F446787

General Info

Members Datasets Scaffolds Average Seq Length
451 270 902 279

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10340981|Ga0157370_103409812
Length 279
Sequence VTVEIVSENRSHGGRQLVVRHASSATSTGMNFSIFLPSQAEDGGRLPVVWFLSGLTCSPMNVTEKGEYRAACAELGLIFVAPDTSPRGDDVPDDENYDFGKGAGFYVDATQLPWSNHYRMCSYVTEELPALVAAEFPIDMGRQAITGHSMGGHGALTVALRNAGRFRSVSAFSPIVAPSQVSWGQKALGGYLGDNRDAWRKHDAVALIEDGARVPEILVDVGTQDQFLDQQLRPDLLEKACADAGIALTLRRQPGYDHSYYFVSTFMADHLRWHADRLA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
197 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
198 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
199 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
200 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
213 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
214 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
215 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
216 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
217 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
218 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
219 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
232 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
244 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
245 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
246 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
247 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
248 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
249 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
250 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
251 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
252 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
253 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
254 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
255 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
256 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
257 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
258 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
259 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
260 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
261 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
262 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
263 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
264 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
265 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
266 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
267 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
268 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
269 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
270 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 0
Isolates 5.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 2.88
Rhizoplane 1.55
Rhizosphere 79.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10340981 3300013104 Bacteria 1381
2 JGI24741J21665_1000025 3300001915 Bacteria 35709
3 JGI24740J21852_10000650 3300001979 Bacteria 15011
4 JGI24737J22298_10000063 3300001990 Bacteria 31330
5 JGI24737J22298_10000861 3300001990 Bacteria 10817
6 JGI24737J22298_10001839 3300001990 Bacteria 7588
7 JGI25160J50197_1000641 3300003354 Bacteria 19480
8 JGI25160J50197_1011488 3300003354 Bacteria 3137
9 Ga0055539_1002424 3300003752 Bacteria 2866
10 Ga0055542_1005439 3300003762 Bacteria 2879
11 Ga0055543_1001343 3300004625 Bacteria 9974
12 Ga0065165_1002233 3300005262 Bacteria 17217
13 Ga0070658_10002747 3300005327 Bacteria 14651
14 Ga0070658_10079803 3300005327 Bacteria 2687
15 Ga0070683_100027764 3300005329 Bacteria 5107
16 Ga0070683_100071758 3300005329 Bacteria 3231
17 Ga0070670_100007466 3300005331 Bacteria 9283
18 Ga0070670_100027054 3300005331 Bacteria 4933
19 Ga0070670_100188390 3300005331 Bacteria 1792
20 Ga0068869_100113394 3300005334 Bacteria 2065
21 Ga0070680_100053058 3300005336 Bacteria 3309
22 Ga0070660_100068653 3300005339 Bacteria 2763
23 Ga0070660_100212989 3300005339 Bacteria 1569
24 Ga0070689_100199745 3300005340 Bacteria 1632
25 Ga0070661_100002866 3300005344 Bacteria 11847
26 Ga0070661_100035742 3300005344 Bacteria 3610
27 Ga0070669_100027578 3300005353 Bacteria 4088
28 Ga0070669_100306593 3300005353 Bacteria 1278
29 Ga0070675_100006955 3300005354 Bacteria 8691
30 Ga0070675_100308116 3300005354 Bacteria 1396
31 Ga0070671_100074776 3300005355 Bacteria 2830
32 Ga0070671_100091331 3300005355 Bacteria 2550
33 Ga0070671_100166455 3300005355 Bacteria 1864
