_100061034 3300006847 Bacteria 3891
73 Ga0075431_100069873 3300006847 Bacteria 3623
74 Ga0075431_100081701 3300006847 Bacteria 3336
75 Ga0075431_100156694 3300006847 Bacteria 2343
76 Ga0075431_100160599 3300006847 Bacteria 2311
77 Ga0075431_100596455 3300006847 Bacteria 1089
78 Ga0075433_10000406 3300006852 Bacteria 27514
79 Ga0075433_10006552 3300006852 Bacteria 9213
80 Ga0075433_10021606 3300006852 Bacteria 5398
81 Ga0075433_10028744 3300006852 Bacteria 4729
82 Ga0075433_10082504 3300006852 Bacteria 2835
83 Ga0075433_10151779 3300006852 Bacteria 2061
84 Ga0075433_10221745 3300006852 Bacteria 1680
85 Ga0075434_100010044 3300006871 Bacteria 8863
86 Ga0075434_100061061 3300006871 Bacteria 3749
87 Ga0075434_100066839 3300006871 Bacteria 3581
88 Ga0075434_100104981 3300006871 Bacteria 2835
89 Ga0075434_100166230 3300006871 Bacteria 2226
90 Ga0075434_100491207 3300006871 Bacteria 1248
91 Ga0075429_100002860 3300006880 Bacteria 14608
92 Ga0075429_100003632 3300006880 Bacteria 13140
93 Ga0075429_100005550 3300006880 Bacteria 10867
94 Ga0075429_100006020 3300006880 Bacteria 10487
95 Ga0075429_100006460 3300006880 Bacteria 10152
96 Ga0075429_100016424 3300006880 Bacteria 6416
97 Ga0075429_100030867 3300006880 Bacteria 4658
98 Ga0075429_100053876 3300006880 Bacteria 3499
99 Ga0075429_100100232 3300006880 Bacteria 2528
100 Ga0075429_100131670 3300006880 Bacteria 2188
101 Ga0075436_100013994 3300006914 Bacteria 5489
102 Ga0075436_100028671 3300006914 Bacteria 3829
103 Ga0097620_100112823 3300006931 Bacteria 2782
104 Ga0075435_100037814 3300007076 Bacteria 3846
105 Ga0075435_100120243 3300007076 Bacteria 2191
106 Ga0075435_100304397 3300007076 Bacteria 1363
107 Ga0099794_10008397 3300007265 Bacteria 4287
108 Ga0099794_10016433 3300007265 Bacteria 3280
109 Ga0099794_10032531 3300007265 Bacteria 2449
110 Ga0099794_10042542 3300007265 Bacteria 2166
111 Ga0111539_10014047 3300009094 Bacteria 10006
112 Ga0111539_10068109 3300009094 Bacteria 4202
113 Ga0111539_10102568 3300009094 Bacteria 3358
114 Ga0114129_10001217 3300009147 Bacteria 34192
115 Ga0114129_10001399 3300009147 Bacteria 32520
116 Ga0114129_10001436 3300009147 Bacteria 32152
117 Ga0114129_10002676 3300009147 Bacteria 24793
118 Ga0114129_10005852 3300009147 Bacteria 17412
119 Ga0114129_10017479 3300009147 Bacteria 10211
120 Ga0114129_10041581 3300009147 Bacteria 6475
121 Ga0114129_10062345 3300009147 Bacteria 5209
122 Ga0114129_10068962 3300009147 Bacteria 4929
123 Ga0114129_10118036 3300009147 Bacteria 3655
124 Ga0114129_10118048 3300009147 Bacteria 3654
125 Ga0114129_10118887 3300009147 Bacteria 3640
126 Ga0114129_10399929 3300009147 Bacteria 1810
127 Ga0114129_10481688 3300009147 Bacteria 1623
128 Ga0114129_10574638 3300009147 Bacteria 1463
129 Ga0114129_10641714 3300009147 Bacteria 1371
130 Ga0114129_10893099 3300009147 Bacteria 1127
131 Ga0105243_10063287 3300009148 Bacteria 2964
132 Ga0105243_10123932 3300009148 Bacteria 2183
133 Ga0105242_10116601 3300009176 Bacteria 2285
134 Ga0105249_10041176 3300009553 Bacteria 4198
135 Ga0157378_10044198 3300013297 Bacteria 3956
136 Ga0157378_10083271 3300013297 Bacteria 2894
137 Ga0163162_10163568 3300013306 Bacteria 2348
138 Ga0157375_10040399 3300013308 Bacteria 4496
139 Ga0157380_10166712 3300014326 Bacteria 1920
140 Ga0197907_11397824 3300020069 Bacteria 6880
141 Ga0206350_10811595 3300020080 Unclassified 4920
142 Ga0207653_10014073 3300025885 Bacteria 2508
143 Ga0207645_10158147 3300025907 Bacteria 1481
144 Ga0207684_10004367 3300025910 Bacteria 13357
145 Ga0207684_10007601 3300025910 Bacteria 9734
146 Ga0207684_10028169 3300025910 Bacteria 4785
147 Ga0207684_10038842 3300025910 Bacteria 4039
148 Ga0207684_10045243 3300025910 Bacteria 3734
149 Ga0207654_10023089 3300025911 Bacteria 3328
150 Ga0207671_10082798 3300025914 Bacteria 2408
151 Ga0207660_10022310 3300025917 Bacteria 4264
