F446617

General Info

Members Datasets Scaffolds Average Seq Length
450 281 391 199

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10349537|Ga0265316_103495372
Length 229
Sequence MRLYRRFAGTLSPQRAAPSLAFANRLDYLGPMRTDVFLAMLTFCFVSGVTPGPNNLMLMTSGVNFGFRRTLPHLMGVIVGYTVMVALVGFGLDAIFSRVPALLPTMRWLGAAYMLWLAWKIANSGPVGDGETRGAPLGFFGAAAFQWINPKGWVMAVSALTAYAVVDDYARNVLIIALTYFVIAFPGSGVWALLGSSMRRALADPRVARPFNWTMAALLAASIVTVFVE

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
6 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
7 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
8 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
9 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
10 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
11 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
12 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
13 2738541297 Duganella sp. GV083 Isolate Unclassified
14 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
15 2738541357 Duganella sp. GV053 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543026 Duganella sp. GV089 Isolate Unclassified
18 2738543029 Duganella sp. GV039 Isolate Unclassified
19 2751185800 Brucella pituitosa AA2 Isolate Unclassified
20 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
21 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
22 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
23 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
24 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
25 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
26 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
27 2821131069 Duganella sp. 1224 Isolate Unclassified
28 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
29 2842711865 Duganella sp. R-73148 Isolate Unclassified
30 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
31 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
32 2854911287 Brucella lupini LUP21 Isolate Unclassified
33 2857553236 Duganella sp. R-74557 Isolate Unclassified
34 2857558681 Duganella sp. R-74565 Isolate Unclassified
35 2857564685 Duganella sp. R-74599 Isolate Unclassified
36 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
37 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
38 2904424332 Duganella sp. 1411 Isolate Rhizosphere
39 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
40 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
41 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
42 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
43 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
44 2919476304 Duganella sp. 3397 Isolate Unclassified
45 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
46 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
47 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
48 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
49 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
50 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
51 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
52 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
53 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
152 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