34 Ga0070673_100018865 3300005364 Bacteria 4943
35 Ga0070659_100014363 3300005366 Bacteria 5917
36 Ga0070659_100057706 3300005366 Bacteria 3062
37 Ga0070659_100102455 3300005366 Bacteria 2305
38 Ga0070659_100177859 3300005366 Bacteria 1745
39 Ga0070659_100264581 3300005366 Bacteria 1427
40 Ga0070667_100001364 3300005367 Bacteria 21900
41 Ga0070667_100016169 3300005367 Bacteria 6173
42 Ga0070663_100140946 3300005455 Bacteria 1841
43 Ga0070662_100004215 3300005457 Bacteria 9058
44 Ga0070662_100202989 3300005457 Bacteria 1574
45 Ga0070662_100628507 3300005457 Bacteria 905
46 Ga0070681_10117077 3300005458 Bacteria 2601
47 Ga0070679_100145043 3300005530 Bacteria 2352
48 Ga0070684_100017376 3300005535 Bacteria 5902
49 Ga0068853_100067272 3300005539 Bacteria 3112
50 Ga0070672_100091227 3300005543 Bacteria 2458
51 Ga0070665_100000169 3300005548 Bacteria 118043
52 Ga0070665_100001642 3300005548 Bacteria 25770
53 Ga0068855_100129582 3300005563 Bacteria 2882
54 Ga0068855_100141756 3300005563 Bacteria 2739
55 Ga0068855_100281840 3300005563 Bacteria 1845
56 Ga0070664_100076665 3300005564 Bacteria 2873
57 Ga0068857_100019893 3300005577 Bacteria 5901
58 Ga0068857_100071094 3300005577 Bacteria 3100
59 Ga0068857_100129856 3300005577 Bacteria 2272
60 Ga0068854_100184730 3300005578 Bacteria 1630
61 Ga0068856_100630573 3300005614 Bacteria 1093
62 Ga0068852_100583440 3300005616 Bacteria 1121
63 Ga0068859_100000117 3300005617 Bacteria 75377
64 Ga0068859_100041822 3300005617 Bacteria 4603
65 Ga0068859_100330902 3300005617 Bacteria 1617
66 Ga0068864_100000161 3300005618 Bacteria 62543
67 Ga0068864_100272169 3300005618 Bacteria 1578
68 Ga0068851_10002607 3300005834 Bacteria 7947
69 Ga0068863_100000883 3300005841 Bacteria 30162
70 Ga0068863_100013097 3300005841 Bacteria 8001
71 Ga0068863_100018572 3300005841 Bacteria 6654
72 Ga0068858_100000063 3300005842 Bacteria 111811
73 Ga0068858_100038387 3300005842 Bacteria 4441
74 Ga0068860_100003162 3300005843 Bacteria 16997
75 Ga0068862_100005226 3300005844 Bacteria 10895
76 Ga0081538_10031964 3300005981 Bacteria 3538
77 Ga0075367_10045497 3300006178 Bacteria 2575
78 Ga0075369_10026708 3300006186 Bacteria 2408
79 Ga0075366_10128883 3300006195 Bacteria 1526
80 Ga0075428_100027569 3300006844 Bacteria 6284
81 Ga0075434_100224632 3300006871 Bacteria 1897
82 Ga0097620_100000117 3300006931 Bacteria 75377
83 Ga0097620_100041825 3300006931 Bacteria 4603
84 Ga0097620_100330894 3300006931 Bacteria 1617
85 Ga0105251_10029461 3300009011 Bacteria 2765
86 Ga0105240_10010877 3300009093 Bacteria 12744
87 Ga0105240_10031204 3300009093 Bacteria 6914
88 Ga0114129_10114319 3300009147 Bacteria 3721
89 Ga0114129_10303713 3300009147 Bacteria 2126
90 Ga0105241_10002431 3300009174 Bacteria 13973
91 Ga0105241_10452712 3300009174 Bacteria 1136
92 Ga0105248_10000496 3300009177 Bacteria 44725
93 Ga0105248_10015959 3300009177 Bacteria 8271
94 Ga0105237_10032763 3300009545 Bacteria 5262
95 Ga0105249_10020120 3300009553 Bacteria 5962
96 Ga0105249_10779494 3300009553 Bacteria 1019
97 Ga0105239_10122171 3300010375 Bacteria 2893
98 Ga0105239_10259117 3300010375 Bacteria 1954
99 Ga0105246_10014149 3300011119 Bacteria 5013
100 Ga0157373_10068492 3300013100 Bacteria 2508
101 Ga0157373_10096606 3300013100 Bacteria 2080
102 Ga0157373_10363051 3300013100 Bacteria 1034
103 Ga0157371_10000347 3300013102 Bacteria 59480
104 Ga0157371_10025597 3300013102 Bacteria 4298
105 Ga0157370_10004337 3300013104 Bacteria 16294
106 Ga0157369_10034341 3300013105 Bacteria 5567
107 Ga0157369_10072906 3300013105 Bacteria 3684
108 Ga0157369_10100562 3300013105 Bacteria 3082
109 Ga0157374_10183803 3300013296 Bacteria 2043
110 Ga0163162_10232297 3300013306 Bacteria 1975
111 Ga0163162_10379422 3300013306 Bacteria 1547
112 Ga0157372_10081556 3300013307 Bacteria 3662
113 Ga0157372_10362665 3300013307 Bacteria 1688
114 Ga0157375_10129548 3300013308 Bacteria 2641
115 Ga0157375_10149335 3300013308 Bacteria 2471
116 Ga0163163_10001219 3300014325 Bacteria 21747
117 Ga0163163_10089115 3300014325 Bacteria 3097
118 Ga0157379_10051498 3300014968 Bacteria 3678
119 Ga0157379_10566106 3300014968 Bacteria 1058
120 Ga0163161_10235126 3300017792 Bacteria 1423
121 Ga0209563_102208 3300025230 Bacteria 4524
122 Ga0209677_104041 3300025253 Bacteria 4413
123 Ga0209148_1000319 3300025254 Bacteria 67129
124 Ga0209233_1015890 3300025261 Bacteria 2085
125 Ga0209455_1000782 3300025272 Bacteria 17766
126 Ga0209758_1024352 3300025297 Bacteria 2700
127 Ga0209758_1047662 3300025297 Bacteria 1531