152 Ga0207660_10231022 3300025917 Bacteria 1454
153 Ga0207646_10003284 3300025922 Bacteria 18418
154 Ga0207646_10003689 3300025922 Bacteria 17099
155 Ga0207646_10004503 3300025922 Bacteria 15100
156 Ga0207646_10005081 3300025922 Bacteria 13975
157 Ga0207646_10157322 3300025922 Bacteria 2050
158 Ga0207646_10179095 3300025922 Bacteria 1914
159 Ga0207706_10075168 3300025933 Bacteria 2971
160 Ga0207686_10004031 3300025934 Bacteria 7880
161 Ga0207709_10019977 3300025935 Bacteria 3775
162 Ga0207709_10055534 3300025935 Bacteria 2447
163 Ga0207689_10005849 3300025942 Bacteria 10900
164 Ga0207689_10018617 3300025942 Bacteria 5858
165 Ga0207689_10064183 3300025942 Bacteria 3021
166 Ga0207712_10042381 3300025961 Bacteria 3133
167 Ga0207712_10044862 3300025961 Bacteria 3058
168 Ga0207712_10137321 3300025961 Bacteria 1871
169 Ga0207668_10136146 3300025972 Bacteria 1882
170 Ga0207641_10109268 3300026088 Bacteria 2449
171 Ga0207648_10184528 3300026089 Bacteria 1847
172 Ga0207675_100018700 3300026118 Bacteria 6467
173 Ga0207675_100352786 3300026118 Bacteria 1442
174 Ga0207428_10000027 3300027907 Bacteria 250186
175 Ga0207428_10031033 3300027907 Bacteria 4415
176 Ga0207428_10050425 3300027907 Bacteria 3330
177 Ga0207428_10150510 3300027907 Bacteria 1771
178 Ga0268265_10016479 3300028380 Bacteria 5078
179 Ga0268264_10052543 3300028381 Bacteria 3398
180 Ga0265765_1002371 3300030879 Bacteria 1818
181 Ga0307408_100023325 3300031548 Bacteria 4214
182 Ga0307408_100066095 3300031548 Bacteria 2655
183 Ga0307407_10143778 3300031903 Bacteria 1542
184 Ga0307412_10166188 3300031911 Bacteria 1645
185 Ga0307416_100033535 3300032002 Bacteria 3894
186 Ga0307411_10048063 3300032005 Bacteria 2763
187 Ga0307411_10126110 3300032005 Bacteria 1862
188 Ga0307415_100107981 3300032126 Bacteria 2058
189 Ga0307415_100335330 3300032126 Bacteria 1267
190 Ga0373940_0004762 3300035088 Bacteria 2890
191 Ga0373949_0018259 3300035090 Bacteria 1588
192 Ga0373949_0031272 3300035090 Bacteria 1269
193 Ga0373932_0006202 3300035112 Bacteria 2824
194 Ga0373939_0017437 3300035114 Bacteria 1907
195 Ga0373962_0014716 3300035242 Bacteria 1997
196 Ga0373931_0014054 3300035691 Bacteria 3907
197 Ga0373931_0014150 3300035691 Bacteria 3896
198 Ga0395900_0135931 3300037418 Bacteria 2518
199 Ga0395898_0052136 3300037466 Bacteria 3997
200 Ga0395901_0003453 3300038443 Bacteria 15929
201 Ga0436361_1163489 3300039447 Bacteria 2023
202 Ga0439441_001767 3300042001 Bacteria 2914
203 Ga0439456_017773 3300042013 Bacteria 1491
204 Ga0439464_0007909 3300042439 Bacteria 2785
205 Ga0439460_0000628 3300042461 Bacteria 7749
206 Ga0451577_0020543 3300042876 Bacteria 6057
207 Ga0451577_0121779 3300042876 Bacteria 2337
208 Ga0453683_0038305 3300044673 Bacteria 3014
209 Ga0451576_0079619 3300045051 Bacteria 3409
210 Ga0451576_0084375 3300045051 Bacteria 3304
211 Ga0451576_0815300 3300045051 Bacteria 980
212 Ga0495580_0005955 3300046472 Bacteria 9999
213 Ga0495659_0065595 3300046664 Bacteria 1351
214 Ga0495669_0045255 3300046684 Bacteria 1962
215 Ga0495670_0046671 3300046691 Bacteria 2164
216 Ga0495604_0029682 3300047317 Bacteria 4350
217 Ga0495636_0029933 3300047318 Bacteria 2224
218 Ga0495636_0177278 3300047318 Bacteria 966
219 Ga0495675_0093197 3300047444 Bacteria 1890
220 Ga0496102_0003375 3300048905 Bacteria 13534
221 Ga0501031_0060387 3300049568 Bacteria 2471
222 Ga0501031_0071835 3300049568 Bacteria 2253
223 Ga0501032_0045423 3300049569 Bacteria 2971
224 Ga0501032_0283052 3300049569 Bacteria 1073
225 Ga0501033_0011346 3300049570 Bacteria 6819
226 Ga0501033_0095792 3300049570 Bacteria 2169
227 Ga0501033_0108192 3300049570 Bacteria 2025
228 Ga0501034_0007680 3300049571 Bacteria 11476
229 Ga0501036_0000918 3300049572 Bacteria 22116
230 Ga0501036_0001392 3300049572 Bacteria 18597
231 Ga0501036_0076760 3300049572 Bacteria 2826
232 Ga0501036_0242558 3300049572 Bacteria 1511