163 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
164 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
274 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
277 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
278 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
279 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
280 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
281 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.44
Metatranscriptomes 0.44
Isolates 13.11

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 9.11
Nodule 1.33
Rhizoplane 4.22
Rhizosphere 69.11
Stem 0
Stem Tuber 0
Unclassified 15.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001055 3300002738 Bacteria 10927
2 rootL2_10043495 3300003322 Bacteria 9960
3 rootL2_10066127 3300003322 Bacteria 13288
4 rootH1_10375494 3300003323 Bacteria 1292
5 JGI25160J50197_1000232 3300003354 Bacteria 43665
6 Ga0006562J51391_1007616 3300003578 Bacteria 4153
7 Ga0055529_1000414 3300003763 Bacteria 44462
8 Ga0055526_1000042 3300003771 Bacteria 124886
9 Ga0065165_1000763 3300005262 Bacteria 43601
10 Ga0065714_10008226 3300005288 Bacteria 3652
11 Ga0065714_10202891 3300005288 Bacteria 890
12 Ga0065704_10021916 3300005289 Bacteria 1054
13 Ga0065704_10032612 3300005289 Bacteria 952
14 Ga0065704_10089465 3300005289 Bacteria 2857
15 Ga0070658_10005670 3300005327 Bacteria 10120
16 Ga0068868_100387668 3300005338 Bacteria 1203
17 Ga0070669_100001853 3300005353 Bacteria 15219
18 Ga0070662_100065180 3300005457 Bacteria 2670
19 Ga0068853_100043924 3300005539 Bacteria 3824
20 Ga0070665_101284439 3300005548 Bacteria 742
21 Ga0068855_100001791 3300005563 Bacteria 26853
22 Ga0068851_10001064 3300005834 Bacteria 11887
23 Ga0075365_10165882 3300006038 Bacteria 1541
24 Ga0075368_10012848 3300006042 Bacteria 3067
25 Ga0075363_100059212 3300006048 Bacteria 2059
26 Ga0075363_100115837 3300006048 Bacteria 1492
27 Ga0075364_10014576 3300006051 Bacteria 4859
28 Ga0075362_10112957 3300006177 Bacteria 1280
29 Ga0075367_10142277 3300006178 Bacteria 1486
30 Ga0079104_1022190 3300006946 Bacteria 1713
31 Ga0105251_10000572 3300009011 Bacteria 34425
32 Ga0105244_10000994 3300009036 Bacteria 23823
33 Ga0105244_10009917 3300009036 Bacteria 5812
34 Ga0105250_10000058 3300009092 Bacteria 111233
35 Ga0105240_10120974 3300009093 Bacteria 3152
36 Ga0105237_10038105 3300009545 Bacteria 4856
37 Ga0105238_10073547 3300009551 Bacteria 3412
38 Ga0105238_10621643 3300009551 Bacteria 1089
39 Ga0105249_10264695 3300009553 Bacteria 1710
40 Ga0105246_10217915 3300011119 Bacteria 1494
41 Ga0157373_10000193 3300013100 Bacteria 50206
42 Ga0157373_10038749 3300013100 Bacteria 3415
43 Ga0157371_10002060 3300013102 Bacteria 19729
44 Ga0157371_10028734 3300013102 Bacteria 4025
45 Ga0157371_10082398 3300013102 Bacteria 2278
46 Ga0157370_10000343 3300013104 Bacteria 58793
47 Ga0157370_10256708 3300013104 Bacteria 1616
48 Ga0157370_10392390 3300013104 Bacteria 1278
49 Ga0157369_10000228 3300013105 Bacteria 77603
50 Ga0157369_10000889 3300013105 Bacteria 38144
51 Ga0157369_10004655 3300013105 Bacteria 16125
52 Ga0157369_10016893 3300013105 Bacteria 8201
53 Ga0163162_10529652 3300013306 Bacteria 1307
54 Ga0163162_10531334 3300013306 Bacteria 1305