128 Ga0207426_1000624 3300025302 Bacteria 44994
129 Ga0207426_1009872 3300025302 Bacteria 3741
130 Ga0207697_10017851 3300025315 Bacteria 2913
131 Ga0207656_10008341 3300025321 Bacteria 3810
132 Ga0207688_10199421 3300025901 Bacteria 1199
133 Ga0207680_10062861 3300025903 Bacteria 2270
134 Ga0207647_10023937 3300025904 Bacteria 4033
135 Ga0207647_10024227 3300025904 Bacteria 4003
136 Ga0207647_10097111 3300025904 Bacteria 1752
137 Ga0207647_10225982 3300025904 Bacteria 1078
138 Ga0207705_10000282 3300025909 Bacteria 48349
139 Ga0207705_10063674 3300025909 Bacteria 2664
140 Ga0207705_10109204 3300025909 Bacteria 2042
141 Ga0207705_10240977 3300025909 Bacteria 1377
142 Ga0207654_10000328 3300025911 Bacteria 28514
143 Ga0207695_10000240 3300025913 Bacteria 143196
144 Ga0207695_10001715 3300025913 Bacteria 35105
145 Ga0207695_10215923 3300025913 Bacteria 1827
146 Ga0207671_10022310 3300025914 Bacteria 4787
147 Ga0207660_10065262 3300025917 Bacteria 2630
148 Ga0207660_10109454 3300025917 Bacteria 2077
149 Ga0207660_10110112 3300025917 Bacteria 2071
150 Ga0207660_10206055 3300025917 Bacteria 1538
151 Ga0207657_10003241 3300025919 Bacteria 17421
152 Ga0207657_10013513 3300025919 Bacteria 8007
153 Ga0207657_10019671 3300025919 Bacteria 6402
154 Ga0207657_10101092 3300025919 Bacteria 2393
155 Ga0207657_10187061 3300025919 Bacteria 1672
156 Ga0207657_10216470 3300025919 Bacteria 1536
157 Ga0207649_10004003 3300025920 Bacteria 8028
158 Ga0207649_10035370 3300025920 Bacteria 3001
159 Ga0207649_10115577 3300025920 Bacteria 1800
160 Ga0207652_10277742 3300025921 Bacteria 1511
161 Ga0207652_10412341 3300025921 Bacteria 1218
162 Ga0207681_10003282 3300025923 Bacteria 10128
163 Ga0207681_10007952 3300025923 Bacteria 6483
164 Ga0207681_10041226 3300025923 Bacteria 3077
165 Ga0207681_10071831 3300025923 Bacteria 2415
166 Ga0207650_10039165 3300025925 Bacteria 3463
167 Ga0207650_10205632 3300025925 Bacteria 1579
168 Ga0207659_10012273 3300025926 Bacteria 5444
169 Ga0207659_10040023 3300025926 Bacteria 3274
170 Ga0207644_10022447 3300025931 Bacteria 4312
171 Ga0207644_10370803 3300025931 Bacteria 1166
172 Ga0207690_10001188 3300025932 Bacteria 16448
173 Ga0207690_10055314 3300025932 Bacteria 2672
174 Ga0207690_10378713 3300025932 Bacteria 1124
175 Ga0207706_10001335 3300025933 Bacteria 24697
176 Ga0207706_10014457 3300025933 Bacteria 7153
177 Ga0207706_10178442 3300025933 Bacteria 1865
178 Ga0207669_10124378 3300025937 Bacteria 1758
179 Ga0207691_10066468 3300025940 Bacteria 3262
180 Ga0207711_10000039 3300025941 Bacteria 162974
181 Ga0207689_10032664 3300025942 Bacteria 4327
182 Ga0207661_10040825 3300025944 Bacteria 3650
183 Ga0207661_10042950 3300025944 Bacteria 3566
184 Ga0207661_10105269 3300025944 Bacteria 2377
185 Ga0207679_10011378 3300025945 Bacteria 5759
186 Ga0207679_10041771 3300025945 Bacteria 3291
187 Ga0207679_10455169 3300025945 Bacteria 1136
188 Ga0207679_10534413 3300025945 Bacteria 1050
189 Ga0207667_10000004 3300025949 Bacteria 737718
190 Ga0207667_10041119 3300025949 Bacteria 4918
191 Ga0207667_10439279 3300025949 Bacteria 1327
192 Ga0207651_10009840 3300025960 Bacteria 5262
193 Ga0207651_10198813 3300025960 Bacteria 1605
194 Ga0207712_10012992 3300025961 Bacteria 5333
195 Ga0207712_10394637 3300025961 Bacteria 1161
196 Ga0207640_10000360 3300025981 Bacteria 29534
197 Ga0207658_10001295 3300025986 Bacteria 19787
198 Ga0207658_10041826 3300025986 Bacteria 3320
199 Ga0207703_10001636 3300026035 Bacteria 20188
200 Ga0207639_10000283 3300026041 Bacteria 36325
201 Ga0207639_10069763 3300026041 Bacteria 2743
202 Ga0207678_10001345 3300026067 Bacteria 22642
203 Ga0207678_10008745 3300026067 Bacteria 8913
204 Ga0207678_10352026 3300026067 Bacteria 1270
205 Ga0207702_10613620 3300026078 Bacteria 1068
206 Ga0207641_10000185 3300026088 Bacteria 86885
207 Ga0207641_10006863 3300026088 Bacteria 9527
208 Ga0207641_10045312 3300026088 Bacteria 3703
209 Ga0207676_10000985 3300026095 Bacteria 21917
210 Ga0207676_10257197 3300026095 Bacteria 1574
211 Ga0207676_10549877 3300026095 Bacteria 1103
212 Ga0207674_10000616 3300026116 Bacteria 46742
213 Ga0207674_10003237 3300026116 Bacteria 20044
214 Ga0207674_10010717 3300026116 Bacteria 10351
215 Ga0207674_10138036 3300026116 Bacteria 2399
216 Ga0207674_10238936 3300026116 Bacteria 1764
217 Ga0207675_100342195 3300026118 Bacteria 1464
218 Ga0207698_10017036 3300026142 Bacteria 4919
219 Ga0207698_10068787 3300026142 Bacteria 2797
220 Ga0207698_10133508 3300026142 Bacteria 2125
221 Ga0268266_10000256 3300028379 Bacteria 89436