233 Ga0501037_0001911 3300049573 Bacteria 15128
234 Ga0501038_0000219 3300049574 Bacteria 48961
235 Ga0501038_0006106 3300049574 Bacteria 11148
236 Ga0501038_0087138 3300049574 Bacteria 2622
237 Ga0501039_0001944 3300049575 Bacteria 15314
238 Ga0501039_0039523 3300049575 Bacteria 3643
239 Ga0501039_0061439 3300049575 Bacteria 2910
240 Ga0501039_0121944 3300049575 Bacteria 2043
241 Ga0501039_0169436 3300049575 Bacteria 1717
242 Ga0501040_0000216 3300049576 Bacteria 33584
243 Ga0501040_0001536 3300049576 Bacteria 14675
244 Ga0501040_0013617 3300049576 Bacteria 5349
245 Ga0501040_0013743 3300049576 Bacteria 5326
246 Ga0501040_0052804 3300049576 Bacteria 2783
247 Ga0501040_0059848 3300049576 Bacteria 2617
248 Ga0501040_0073963 3300049576 Bacteria 2355
249 Ga0501040_0080308 3300049576 Bacteria 2259
250 Ga0501040_0082364 3300049576 Bacteria 2231
251 Ga0501040_0127517 3300049576 Bacteria 1788
252 Ga0501040_0145725 3300049576 Bacteria 1669
253 Ga0501040_0238467 3300049576 Bacteria 1296
254 Ga0501041_0000742 3300049577 Bacteria 17461
255 Ga0501041_0004676 3300049577 Bacteria 7942
256 Ga0501041_0047430 3300049577 Bacteria 2615
257 Ga0501041_0081497 3300049577 Bacteria 1992
258 Ga0501042_0000279 3300049578 Bacteria 25036
259 Ga0501042_0010221 3300049578 Bacteria 6281
260 Ga0501042_0031455 3300049578 Bacteria 3753
261 Ga0501042_0142074 3300049578 Bacteria 1731
262 Ga0501042_0224792 3300049578 Bacteria 1354
263 Ga0501042_0261603 3300049578 Bacteria 1249
264 Ga0501043_0293235 3300049579 Bacteria 1245
265 Ga0501046_0000375 3300049580 Bacteria 45211
266 Ga0501046_0002294 3300049580 Bacteria 18040
267 Ga0501046_0065722 3300049580 Bacteria 2829
268 Ga0501046_0216727 3300049580 Bacteria 1419
269 Ga0501048_0001335 3300049582 Bacteria 18693
270 Ga0501048_0018364 3300049582 Bacteria 5144
271 Ga0501048_0024806 3300049582 Bacteria 4373
272 Ga0501048_0070110 3300049582 Bacteria 2476
273 Ga0501048_0082311 3300049582 Bacteria 2270
274 Ga0501048_0274406 3300049582 Bacteria 1199
275 Ga0501067_0115093 3300049583 Bacteria 1495
276 Ga0501068_0007197 3300049584 Bacteria 6163
277 Ga0501068_0015258 3300049584 Bacteria 4409
278 Ga0501069_0010118 3300049585 Bacteria 4989
279 Ga0501069_0090633 3300049585 Bacteria 1729
280 Ga0501070_0005598 3300049586 Bacteria 10713
281 Ga0501070_0026072 3300049586 Bacteria 4904
282 Ga0501071_0021871 3300049587 Bacteria 4457
283 Ga0501071_0021942 3300049587 Bacteria 4451
284 Ga0501071_0022653 3300049587 Bacteria 4381
285 Ga0501071_0026737 3300049587 Bacteria 4053
286 Ga0501072_0009091 3300049588 Bacteria 7544
287 Ga0501072_0012147 3300049588 Bacteria 6580
288 Ga0501072_0045461 3300049588 Bacteria 3453
289 Ga0501072_0057127 3300049588 Bacteria 3075
290 Ga0501072_0062839 3300049588 Bacteria 2929
291 Ga0501072_0065761 3300049588 Bacteria 2859
292 Ga0501072_0090780 3300049588 Bacteria 2425
293 Ga0501072_0107179 3300049588 Bacteria 2222
294 Ga0501072_0153733 3300049588 Bacteria 1835
295 Ga0501072_0154875 3300049588 Bacteria 1827
296 Ga0501072_0209612 3300049588 Bacteria 1553
297 Ga0501073_0012187 3300049589 Bacteria 6278
298 Ga0501074_0000294 3300049590 Bacteria 28804
299 Ga0501074_0000624 3300049590 Bacteria 22041
300 Ga0501074_0045528 3300049590 Bacteria 3174
301 Ga0501074_0069890 3300049590 Bacteria 2525
302 Ga0501075_0000047 3300049591 Bacteria 50323
303 Ga0501075_0000660 3300049591 Bacteria 21221
304 Ga0501075_0020778 3300049591 Bacteria 4779
305 Ga0501075_0041009 3300049591 Bacteria 3469
306 Ga0501075_0049645 3300049591 Bacteria 3154
307 Ga0501075_0052124 3300049591 Bacteria 3077
308 Ga0501075_0097935 3300049591 Bacteria 2226
309 Ga0501075_0155502 3300049591 Bacteria 1744
310 Ga0501075_0166582 3300049591 Bacteria 1681
311 Ga0501075_0176127 3300049591 Bacteria 1632
312 Ga0501075_0249926 3300049591 Bacteria 1351
313 Ga0501075_0385421 3300049591 Bacteria 1068