55 Ga0157372_10473273 3300013307 Bacteria 1460
56 Ga0182008_10000202 3300014497 Bacteria 46777
57 Ga0182008_10116833 3300014497 Bacteria 1324
58 Ga0182006_1000019 3300015261 Bacteria 294192
59 Ga0182006_1004684 3300015261 Bacteria 6699
60 Ga0182006_1011059 3300015261 Bacteria 3984
61 Ga0182006_1019942 3300015261 Bacteria 2815
62 Ga0182007_10000237 3300015262 Bacteria 37215
63 Ga0182005_1000005 3300015265 Bacteria 537378
64 Ga0183361_10002 3300016635 Bacteria 907642
65 Ga0163161_10016777 3300017792 Bacteria 5119
66 Ga0163161_10030096 3300017792 Bacteria 3862
67 Ga0163161_10144952 3300017792 Bacteria 1800
68 Ga0213872_10000122 3300021361 Bacteria 73335
69 Ga0213872_10013183 3300021361 Bacteria 3876
70 Ga0213872_10077678 3300021361 Bacteria 1492
71 Ga0213872_10081500 3300021361 Bacteria 1454
72 Ga0213872_10175613 3300021361 Bacteria 927
73 Ga0224712_10001155 3300022467 Bacteria 5897
74 Ga0209672_100498 3300025228 Bacteria 21801
75 Ga0209563_103105 3300025230 Bacteria 3520
76 Ga0209646_1000097 3300025246 Bacteria 181432
77 Ga0209455_1000047 3300025272 Bacteria 379709
78 Ga0209130_1005772 3300025284 Bacteria 4190
79 Ga0209130_1011635 3300025284 Bacteria 2346
80 Ga0209025_1019450 3300025294 Bacteria 3777
81 Ga0209564_1000032 3300025295 Bacteria 464041
82 Ga0209564_1000464 3300025295 Bacteria 67994
83 Ga0209564_1046983 3300025295 Bacteria 1093
84 Ga0209758_1001809 3300025297 Bacteria 23626
85 Ga0207426_1000180 3300025302 Bacteria 158321
86 Ga0207656_10001219 3300025321 Bacteria 8478
87 Ga0207696_1000017 3300025711 Bacteria 491130
88 Ga0207655_1012009 3300025728 Bacteria 5104
89 Ga0207655_1016388 3300025728 Bacteria 4055
90 Ga0207655_1054739 3300025728 Bacteria 1584
91 Ga0207713_1001351 3300025735 Bacteria 20001
92 Ga0207705_10003153 3300025909 Bacteria 12548
93 Ga0207671_10043615 3300025914 Bacteria 3316
94 Ga0207681_10000430 3300025923 Bacteria 29298
95 Ga0207694_10182391 3300025924 Bacteria 1703
96 Ga0207694_10474545 3300025924 Bacteria 1046
97 Ga0207706_10006944 3300025933 Bacteria 10467
98 Ga0207667_10003656 3300025949 Bacteria 18965
99 Ga0207677_10454736 3300026023 Bacteria 1098
100 Ga0207639_10074026 3300026041 Bacteria 2673
101 Ga0207678_10160590 3300026067 Bacteria 1919
102 Ga0207678_10742826 3300026067 Bacteria 865
103 Ga0209281_1028323 3300027111 Bacteria 1019
104 Ga0209371_1019207 3300027312 Bacteria 1711
105 Ga0307515_10000307 3300028794 Bacteria 121172
106 Ga0307515_10085058 3300028794 Bacteria 4053
107 Ga0265338_10000385 3300028800 Bacteria 79013
108 Ga0268256_1021490 3300030500 Bacteria 1715
109 Ga0265328_10011154 3300031239 Bacteria 3598
110 Ga0265340_10019872 3300031247 Bacteria 3456
111 Ga0265331_10001390 3300031250 Bacteria 17788
112 Ga0265327_10000444 3300031251 Bacteria 74908
113 Ga0265316_10349537 3300031344 Bacteria 1071
114 Ga0307516_10096547 3300031730 Bacteria 2776
115 Ga0307516_10445110 3300031730 Bacteria 952
116 Ga0307516_10675457 3300031730 Bacteria 689
117 Ga0307413_10813507 3300031824 Bacteria 786
118 Ga0307414_10330911 3300032004 Bacteria 1300
119 Ga0307415_100959207 3300032126 Bacteria 792
120 Ga0316574_0295565 3300035398 Bacteria 1031
121 Ga0373927_0000810 3300035695 Bacteria 23917
122 Ga0373947_0704328 3300035725 Bacteria 689