222 Ga0268266_10003322 3300028379 Bacteria 16142
223 Ga0268266_10024332 3300028379 Bacteria 5152
224 Ga0268265_10085580 3300028380 Bacteria 2502
225 Ga0268265_10152191 3300028380 Bacteria 1952
226 Ga0268265_10417725 3300028380 Bacteria 1244
227 Ga0268264_10001136 3300028381 Bacteria 26086
228 Ga0268264_10018249 3300028381 Bacteria 5738
229 Ga0307513_10441880 3300031456 Bacteria 1027
230 Ga0307408_100111021 3300031548 Bacteria 2106
231 Ga0307408_100178041 3300031548 Bacteria 1703
232 Ga0307413_10007203 3300031824 Bacteria 5145
233 Ga0307413_10051316 3300031824 Bacteria 2485
234 Ga0307410_10001652 3300031852 Bacteria 10265
235 Ga0307410_10197115 3300031852 Bacteria 1535
236 Ga0307410_10226741 3300031852 Bacteria 1440
237 Ga0307412_10088076 3300031911 Bacteria 2165
238 Ga0307409_100009153 3300031995 Bacteria 6069
239 Ga0307409_100071662 3300031995 Bacteria 2756
240 Ga0307409_100107350 3300031995 Bacteria 2332
241 Ga0307414_10036070 3300032004 Bacteria 3297
242 Ga0307414_10660366 3300032004 Bacteria 943
243 Ga0307411_10006983 3300032005 Bacteria 5702
244 Ga0307411_10031755 3300032005 Bacteria 3254
245 Ga0307411_10063223 3300032005 Bacteria 2473
246 Ga0307411_10066250 3300032005 Bacteria 2426
247 Ga0307415_100408595 3300032126 Bacteria 1161
248 Ga0307510_10003003 3300033180 Bacteria 19416
249 Ga0307510_10094132 3300033180 Bacteria 2823
250 Ga0373946_0247625 3300035171 Bacteria 868
251 Ga0373927_0027923 3300035695 Bacteria 3683
252 Ga0373947_0035762 3300035725 Bacteria 2942
253 Ga0395899_0147724 3300037312 Bacteria 1668
254 Ga0395899_0174655 3300037312 Bacteria 1511
255 Ga0395899_0273895 3300037312 Bacteria 1150
256 Ga0395900_0017500 3300037418 Bacteria 7314
257 Ga0395900_0018188 3300037418 Bacteria 7169
258 Ga0395900_0030722 3300037418 Bacteria 5516
259 Ga0395900_0045785 3300037418 Bacteria 4506
260 Ga0395900_0177571 3300037418 Bacteria 2165
261 Ga0395900_0254484 3300037418 Bacteria 1756
262 Ga0395900_0262888 3300037418 Bacteria 1722
263 Ga0395900_0521173 3300037418 Bacteria 1136
264 Ga0395898_0060469 3300037466 Bacteria 3682
265 Ga0395898_0077264 3300037466 Bacteria 3214
266 Ga0395898_0382915 3300037466 Bacteria 1341
267 Ga0395898_0399950 3300037466 Bacteria 1310
268 Ga0395898_0447997 3300037466 Bacteria 1230
269 Ga0395898_0489907 3300037466 Bacteria 1169
270 Ga0395898_0612037 3300037466 Bacteria 1032
271 Ga0395905_0001314 3300037471 Bacteria 30557
272 Ga0395905_0003071 3300037471 Bacteria 18069
273 Ga0395905_0009149 3300037471 Bacteria 9704
274 Ga0395905_0028336 3300037471 Bacteria 5279
275 Ga0395905_0035828 3300037471 Bacteria 4660
276 Ga0395905_0059074 3300037471 Bacteria 3585
277 Ga0395905_0106004 3300037471 Bacteria 2639
278 Ga0395905_0214173 3300037471 Bacteria 1804
279 Ga0395905_0220632 3300037471 Bacteria 1774
280 Ga0395905_0267761 3300037471 Bacteria 1594
281 Ga0436364_0767650 3300037853 Bacteria 28654
282 Ga0395901_0008844 3300038443 Bacteria 10194
283 Ga0395901_0019330 3300038443 Bacteria 6964
284 Ga0395901_0020625 3300038443 Bacteria 6745
285 Ga0395901_0052785 3300038443 Bacteria 4225
286 Ga0395901_0093469 3300038443 Bacteria 3149
287 Ga0395901_0108974 3300038443 Bacteria 2907
288 Ga0395901_0147476 3300038443 Bacteria 2472
289 Ga0395901_0165418 3300038443 Bacteria 2323
290 Ga0395901_0254887 3300038443 Bacteria 1827
291 Ga0395901_0296345 3300038443 Bacteria 1677
292 Ga0395901_0303563 3300038443 Bacteria 1655
293 Ga0395901_0338098 3300038443 Bacteria 1555
294 Ga0395901_0431361 3300038443 Bacteria 1350
295 Ga0395901_0578892 3300038443 Bacteria 1134
296 Ga0439432_007361 3300042006 Bacteria 3901
297 Ga0466969_0045926 3300044656 Bacteria 2167
298 Ga0466966_0000021 3300044684 Bacteria 116714
299 Ga0466966_0003714 3300044684 Bacteria 10068
300 Ga0466961_0000016 3300044693 Bacteria 111421
301 Ga0466961_0054687 3300044693 Bacteria 2546
302 Ga0466961_0189823 3300044693 Bacteria 1274
303 Ga0466963_0049501 3300044694 Bacteria 2779
304 Ga0466968_0016898 3300044735 Bacteria 2909
305 Ga0466970_0096418 3300044765 Bacteria 1608
306 Ga0466957_0059975 3300044842 Bacteria 2333
307 Ga0466959_0037195 3300045049 Bacteria 3596
308 Ga0466959_0498220 3300045049 Bacteria 823
309 Ga0466958_0260933 3300045836 Bacteria 1109
310 Ga0466967_0028751 3300045976 Bacteria 4645
311 Ga0466967_0070882 3300045976 Bacteria 3119
312 Ga0466967_0378359 3300045976 Bacteria 1374
313 Ga0466967_0539345 3300045976 Bacteria 1147
314 Ga0495603_0138390 3300046455 Bacteria 1417
315 Ga0495629_0004696 3300046459 Bacteria 10236
316 Ga0495651_0051650 3300046462 Bacteria 3168