314 Ga0501076_0000006 3300049592 Bacteria 125308
315 Ga0501076_0007649 3300049592 Bacteria 7868
316 Ga0501076_0025644 3300049592 Bacteria 4565
317 Ga0501076_0031829 3300049592 Bacteria 4116
318 Ga0501076_0046013 3300049592 Bacteria 3447
319 Ga0501076_0053914 3300049592 Bacteria 3187
320 Ga0501076_0120530 3300049592 Bacteria 2124
321 Ga0501077_0000555 3300049593 Bacteria 22676
322 Ga0501077_0003051 3300049593 Bacteria 10052
323 Ga0501077_0009437 3300049593 Bacteria 6063
324 Ga0501077_0014499 3300049593 Bacteria 4953
325 Ga0501077_0072973 3300049593 Bacteria 2174
326 Ga0501077_0092682 3300049593 Bacteria 1914
327 Ga0501077_0128099 3300049593 Bacteria 1609
328 Ga0501077_0247983 3300049593 Bacteria 1132
329 Ga0501077_0267672 3300049593 Bacteria 1087
330 Ga0501079_0000675 3300049741 Bacteria 22940
331 Ga0501079_0003130 3300049741 Bacteria 12123
332 Ga0501079_0004537 3300049741 Bacteria 10300
333 Ga0501079_0011302 3300049741 Bacteria 6810
334 Ga0501079_0019583 3300049741 Bacteria 5168
335 Ga0501079_0025751 3300049741 Bacteria 4511
336 Ga0501079_0055370 3300049741 Bacteria 3061
337 Ga0501079_0074546 3300049741 Bacteria 2623
338 Ga0501079_0101046 3300049741 Bacteria 2236
339 Ga0501079_0170950 3300049741 Bacteria 1694
340 Ga0501079_0234979 3300049741 Bacteria 1432
341 Ga0501080_0000751 3300049742 Bacteria 26245
342 Ga0501080_0014894 3300049742 Bacteria 7161
343 Ga0501080_0015046 3300049742 Bacteria 7129
344 Ga0501080_0072679 3300049742 Bacteria 3200
345 Ga0501080_0171499 3300049742 Bacteria 2001
346 Ga0501080_0282974 3300049742 Bacteria 1507
347 Ga0501080_0345422 3300049742 Bacteria 1344
348 Ga0501080_0393439 3300049742 Bacteria 1248
349 Ga0501081_0000887 3300049743 Bacteria 17690
350 Ga0501081_0001968 3300049743 Bacteria 12789
351 Ga0501081_0003201 3300049743 Bacteria 10400
352 Ga0501081_0005541 3300049743 Bacteria 8148
353 Ga0501081_0027830 3300049743 Bacteria 3812
354 Ga0501081_0033276 3300049743 Bacteria 3502
355 Ga0501081_0063605 3300049743 Bacteria 2561
356 Ga0501081_0129172 3300049743 Bacteria 1805
357 Ga0501081_0141039 3300049743 Bacteria 1727
358 Ga0501083_0002540 3300049744 Bacteria 12529
359 Ga0501083_0022299 3300049744 Bacteria 4395
360 Ga0501083_0061880 3300049744 Bacteria 2499
361 Ga0501083_0104119 3300049744 Bacteria 1870
362 Ga0501035_0000558 3300049822 Bacteria 41368
363 Ga0501035_0018822 3300049822 Bacteria 6362
364 Ga0501035_0089447 3300049822 Bacteria 2712
365 Ga0501035_0267985 3300049822 Bacteria 1446
366 Ga0501045_0006802 3300049824 Bacteria 7920
367 Ga0501045_0010185 3300049824 Bacteria 6580
368 Ga0501045_0044836 3300049824 Bacteria 3221
369 Ga0501045_0222601 3300049824 Bacteria 1405
370 Ga0501045_0223957 3300049824 Bacteria 1400
371 nmdc:mga05p37_121573_c1 3300050507 Bacteria 3207
372 nmdc:mga05p37_1423_c1 3300050507 Bacteria 27829
373 nmdc:mga05p37_14836_c1 3300050507 Bacteria 9356
374 nmdc:mga05p37_1590_c1 3300050507 Bacteria 26367
375 nmdc:mga05p37_19578_c1 3300050507 Bacteria 8187
376 nmdc:mga05p37_203112_c1 3300050507 Bacteria 2399
377 nmdc:mga05p37_31073_c2 3300050507 Bacteria 4965
378 nmdc:mga05p37_437_c1 3300050507 Bacteria 45229
379 nmdc:mga05p37_498697_c1 3300050507 Bacteria 1398
380 nmdc:mga05p37_65288_c1 3300050507 Bacteria 4478
381 nmdc:mga05p37_72273_c1 3300050507 Bacteria 4245
382 nmdc:mga05p37_7542_c1 3300050507 Bacteria 12827
383 nmdc:mga05p37_79676_c1 3300050507 Bacteria 4033
384 nmdc:mga05p37_80608_c1 3300050507 Bacteria 4010
385 nmdc:mga05p37_82571_c1 3300050507 Bacteria 3960
386 nmdc:mga05p37_996_c1 3300050507 Bacteria 32280
387 nmdc:mga09592_2318_c1 3300050508 Bacteria 15358
388 nmdc:mga09592_35462_c1 3300050508 Bacteria 4176
389 nmdc:mga09592_39411_c1 3300050508 Bacteria 3969
390 nmdc:mga09592_5430_c1 3300050508 Bacteria 10362
391 nmdc:mga09592_56500_c1 3300050508 Bacteria 3317
392 nmdc:mga09592_6466_c1 3300050508 Bacteria 9541