123 Ga0373925_0110962 3300037068 Bacteria 2118
124 Ga0395899_0000036 3300037312 Bacteria 289502
125 Ga0395899_0021992 3300037312 Bacteria 4836
126 Ga0395899_0059063 3300037312 Bacteria 2827
127 Ga0395900_0000071 3300037418 Bacteria 187816
128 Ga0395900_0000089 3300037418 Bacteria 170012
129 Ga0395900_0083131 3300037418 Bacteria 3290
130 Ga0395900_0087345 3300037418 Bacteria 3205
131 Ga0395900_0120673 3300037418 Bacteria 2690
132 Ga0395900_0615326 3300037418 Bacteria 1025
133 Ga0395898_0000115 3300037466 Bacteria 211806
134 Ga0395898_0000195 3300037466 Bacteria 155796
135 Ga0395898_0014795 3300037466 Bacteria 8009
136 Ga0395898_0063629 3300037466 Bacteria 3579
137 Ga0395898_1093834 3300037466 Bacteria 731
138 Ga0395905_0000052 3300037471 Bacteria 215018
139 Ga0395905_0024686 3300037471 Bacteria 5672
140 Ga0395905_0026423 3300037471 Bacteria 5473
141 Ga0395901_0000012 3300038443 Bacteria 381361
142 Ga0395901_0000038 3300038443 Bacteria 210534
143 Ga0395901_0053865 3300038443 Bacteria 4180
144 Ga0436360_0046226 3300039438 Bacteria 1184
145 Ga0436360_0558848 3300039438 Bacteria 2471
146 Ga0436360_1038136 3300039438 Bacteria 1466
147 Ga0436361_0158106 3300039447 Bacteria 4060
148 Ga0436361_0322493 3300039447 Bacteria 4587
149 Ga0436361_0483826 3300039447 Bacteria 9339
150 Ga0436361_0530034 3300039447 Bacteria 2891
151 Ga0436361_0652019 3300039447 Bacteria 3364
152 Ga0436361_0664565 3300039447 Bacteria 1521
153 Ga0436361_0768132 3300039447 Bacteria 1506
154 Ga0436361_0813098 3300039447 Bacteria 136133
155 Ga0436361_1203940 3300039447 Bacteria 3895
156 Ga0436363_1060263 3300039450 Bacteria 696
157 Ga0436362_0818039 3300039453 Bacteria 1914
158 Ga0439436_0001352 3300041404 Bacteria 7051
159 Ga0439438_004593 3300041405 Bacteria 5250
160 Ga0439447_000753 3300041407 Bacteria 11992
161 Ga0439466_0006981 3300041411 Bacteria 4281
162 Ga0451807_0348260 3300041486 Bacteria 2309
163 Ga0451807_0485987 3300041486 Bacteria 778
164 Ga0451837_0144495 3300041494 Bacteria 599
165 Ga0451843_0449746 3300041509 Bacteria 1016
166 Ga0439431_0013338 3300041997 Bacteria 1895
167 Ga0439437_002391 3300042000 Bacteria 2004
168 Ga0439432_011144 3300042006 Bacteria 3098
169 Ga0439452_012051 3300042010 Bacteria 2469
170 Ga0439455_0008346 3300042012 Bacteria 2217
171 Ga0439456_016251 3300042013 Bacteria 1556
172 Ga0450911_000013 3300042115 Bacteria 129019
173 Ga0450904_000018 3300042139 Bacteria 40183
174 Ga0450904_007887 3300042139 Bacteria 1052
175 Ga0439446_0000750 3300042156 Bacteria 6817
176 Ga0439446_0003852 3300042156 Bacteria 3761
177 Ga0439434_0002414 3300042435 Bacteria 5431
178 Ga0439459_0004210 3300042438 Bacteria 2307
179 Ga0439459_0006997 3300042438 Bacteria 1893
180 Ga0439464_0008414 3300042439 Bacteria 2703
181 Ga0439464_0051285 3300042439 Bacteria 1193
182 Ga0450893_0004055 3300042532 Bacteria 2328
183 Ga0466972_0061189 3300044658 Bacteria 1806
184 Ga0466966_0000481 3300044684 Bacteria 25684
185 Ga0466961_0000153 3300044693 Bacteria 46519
186 Ga0466963_0137479 3300044694 Bacteria 1691
187 Ga0466963_0380815 3300044694 Bacteria 994
188 Ga0453684_0063030 3300044712 Bacteria 4745
189 Ga0466971_0002580 3300044719 Bacteria 7658
190 Ga0466971_0186551 3300044719 Bacteria 976