317 Ga0495650_0035931 3300046471 Bacteria 2175
318 Ga0495580_0145395 3300046472 Bacteria 1643
319 Ga0495585_0135080 3300046492 Bacteria 1295
320 Ga0495583_0030009 3300046506 Bacteria 2654
321 Ga0495606_0034082 3300046507 Bacteria 3500
322 Ga0495608_0090372 3300046511 Bacteria 1981
323 Ga0495632_0000038 3300046519 Bacteria 155743
324 Ga0495643_0168214 3300046522 Bacteria 1074
325 Ga0495643_0228797 3300046522 Bacteria 878
326 Ga0495663_0000013 3300046525 Bacteria 155493
327 Ga0495652_0029726 3300046529 Bacteria 4797
328 Ga0495598_0017015 3300046537 Bacteria 1867
329 Ga0495621_0012260 3300046539 Bacteria 2669
330 Ga0495622_0125922 3300046557 Bacteria 1168
331 Ga0495633_0015077 3300046558 Bacteria 4017
332 Ga0495634_0035314 3300046642 Bacteria 3425
333 Ga0495625_0192920 3300046660 Bacteria 1348
334 Ga0495635_0001601 3300046663 Bacteria 15230
335 Ga0495659_0020859 3300046664 Bacteria 2204
336 Ga0495588_0118817 3300046674 Bacteria 1393
337 Ga0495588_0225092 3300046674 Bacteria 990
338 Ga0495588_0312282 3300046674 Bacteria 827
339 Ga0495657_0013804 3300046675 Bacteria 5946
340 Ga0495646_0216349 3300046680 Bacteria 1038
341 Ga0495669_0003458 3300046684 Bacteria 6510
342 Ga0495669_0098644 3300046684 Bacteria 1355
343 Ga0495670_0002809 3300046691 Bacteria 8614
344 Ga0495671_0087645 3300046692 Bacteria 1524
345 Ga0495671_0229720 3300046692 Bacteria 897
346 Ga0495600_0003435 3300046809 Bacteria 9314
347 Ga0495604_0001069 3300047317 Bacteria 22717
348 Ga0495676_0135350 3300047321 Bacteria 1773
349 Ga0495686_0012456 3300047472 Bacteria 5947
350 Ga0495593_0065477 3300047673 Bacteria 1895
351 Ga0496104_0009238 3300048907 Bacteria 8766
352 Ga0496105_0000450 3300048908 Bacteria 27125
353 Ga0496109_0024353 3300048912 Bacteria 5381
354 Ga0496110_0016919 3300048913 Bacteria 6095
355 Ga0496111_0005571 3300048914 Bacteria 8093
356 Ga0496113_0411384 3300048916 Bacteria 1086
357 Ga0496115_0178580 3300048918 Bacteria 1755
358 Ga0496118_0062934 3300048921 Bacteria 2734
359 Ga0496119_0002327 3300048922 Bacteria 20938
360 Ga0496120_0036921 3300048923 Bacteria 2903
361 Ga0496121_0013471 3300048924 Bacteria 8779
362 Ga0496121_0038004 3300048924 Bacteria 4270
363 Ga0496121_0265349 3300048924 Bacteria 1183
364 Ga0496124_0142523 3300048927 Bacteria 1889
365 Ga0496124_0225427 3300048927 Bacteria 1406
366 Ga0496125_0000203 3300048928 Bacteria 125569
367 Ga0496125_0003518 3300048928 Bacteria 18902
368 Ga0496125_0003917 3300048928 Bacteria 17564
369 Ga0496125_0016801 3300048928 Bacteria 7014
370 Ga0496126_0001402 3300048929 Bacteria 38138
371 Ga0496126_0016269 3300048929 Bacteria 7444
372 Ga0496126_0114415 3300048929 Bacteria 2347
373 Ga0496126_0162264 3300048929 Bacteria 1909
374 Ga0496126_0383539 3300048929 Bacteria 1143
375 Ga0501290_000113 3300049513 Bacteria 12121
376 Ga0501292_000005 3300049515 Bacteria 147536
377 Ga0501294_000141 3300049517 Bacteria 8463
378 Ga0501297_008770 3300049520 Bacteria 1121
379 Ga0501300_000307 3300049523 Bacteria 7390
380 Ga0501031_0149783 3300049568 Bacteria 1524
381 Ga0501032_0101876 3300049569 Bacteria 1902
382 Ga0501038_0266000 3300049574 Bacteria 1353
383 Ga0501038_0344432 3300049574 Bacteria 1162
384 Ga0501041_0311940 3300049577 Bacteria 992
385 Ga0501043_0032490 3300049579 Bacteria 4103
386 Ga0501047_0363551 3300049581 Bacteria 1282
387 Ga0501206_003876 3300049653 Bacteria 1900
388 Ga0501223_000912 3300049663 Bacteria 6982
389 Ga0501224_013704 3300049664 Bacteria 1197
390 Ga0501233_005961 3300049668 Bacteria 2275
391 Ga0501235_035493 3300049669 Bacteria 1132
392 Ga0501259_000348 3300049688 Bacteria 7257
393 Ga0501261_000076 3300049690 Bacteria 16797
394 Ga0501245_000266 3300049708 Bacteria 6025
395 Ga0501264_001490 3300049761 Bacteria 2497
396 Ga0501279_000023 3300049775 Bacteria 48641
397 Ga0501280_000016 3300049776 Bacteria 54911
398 Ga0501281_00185 3300049777 Bacteria 7186
399 Ga0501282_002698 3300049778 Bacteria 1922
400 Ga0501035_0380403 3300049822 Bacteria 1177
401 nmdc:mga03n38_57453_c1 3300050490 Bacteria 1759
402 nmdc:mga00v17_86687_c1 3300050491 Bacteria 1962
403 nmdc:mga0yw44_59967_c1 3300050492 Bacteria 2330
404 nmdc:mga0k408_154165_c1 3300050493 Bacteria 1368
405 nmdc:mga06z11_44071_c1 3300050494 Bacteria 2248
406 nmdc:mga07m45_121494_c1 3300050496 Bacteria 1508
407 nmdc:mga05p37_46959_c1 3300050507 Bacteria 5310
408 nmdc:mga0n895_399763_c1 3300050512 Bacteria 1389
409 nmdc:mga0sz30_10692_c1 3300050516 Bacteria 3523
410 Ga0500651_0104697 3300053093 Bacteria 1732
411 Ga0500640_096941 3300053095 Bacteria 1225