393 nmdc:mga09592_75416_c1 3300050508 Bacteria 2867
394 nmdc:mga09592_82869_c1 3300050508 Bacteria 2733
395 nmdc:mga0qj67_140_c1 3300050509 Bacteria 48848
396 nmdc:mga0qj67_24649_c1 3300050509 Bacteria 4641
397 nmdc:mga0qj67_4886_c1 3300050509 Bacteria 9744
398 nmdc:mga0qj67_54217_c1 3300050509 Bacteria 3175
399 nmdc:mga06r32_1165_c1 3300050510 Bacteria 23660
400 nmdc:mga06r32_132407_c1 3300050510 Bacteria 2466
401 nmdc:mga06r32_45296_c1 3300050510 Bacteria 4192
402 nmdc:mga06r32_56986_c1 3300050510 Bacteria 3753
403 nmdc:mga06r32_6381_c1 3300050510 Bacteria 10598
404 nmdc:mga06r32_6726_c1 3300050510 Bacteria 10330
405 nmdc:mga06r32_9032_c1 3300050510 Bacteria 8980
406 nmdc:mga06r32_99866_c1 3300050510 Bacteria 2847
407 nmdc:mga08y16_2666_c1 3300050511 Bacteria 18354
408 nmdc:mga08y16_28701_c1 3300050511 Bacteria 5864
409 nmdc:mga0n895_12050_c1 3300050512 Bacteria 7740
410 nmdc:mga0n895_136488_c1 3300050512 Bacteria 2480
411 nmdc:mga0n895_407741_c1 3300050512 Bacteria 1375
412 nmdc:mga0n895_44945_c1 3300050512 Bacteria 4308
413 nmdc:mga0n895_463803_c1 3300050512 Bacteria 1278
414 nmdc:mga0rr50_103641_c1 3300050513 Bacteria 2240
415 nmdc:mga0rr50_13154_c1 3300050513 Bacteria 5377
416 nmdc:mga0rr50_27806_c1 3300050513 Bacteria 3966
417 nmdc:mga0rr50_39319_c1 3300050513 Bacteria 3430
418 nmdc:mga0rr50_58773_c1 3300050513 Bacteria 2883
419 nmdc:mga08x19_657_c1 3300050514 Bacteria 22276
420 nmdc:mga0a205_106918_c1 3300050515 Bacteria 2695
421 nmdc:mga0a205_254381_c1 3300050515 Bacteria 1635
422 nmdc:mga0a205_289_c1 3300050515 Bacteria 37019
423 nmdc:mga0a205_43410_c1 3300050515 Bacteria 4335
424 nmdc:mga0a205_50397_c1 3300050515 Bacteria 4020
425 nmdc:mga0a205_6551_c1 3300050515 Bacteria 10533
426 nmdc:mga0a205_76157_c1 3300050515 Bacteria 3242
427 nmdc:mga0a205_90149_c1 3300050515 Bacteria 2963
428 Ga0501084_0002045 3300054114 Bacteria 16117
429 Ga0501084_0003948 3300054114 Bacteria 12083
430 Ga0501084_0022073 3300054114 Bacteria 5309
431 Ga0501084_0044872 3300054114 Bacteria 3701
432 Ga0501084_0045607 3300054114 Bacteria 3670
433 Ga0501084_0054638 3300054114 Bacteria 3341
434 Ga0501084_0062184 3300054114 Bacteria 3125
435 Ga0501084_0117534 3300054114 Bacteria 2236
436 Ga0501084_0288481 3300054114 Bacteria 1386
437 Ga0501082_0005255 3300060353 Bacteria 11254
438 Ga0501082_0011159 3300060353 Bacteria 7723
439 Ga0501082_0019918 3300060353 Bacteria 5782
440 Ga0501082_0024243 3300060353 Bacteria 5230
441 Ga0501082_0027779 3300060353 Bacteria 4872
442 Ga0501082_0051970 3300060353 Bacteria 3532
443 Ga0501082_0154148 3300060353 Bacteria 1996
444 Ga0501082_0292363 3300060353 Bacteria 1418
445 Ga0501082_0361854 3300060353 Bacteria 1265
446 Ga0530510_0000001 3300061734 Bacteria 285623
447 Ga0530510_0001055 3300061734 Bacteria 18266
448 Ga0530510_0016400 3300061734 Bacteria 5243
449 Ga0530510_0039061 3300061734 Bacteria 3426
450 Ga0530510_0083684 3300061734 Bacteria 2323
451 Ga0530510_0237549 3300061734 Bacteria 1356
452 Ga0436362_1282927
453 JGI25406J46586_10029364
454 Ga0065707_10156245
455 Ga0070680_100026404
456 Ga0070680_100093157
457 Ga0070680_100272993
458 Ga0070687_100088517
459 Ga0070692_10018781
460 Ga0070668_100101529
461 Ga0070669_100111317
462 Ga0070667_100180470
463 Ga0070703_10011539
464 Ga0070701_10001288
465 Ga0070705_100007533
466 Ga0070705_100032780
467 Ga0070705_100218640
468 Ga0070694_100026831
469 Ga0070694_100102494
470 Ga0070708_100008507
471 Ga0070708_100023372
472 Ga0070708_100076469
473 Ga0070708_100091913
474 Ga0070708_100105657
475 Ga0070662_100121084
476 Ga0070706_100022726
477 Ga0070706_100073814
478 Ga0070706_100086832
479 Ga0070706_100229149
480 Ga0070707_100020011
481 Ga0070707_100056870
482 Ga0070698_100025779
483 Ga0070698_100120132
484 Ga0070698_100214230
485 Ga0070699_100004968
486 Ga0070699_100005082
487 Ga0070699_100095626
488 Ga0070699_100284339
489 Ga0070699_100338302