412 Ga0500569_054532 3300053109 Bacteria 1216
413 Ga0500572_004908 3300053111 Bacteria 3026
414 Ga0500595_008906 3300053119 Bacteria 4077
415 Ga0500595_020069 3300053119 Bacteria 2412
416 Ga0500608_033617 3300053122 Bacteria 2441
417 Ga0500658_0060360 3300053134 Bacteria 1575
418 Ga0500559_0019173 3300053136 Bacteria 2891
419 Ga0500585_027383 3300053144 Bacteria 1934
420 Ga0500590_096471 3300053148 Bacteria 1426
421 Ga0500620_007328 3300053155 Bacteria 2719
422 Ga0500636_0000147 3300053177 Bacteria 36797
423 Ga0500645_068036 3300053730 Bacteria 1024
424 Ga0500609_020760 3300053731 Bacteria 895
425 Ga0500601_000077 3300053737 Bacteria 20039
426 Ga0500661_002176 3300055283 Bacteria 3699
427 2511398680 2511231028 Bacteria 8046582
428 2513643116 2513237094 Bacteria 8789602
429 2513721156 2513237104 Bacteria 10034502
430 2513858474 2513237137 Bacteria 9558895
431 2643730644 2643221541 Bacteria 5498788
432 2644043813 2643221606 Bacteria 5588032
433 2644393972 2643221671 Bacteria 5496681
434 2844317203 2844315083 Bacteria 8138177
435 2849081185 2849076700 Bacteria 7039503
436 2874634612 2874628541 Bacteria 8630250
437 2888388748 2888388044 Bacteria 7304136
438 2896429298 2896429255 Bacteria 2557483
439 2903735187 2903727486 Bacteria 8281579
440 2904697170 2904690495 Bacteria 9412302
441 2906607242 2906602504 Bacteria 8295279
442 2932799219 2932794094 Bacteria 7915132
443 2932803786 2932801729 Bacteria 7987968
444 2935884336 2935883170 Bacteria 7964738
445 2941535048 2941531003 Bacteria 7653939
446 3005596906 3005594810 Bacteria 8716512
447 3005712939 3005710791 Bacteria 7622528
448 3005720309 3005718088 Bacteria 8283608
449 8019655879 8019648815 Bacteria 10014479
450 8045864603 8045864390 Bacteria 5043873
451 8056976255 8056967851 Bacteria 9038162
452 Ga0157370_10340981
453 JGI24741J21665_1000025
454 JGI24740J21852_10000650
455 JGI24737J22298_10000063
456 JGI24737J22298_10000861
457 JGI24737J22298_10001839
458 JGI25160J50197_1000641
459 JGI25160J50197_1011488
460 Ga0055539_1002424
461 Ga0055542_1005439
462 Ga0055543_1001343
463 Ga0065165_1002233
464 Ga0070658_10002747
465 Ga0070658_10079803
466 Ga0070683_100027764
467 Ga0070683_100071758
468 Ga0070670_100007466
469 Ga0070670_100027054
470 Ga0070670_100188390
471 Ga0068869_100113394
472 Ga0070680_100053058
473 Ga0070660_100068653
474 Ga0070660_100212989
475 Ga0070689_100199745
476 Ga0070661_100002866
477 Ga0070661_100035742
478 Ga0070669_100027578
479 Ga0070669_100306593
480 Ga0070675_100006955
481 Ga0070675_100308116
482 Ga0070671_100074776
483 Ga0070671_100091331
484 Ga0070671_100166455
485 Ga0070673_100018865
486 Ga0070659_100014363
487 Ga0070659_100057706
488 Ga0070659_100102455
489 Ga0070659_100177859
490 Ga0070659_100264581
491 Ga0070667_100001364
492 Ga0070667_100016169
493 Ga0070663_100140946
494 Ga0070662_100004215
495 Ga0070662_100202989
496 Ga0070662_100628507
497 Ga0070681_10117077
498 Ga0070679_100145043
499 Ga0070684_100017376
500 Ga0068853_100067272
501 Ga0070672_100091227
502 Ga0070665_100000169
503 Ga0070665_100001642
504 Ga0068855_100129582
505 Ga0068855_100141756
506 Ga0068855_100281840
507 Ga0070664_100076665
508 Ga0068857_100019893
509 Ga0068857_100071094
510 Ga0068857_100129856
511 Ga0068854_100184730
512 Ga0068856_100630573
513 Ga0068852_100583440
514 Ga0068859_100000117
515 Ga0068859_100041822
516 Ga0068859_100330902
517 Ga0068864_100000161
518 Ga0068864_100272169
519 Ga0068851_10002607
520 Ga0068863_100000883
521 Ga0068863_100013097
522 Ga0068863_100018572
523 Ga0068858_100000063
524 Ga0068858_100038387
525 Ga0068860_100003162
526 Ga0068862_100005226
527 Ga0081538_10031964
528 Ga0075367_10045497
529 Ga0075369_10026708
530 Ga0075366_10128883
531 Ga0075428_100027569
532 Ga0075434_100224632
533 Ga0097620_100000117
534 Ga0097620_100041825
535 Ga0097620_100330894
536 Ga0105251_10029461
537 Ga0105240_10010877
538 Ga0105240_10031204
539 Ga0114129_10114319
540 Ga0114129_10303713
541 Ga0105241_10002431
542 Ga0105241_10452712
543 Ga0105248_10000496
544 Ga0105248_10015959
545 Ga0105237_10032763
546 Ga0105249_10020120
547 Ga0105249_10779494
548 Ga0105239_10122171
549 Ga0105239_10259117
550 Ga0105246_10014149
551 Ga0157373_10068492
552 Ga0157373_10096606
553 Ga0157373_10363051
554 Ga0157371_10000347
555 Ga0157371_10025597
556 Ga0157370_10004337
557 Ga0157369_10034341
558 Ga0157369_10072906
559 Ga0157369_10100562
560 Ga0157374_10183803
561 Ga0163162_10232297
562 Ga0163162_10379422
563 Ga0157372_10081556
564 Ga0157372_10362665
565 Ga0157375_10129548
566 Ga0157375_10149335
567 Ga0163163_10001219