490 Ga0070697_100018013
491 Ga0070697_100023533
492 Ga0070697_100093580
493 Ga0070695_100002058
494 Ga0070695_100007595
495 Ga0070696_100013092
496 Ga0070696_100022777
497 Ga0070704_100077525
498 Ga0070704_100359219
499 Ga0068859_100112825
500 Ga0068866_10138202
501 Ga0068858_100241072
502 Ga0068862_100050828
503 Ga0068862_100121292
504 Ga0081539_10000035
505 Ga0075428_100001055
506 Ga0075428_100004726
507 Ga0075428_100036220
508 Ga0075428_100065016
509 Ga0075428_100083527
510 Ga0075428_100572597
511 Ga0075430_100000188
512 Ga0075430_100000330
513 Ga0075430_100024831
514 Ga0075430_100031632
515 Ga0075431_100000322
516 Ga0075431_100000570
517 Ga0075431_100008332
518 Ga0075431_100008578
519 Ga0075431_100019087
520 Ga0075431_100027163
521 Ga0075431_100037896
522 Ga0075431_100043338
523 Ga0075431_100061034
524 Ga0075431_100069873
525 Ga0075431_100081701
526 Ga0075431_100156694
527 Ga0075431_100160599
528 Ga0075431_100596455
529 Ga0075433_10000406
530 Ga0075433_10006552
531 Ga0075433_10021606
532 Ga0075433_10028744
533 Ga0075433_10082504
534 Ga0075433_10151779
535 Ga0075433_10221745
536 Ga0075434_100010044
537 Ga0075434_100061061
538 Ga0075434_100066839
539 Ga0075434_100104981
540 Ga0075434_100166230
541 Ga0075434_100491207
542 Ga0075429_100002860
543 Ga0075429_100003632
544 Ga0075429_100005550
545 Ga0075429_100006020
546 Ga0075429_100006460
547 Ga0075429_100016424
548 Ga0075429_100030867
549 Ga0075429_100053876
550 Ga0075429_100100232
551 Ga0075429_100131670
552 Ga0075436_100013994
553 Ga0075436_100028671
554 Ga0097620_100112823
555 Ga0075435_100037814
556 Ga0075435_100120243
557 Ga0075435_100304397
558 Ga0099794_10008397
559 Ga0099794_10016433
560 Ga0099794_10032531
561 Ga0099794_10042542
562 Ga0111539_10014047
563 Ga0111539_10068109
564 Ga0111539_10102568
565 Ga0114129_10001217
566 Ga0114129_10001399
567 Ga0114129_10001436
568 Ga0114129_10002676
569 Ga0114129_10005852
570 Ga0114129_10017479
571 Ga0114129_10041581
572 Ga0114129_10062345
573 Ga0114129_10068962
574 Ga0114129_10118036
575 Ga0114129_10118048
576 Ga0114129_10118887
577 Ga0114129_10399929
578 Ga0114129_10481688
579 Ga0114129_10574638
580 Ga0114129_10641714
581 Ga0114129_10893099
582 Ga0105243_10063287
583 Ga0105243_10123932
584 Ga0105242_10116601
585 Ga0105249_10041176
586 Ga0157378_10044198
587 Ga0157378_10083271
588 Ga0163162_10163568
589 Ga0157375_10040399
590 Ga0157380_10166712
591 Ga0197907_11397824
592 Ga0206350_10811595
593 Ga0207653_10014073
594 Ga0207645_10158147
595 Ga0207684_10004367
596 Ga0207684_10007601
597 Ga0207684_10028169
598 Ga0207684_10038842
599 Ga0207684_10045243
600 Ga0207654_10023089
601 Ga0207671_10082798
602 Ga0207660_10022310
603 Ga0207660_10231022
604 Ga0207646_10003284
605 Ga0207646_10003689
606 Ga0207646_10004503
607 Ga0207646_10005081
608 Ga0207646_10157322
609 Ga0207646_10179095
610 Ga0207706_10075168
611 Ga0207686_10004031
612 Ga0207709_10019977
613 Ga0207709_10055534
614 Ga0207689_10005849
615 Ga0207689_10018617
616 Ga0207689_10064183
617 Ga0207712_10042381
618 Ga0207712_10044862
619 Ga0207712_10137321
620 Ga0207668_10136146
621 Ga0207641_10109268
622 Ga0207648_10184528
623 Ga0207675_100018700
624 Ga0207675_100352786
625 Ga0207428_10000027
626 Ga0207428_10031033
627 Ga0207428_10050425
628 Ga0207428_10150510
629 Ga0268265_10016479
630 Ga0268264_10052543
631 Ga0265765_1002371
632 Ga0307408_100023325
633 Ga0307408_100066095
634 Ga0307407_10143778
635 Ga0307412_10166188
636 Ga0307416_100033535
637 Ga0307411_10048063
638 Ga0307411_10126110
639 Ga0307415_100107981
640 Ga0307415_100335330
641 Ga0373940_0004762
642 Ga0373949_0018259
643 Ga0373949_0031272
644 Ga0373932_0006202
645 Ga0373939_0017437
646 Ga0373962_0014716
647 Ga0373931_0014054
648 Ga0373931_0014150
649 Ga0395900_0135931
650 Ga0395898_0052136
651 Ga0395901_0003453
652 Ga0436361_1163489
653 Ga0439441_001767
654 Ga0439456_017773