568 Ga0163163_10089115
569 Ga0157379_10051498
570 Ga0157379_10566106
571 Ga0163161_10235126
572 Ga0209563_102208
573 Ga0209677_104041
574 Ga0209148_1000319
575 Ga0209233_1015890
576 Ga0209455_1000782
577 Ga0209758_1024352
578 Ga0209758_1047662
579 Ga0207426_1000624
580 Ga0207426_1009872
581 Ga0207697_10017851
582 Ga0207656_10008341
583 Ga0207688_10199421
584 Ga0207680_10062861
585 Ga0207647_10023937
586 Ga0207647_10024227
587 Ga0207647_10097111
588 Ga0207647_10225982
589 Ga0207705_10000282
590 Ga0207705_10063674
591 Ga0207705_10109204
592 Ga0207705_10240977
593 Ga0207654_10000328
594 Ga0207695_10000240
595 Ga0207695_10001715
596 Ga0207695_10215923
597 Ga0207671_10022310
598 Ga0207660_10065262
599 Ga0207660_10109454
600 Ga0207660_10110112
601 Ga0207660_10206055
602 Ga0207657_10003241
603 Ga0207657_10013513
604 Ga0207657_10019671
605 Ga0207657_10101092
606 Ga0207657_10187061
607 Ga0207657_10216470
608 Ga0207649_10004003
609 Ga0207649_10035370
610 Ga0207649_10115577
611 Ga0207652_10277742
612 Ga0207652_10412341
613 Ga0207681_10003282
614 Ga0207681_10007952
615 Ga0207681_10041226
616 Ga0207681_10071831
617 Ga0207650_10039165
618 Ga0207650_10205632
619 Ga0207659_10012273
620 Ga0207659_10040023
621 Ga0207644_10022447
622 Ga0207644_10370803
623 Ga0207690_10001188
624 Ga0207690_10055314
625 Ga0207690_10378713
626 Ga0207706_10001335
627 Ga0207706_10014457
628 Ga0207706_10178442
629 Ga0207669_10124378
630 Ga0207691_10066468
631 Ga0207711_10000039
632 Ga0207689_10032664
633 Ga0207661_10040825
634 Ga0207661_10042950
635 Ga0207661_10105269
636 Ga0207679_10011378
637 Ga0207679_10041771
638 Ga0207679_10455169
639 Ga0207679_10534413
640 Ga0207667_10000004
641 Ga0207667_10041119
642 Ga0207667_10439279
643 Ga0207651_10009840
644 Ga0207651_10198813
645 Ga0207712_10012992
646 Ga0207712_10394637
647 Ga0207640_10000360
648 Ga0207658_10001295
649 Ga0207658_10041826
650 Ga0207703_10001636
651 Ga0207639_10000283
652 Ga0207639_10069763
653 Ga0207678_10001345
654 Ga0207678_10008745
655 Ga0207678_10352026
656 Ga0207702_10613620
657 Ga0207641_10000185
658 Ga0207641_10006863
659 Ga0207641_10045312
660 Ga0207676_10000985
661 Ga0207676_10257197
662 Ga0207676_10549877
663 Ga0207674_10000616
664 Ga0207674_10003237
665 Ga0207674_10010717
666 Ga0207674_10138036
667 Ga0207674_10238936
668 Ga0207675_100342195
669 Ga0207698_10017036
670 Ga0207698_10068787
671 Ga0207698_10133508
672 Ga0268266_10000256
673 Ga0268266_10003322
674 Ga0268266_10024332
675 Ga0268265_10085580
676 Ga0268265_10152191
677 Ga0268265_10417725
678 Ga0268264_10001136
679 Ga0268264_10018249
680 Ga0307513_10441880
681 Ga0307408_100111021
682 Ga0307408_100178041
683 Ga0307413_10007203
684 Ga0307413_10051316
685 Ga0307410_10001652
686 Ga0307410_10197115
687 Ga0307410_10226741
688 Ga0307412_10088076
689 Ga0307409_100009153
690 Ga0307409_100071662
691 Ga0307409_100107350
692 Ga0307414_10036070
693 Ga0307414_10660366
694 Ga0307411_10006983
695 Ga0307411_10031755
696 Ga0307411_10063223
697 Ga0307411_10066250
698 Ga0307415_100408595
699 Ga0307510_10003003
700 Ga0307510_10094132
701 Ga0373946_0247625
702 Ga0373927_0027923
703 Ga0373947_0035762
704 Ga0395899_0147724
705 Ga0395899_0174655
706 Ga0395899_0273895
707 Ga0395900_0017500
708 Ga0395900_0018188
709 Ga0395900_0030722
710 Ga0395900_0045785
711 Ga0395900_0177571
712 Ga0395900_0254484
713 Ga0395900_0262888
714 Ga0395900_0521173
715 Ga0395898_0060469
716 Ga0395898_0077264
717 Ga0395898_0382915
718 Ga0395898_0399950
719 Ga0395898_0447997
720 Ga0395898_0489907
721 Ga0395898_0612037
722 Ga0395905_0001314
723 Ga0395905_0003071
724 Ga0395905_0009149
725 Ga0395905_0028336
726 Ga0395905_0035828
727 Ga0395905_0059074
728 Ga0395905_0106004
729 Ga0395905_0214173
730 Ga0395905_0220632
731 Ga0395905_0267761
732 Ga0436364_0767650
733 Ga0395901_0008844
734 Ga0395901_0019330
735 Ga0395901_0020625
736 Ga0395901_0052785
737 Ga0395901_0093469
738 Ga0395901_0108974
739 Ga0395901_0147476
740 Ga0395901_0165418
741 Ga0395901_0254887
742 Ga0395901_0296345
743 Ga0395901_0303563
744 Ga0395901_0338098
745 Ga0395901_0431361
746 Ga0395901_0578892
747 Ga0439432_007361
748 Ga0466969_0045926
749 Ga0466966_0000021
750 Ga0466966_0003714
751 Ga0466961_0000016
752 Ga0466961_0054687
753 Ga0466961_0189823
754 Ga0466963_0049501
755 Ga0466968_0016898
756 Ga0466970_0096418
757 Ga0466957_0059975
758 Ga0466959_0037195
759 Ga0466959_0498220
760 Ga0466958_0260933
761 Ga0466967_0028751
762 Ga0466967_0070882
763 Ga0466967_0378359
764 Ga0466967_0539345
765 Ga0495603_0138390
766 Ga0495629_0004696
767 Ga0495651_0051650