655 Ga0439464_0007909
656 Ga0439460_0000628
657 Ga0451577_0020543
658 Ga0451577_0121779
659 Ga0453683_0038305
660 Ga0451576_0079619
661 Ga0451576_0084375
662 Ga0451576_0815300
663 Ga0495580_0005955
664 Ga0495659_0065595
665 Ga0495669_0045255
666 Ga0495670_0046671
667 Ga0495604_0029682
668 Ga0495636_0029933
669 Ga0495636_0177278
670 Ga0495675_0093197
671 Ga0496102_0003375
672 Ga0501031_0060387
673 Ga0501031_0071835
674 Ga0501032_0045423
675 Ga0501032_0283052
676 Ga0501033_0011346
677 Ga0501033_0095792
678 Ga0501033_0108192
679 Ga0501034_0007680
680 Ga0501036_0000918
681 Ga0501036_0001392
682 Ga0501036_0076760
683 Ga0501036_0242558
684 Ga0501037_0001911
685 Ga0501038_0000219
686 Ga0501038_0006106
687 Ga0501038_0087138
688 Ga0501039_0001944
689 Ga0501039_0039523
690 Ga0501039_0061439
691 Ga0501039_0121944
692 Ga0501039_0169436
693 Ga0501040_0000216
694 Ga0501040_0001536
695 Ga0501040_0013617
696 Ga0501040_0013743
697 Ga0501040_0052804
698 Ga0501040_0059848
699 Ga0501040_0073963
700 Ga0501040_0080308
701 Ga0501040_0082364
702 Ga0501040_0127517
703 Ga0501040_0145725
704 Ga0501040_0238467
705 Ga0501041_0000742
706 Ga0501041_0004676
707 Ga0501041_0047430
708 Ga0501041_0081497
709 Ga0501042_0000279
710 Ga0501042_0010221
711 Ga0501042_0031455
712 Ga0501042_0142074
713 Ga0501042_0224792
714 Ga0501042_0261603
715 Ga0501043_0293235
716 Ga0501046_0000375
717 Ga0501046_0002294
718 Ga0501046_0065722
719 Ga0501046_0216727
720 Ga0501048_0001335
721 Ga0501048_0018364
722 Ga0501048_0024806
723 Ga0501048_0070110
724 Ga0501048_0082311
725 Ga0501048_0274406
726 Ga0501067_0115093
727 Ga0501068_0007197
728 Ga0501068_0015258
729 Ga0501069_0010118
730 Ga0501069_0090633
731 Ga0501070_0005598
732 Ga0501070_0026072
733 Ga0501071_0021871
734 Ga0501071_0021942
735 Ga0501071_0022653
736 Ga0501071_0026737
737 Ga0501072_0009091
738 Ga0501072_0012147
739 Ga0501072_0045461
740 Ga0501072_0057127
741 Ga0501072_0062839
742 Ga0501072_0065761
743 Ga0501072_0090780
744 Ga0501072_0107179
745 Ga0501072_0153733
746 Ga0501072_0154875
747 Ga0501072_0209612
748 Ga0501073_0012187
749 Ga0501074_0000294
750 Ga0501074_0000624
751 Ga0501074_0045528
752 Ga0501074_0069890
753 Ga0501075_0000047
754 Ga0501075_0000660
755 Ga0501075_0020778
756 Ga0501075_0041009
757 Ga0501075_0049645
758 Ga0501075_0052124
759 Ga0501075_0097935
760 Ga0501075_0155502
761 Ga0501075_0166582
762 Ga0501075_0176127
763 Ga0501075_0249926
764 Ga0501075_0385421
765 Ga0501076_0000006
766 Ga0501076_0007649
767 Ga0501076_0025644
768 Ga0501076_0031829
769 Ga0501076_0046013
770 Ga0501076_0053914
771 Ga0501076_0120530
772 Ga0501077_0000555
773 Ga0501077_0003051
774 Ga0501077_0009437
775 Ga0501077_0014499
776 Ga0501077_0072973
777 Ga0501077_0092682
778 Ga0501077_0128099
779 Ga0501077_0247983
780 Ga0501077_0267672
781 Ga0501079_0000675
782 Ga0501079_0003130
783 Ga0501079_0004537
784 Ga0501079_0011302
785 Ga0501079_0019583
786 Ga0501079_0025751
787 Ga0501079_0055370
788 Ga0501079_0074546
789 Ga0501079_0101046
790 Ga0501079_0170950
791 Ga0501079_0234979
792 Ga0501080_0000751
793 Ga0501080_0014894
794 Ga0501080_0015046
795 Ga0501080_0072679
796 Ga0501080_0171499
797 Ga0501080_0282974
798 Ga0501080_0345422
799 Ga0501080_0393439
800 Ga0501081_0000887
801 Ga0501081_0001968
802 Ga0501081_0003201
803 Ga0501081_0005541
804 Ga0501081_0027830
805 Ga0501081_0033276
806 Ga0501081_0063605
807 Ga0501081_0129172
808 Ga0501081_0141039
809 Ga0501083_0002540
810 Ga0501083_0022299
811 Ga0501083_0061880
812 Ga0501083_0104119
813 Ga0501035_0000558
814 Ga0501035_0018822
815 Ga0501035_0089447
816 Ga0501035_0267985
817 Ga0501045_0006802
818 Ga0501045_0010185
819 Ga0501045_0044836
820 Ga0501045_0222601
821 Ga0501045_0223957
822 nmdc:mga05p37_121573_c1
823 nmdc:mga05p37_1423_c1
824 nmdc:mga05p37_14836_c1
825 nmdc:mga05p37_1590_c1
826 nmdc:mga05p37_19578_c1
827 nmdc:mga05p37_203112_c1
828 nmdc:mga05p37_31073_c2
829 nmdc:mga05p37_437_c1
830 nmdc:mga05p37_498697_c1
831 nmdc:mga05p37_65288_c1
832 nmdc:mga05p37_72273_c1
833 nmdc:mga05p37_7542_c1
834 nmdc:mga05p37_79676_c1
835 nmdc:mga05p37_80608_c1
836 nmdc:mga05p37_82571_c1
837 nmdc:mga05p37_996_c1
838 nmdc:mga09592_2318_c1
839 nmdc:mga09592_35462_c1
840 nmdc:mga09592_39411_c1
841 nmdc:mga09592_5430_c1
842 nmdc:mga09592_56500_c1
843 nmdc:mga09592_6466_c1
844 nmdc:mga09592_75416_c1
845 nmdc:mga09592_82869_c1
846 nmdc:mga0qj67_140_c1
847 nmdc:mga0qj67_24649_c1
848 nmdc:mga0qj67_4886_c1
849 nmdc:mga0qj67_54217_c1
850 nmdc:mga06r32_1165_c1
851 nmdc:mga06r32_132407_c1
852 nmdc:mga06r32_45296_c1
853 nmdc:mga06r32_56986_c1
854 nmdc:mga06r32_6381_c1
855 nmdc:mga06r32_6726_c1
856 nmdc:mga06r32_9032_c1
857 nmdc:mga06r32_99866_c1
858 nmdc:mga08y16_2666_c1
859 nmdc:mga08y16_28701_c1
860 nmdc:mga0n895_12050_c1
861 nmdc:mga0n895_136488_c1
862 nmdc:mga0n895_407741_c1
863 nmdc:mga0n895_44945_c1
864 nmdc:mga0n895_463803_c1
865 nmdc:mga0rr50_103641_c1
866 nmdc:mga0rr50_13154_c1
867 nmdc:mga0rr50_27806_c1
868 nmdc:mga0rr50_39319_c1
869 nmdc:mga0rr50_58773_c1
870 nmdc:mga08x19_657_c1
871 nmdc:mga0a205_106918_c1
872 nmdc:mga0a205_254381_c1
873 nmdc:mga0a205_289_c1
874 nmdc:mga0a205_43410_c1
875 nmdc:mga0a205_50397_c1
876 nmdc:mga0a205_6551_c1
877 nmdc:mga0a205_76157_c1
878 nmdc:mga0a205_90149_c1
879 Ga0501084_0002045
880 Ga0501084_0003948
881 Ga0501084_0022073
882 Ga0501084_0044872
883 Ga0501084_0045607
884 Ga0501084_0054638
885 Ga0501084_0062184
886 Ga0501084_0117534
887 Ga0501084_0288481
888 Ga0501082_0005255
889 Ga0501082_0011159
890 Ga0501082_0019918
891 Ga0501082_0024243
892 Ga0501082_0027779
893 Ga0501082_0051970
894 Ga0501082_0154148
895 Ga0501082_0292363
896 Ga0501082_0361854
897 Ga0530510_0000001
898 Ga0530510_0001055
899 Ga0530510_0016400
900 Ga0530510_0039061
901 Ga0530510_0083684
902 Ga0530510_0237549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00676

E1_dh

Dehydrogenase E1 component

27

325

0.98

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

110

249

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exh-assembly2.cif.gz_E crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9587 15 336
6cer-assembly2.cif.gz_G human pyruvate dehydrogenase complex e1 component v138m mutation 0.9566 15 336
3exi-assembly1.cif.gz_A-2 crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (sbd) of e2p, but sbd cannot be modeled into the electron density 0.9566 15 336
3exh-assembly2.cif.gz_G crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9559 15 335
3exe-assembly2.cif.gz_E crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9527 15 335
ID Description Score Start End Superfamily
af_A0A1D6GTY5_25_137_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9595 129 242 3.40.50.970
af_I1N1B9_20_344_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9507 19 302 3.40.50.970
af_B4FGJ4_23_381_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9503 19 335 3.40.50.970
af_I1KAH2_90_485_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9471 15 332 3.40.50.970
af_A4HY08_15_377_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9421 15 335 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7V5CX94-F1-model_v4 Pyruvate dehydrogenase (Acetyl-transferring) E1 component subunit alpha 0.9859 15 232 GO:0004739
GO:0006086
AF-A0A7C1RC44-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.9838 15 224 GO:0004739
GO:0006086
AF-A0A6I2Y6T4-F1-model_v4 Dehydrogenase E1 component domain-containing protein 0.9819 29 228 GO:0000287
GO:0004739
GO:0006086
AF-A0A2V7HHY4-F1-model_v4 Pyruvate dehydrogenase (Acetyl-transferring) E1 component subunit alpha 0.9812 28 163 GO:0004739
GO:0006086
AF-A0A1G2WH57-F1-model_v4 Pyruvate dehydrogenase E1 component subunit alpha (EC 1.2.4.1) 0.9806 15 309 GO:0004739
GO:0006086
GO:0043231

Map