768 Ga0495650_0035931
769 Ga0495580_0145395
770 Ga0495585_0135080
771 Ga0495583_0030009
772 Ga0495606_0034082
773 Ga0495608_0090372
774 Ga0495632_0000038
775 Ga0495643_0168214
776 Ga0495643_0228797
777 Ga0495663_0000013
778 Ga0495652_0029726
779 Ga0495598_0017015
780 Ga0495621_0012260
781 Ga0495622_0125922
782 Ga0495633_0015077
783 Ga0495634_0035314
784 Ga0495625_0192920
785 Ga0495635_0001601
786 Ga0495659_0020859
787 Ga0495588_0118817
788 Ga0495588_0225092
789 Ga0495588_0312282
790 Ga0495657_0013804
791 Ga0495646_0216349
792 Ga0495669_0003458
793 Ga0495669_0098644
794 Ga0495670_0002809
795 Ga0495671_0087645
796 Ga0495671_0229720
797 Ga0495600_0003435
798 Ga0495604_0001069
799 Ga0495676_0135350
800 Ga0495686_0012456
801 Ga0495593_0065477
802 Ga0496104_0009238
803 Ga0496105_0000450
804 Ga0496109_0024353
805 Ga0496110_0016919
806 Ga0496111_0005571
807 Ga0496113_0411384
808 Ga0496115_0178580
809 Ga0496118_0062934
810 Ga0496119_0002327
811 Ga0496120_0036921
812 Ga0496121_0013471
813 Ga0496121_0038004
814 Ga0496121_0265349
815 Ga0496124_0142523
816 Ga0496124_0225427
817 Ga0496125_0000203
818 Ga0496125_0003518
819 Ga0496125_0003917
820 Ga0496125_0016801
821 Ga0496126_0001402
822 Ga0496126_0016269
823 Ga0496126_0114415
824 Ga0496126_0162264
825 Ga0496126_0383539
826 Ga0501290_000113
827 Ga0501292_000005
828 Ga0501294_000141
829 Ga0501297_008770
830 Ga0501300_000307
831 Ga0501031_0149783
832 Ga0501032_0101876
833 Ga0501038_0266000
834 Ga0501038_0344432
835 Ga0501041_0311940
836 Ga0501043_0032490
837 Ga0501047_0363551
838 Ga0501206_003876
839 Ga0501223_000912
840 Ga0501224_013704
841 Ga0501233_005961
842 Ga0501235_035493
843 Ga0501259_000348
844 Ga0501261_000076
845 Ga0501245_000266
846 Ga0501264_001490
847 Ga0501279_000023
848 Ga0501280_000016
849 Ga0501281_00185
850 Ga0501282_002698
851 Ga0501035_0380403
852 nmdc:mga03n38_57453_c1
853 nmdc:mga00v17_86687_c1
854 nmdc:mga0yw44_59967_c1
855 nmdc:mga0k408_154165_c1
856 nmdc:mga06z11_44071_c1
857 nmdc:mga07m45_121494_c1
858 nmdc:mga05p37_46959_c1
859 nmdc:mga0n895_399763_c1
860 nmdc:mga0sz30_10692_c1
861 Ga0500651_0104697
862 Ga0500640_096941
863 Ga0500569_054532
864 Ga0500572_004908
865 Ga0500595_008906
866 Ga0500595_020069
867 Ga0500608_033617
868 Ga0500658_0060360
869 Ga0500559_0019173
870 Ga0500585_027383
871 Ga0500590_096471
872 Ga0500620_007328
873 Ga0500636_0000147
874 Ga0500645_068036
875 Ga0500609_020760
876 Ga0500601_000077
877 Ga0500661_002176
878 2511398680
879 2513643116
880 2513721156
881 2513858474
882 2643730644
883 2644043813
884 2644393972
885 2844317203
886 2849081185
887 2874634612
888 2888388748
889 2896429298
890 2903735187
891 2904697170
892 2906607242
893 2932799219
894 2932803786
895 2935884336
896 2941535048
897 3005596906
898 3005712939
899 3005720309
900 8019655879
901 8045864603
902 8056976255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

23

273

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4d-assembly2.cif.gz_D structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens 0.9868 1 277
4b6g-assembly2.cif.gz_B the crystal structure of the neisserial esterase d. 0.9824 1 274
3e4d-assembly2.cif.gz_D structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens 0.9797 1 277
6jzl-assembly1.cif.gz_A s-formylglutathione hydrolase homolog from a psychrophilic bacterium of shewanella frigidimarina 0.9733 1 277
3s8y-assembly1.cif.gz_A bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica 0.9726 2 277
ID Description Score Start End Superfamily
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9615 1 277 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9547 1 277 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9527 1 277 3.40.50.1820
4folD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9461 1 277 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.933 1 277 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A520HT63-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9996 128 277 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A060CE92-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9972 169 277 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A2T4HYR3-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9944 1 277 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A5C6UJA1-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9936 1 277 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A377F8J7-F1-model_v4 S-formylglutathione hydrolase FrmB (EC 3.1.2.12) 0.9933 119 221 GO:0005829
GO:0018738
GO:0046294
GO:0052689

Map