191 Ga0466971_0357481 3300044719 Bacteria 707
192 Ga0466960_0030295 3300044901 Bacteria 2489
193 Ga0466959_0171520 3300045049 Bacteria 1521
194 Ga0466959_0435512 3300045049 Bacteria 889
195 Ga0451576_0003778 3300045051 Bacteria 20426
196 Ga0451576_0109910 3300045051 Bacteria 2869
197 Ga0466958_0008080 3300045836 Bacteria 5821
198 Ga0495617_000005 3300046452 Bacteria 404687
199 Ga0495627_000033 3300046453 Bacteria 220621
200 Ga0495590_0000011 3300046457 Bacteria 307470
201 Ga0495590_0003718 3300046457 Bacteria 6214
202 Ga0495638_0000080 3300046460 Bacteria 155967
203 Ga0495638_0010017 3300046460 Bacteria 6609
204 Ga0495638_0030372 3300046460 Bacteria 3480
205 Ga0495638_0145153 3300046460 Bacteria 1381
206 Ga0495653_0000008 3300046463 Bacteria 307868
207 Ga0495653_0000113 3300046463 Bacteria 68137
208 Ga0495653_0233106 3300046463 Bacteria 1231
209 Ga0495650_0000368 3300046471 Bacteria 78685
210 Ga0495650_0000397 3300046471 Bacteria 72986
211 Ga0495650_0000748 3300046471 Bacteria 40639
212 Ga0495650_0002528 3300046471 Bacteria 14617
213 Ga0495605_0000267 3300046474 Bacteria 59550
214 Ga0495605_0016074 3300046474 Bacteria 4058
215 Ga0495584_0038198 3300046491 Bacteria 2427
216 Ga0495585_0000163 3300046492 Bacteria 71586
217 Ga0495585_0000717 3300046492 Bacteria 29773
218 Ga0495585_0004858 3300046492 Bacteria 8627
219 Ga0495607_0000295 3300046501 Bacteria 52177
220 Ga0495583_0000076 3300046506 Bacteria 174154
221 Ga0495583_0000131 3300046506 Bacteria 125393
222 Ga0495583_0041879 3300046506 Bacteria 2142
223 Ga0495606_0000048 3300046507 Bacteria 207840
224 Ga0495606_0000061 3300046507 Bacteria 185384
225 Ga0495606_0000188 3300046507 Bacteria 108100
226 Ga0495606_0000251 3300046507 Bacteria 94515
227 Ga0495606_0000452 3300046507 Bacteria 67182
228 Ga0495606_0000757 3300046507 Bacteria 49718
229 Ga0495606_0002314 3300046507 Bacteria 22443
230 Ga0495610_0000007 3300046512 Bacteria 820919
231 Ga0495610_0001160 3300046512 Bacteria 23977
232 Ga0495610_0001725 3300046512 Bacteria 19161
233 Ga0495610_0002114 3300046512 Bacteria 16926
234 Ga0495610_0018304 3300046512 Bacteria 3961
235 Ga0495610_0019716 3300046512 Bacteria 3763
236 Ga0495637_0001289 3300046520 Bacteria 15089
237 Ga0495637_0005155 3300046520 Bacteria 6697
238 Ga0495643_0000119 3300046522 Bacteria 127740
239 Ga0495643_0000153 3300046522 Bacteria 112514
240 Ga0495643_0016480 3300046522 Bacteria 4340
241 Ga0495644_0193007 3300046523 Bacteria 784
242 Ga0495648_0000010 3300046524 Bacteria 307259
243 Ga0495648_0001241 3300046524 Bacteria 25515
244 Ga0495648_0038283 3300046524 Bacteria 3069
245 Ga0495648_0050840 3300046524 Bacteria 2529
246 Ga0495642_0000269 3300046528 Bacteria 29337
247 Ga0495654_0000046 3300046530 Bacteria 150178
248 Ga0495654_0000059 3300046530 Bacteria 137056
249 Ga0495654_0006272 3300046530 Bacteria 6773
250 Ga0495654_0009079 3300046530 Bacteria 5455
251 Ga0495609_0000576 3300046538 Bacteria 28870
252 Ga0495609_0006496 3300046538 Bacteria 5959
253 Ga0495609_0026893 3300046538 Bacteria 2631
254 Ga0495609_0028325 3300046538 Bacteria 2556
255 Ga0495597_0000043 3300046542 Bacteria 106919
256 Ga0495597_0000238 3300046542 Bacteria 49780
257 Ga0495622_0001291 3300046557 Bacteria 12854
258 Ga0495633_0000076 3300046558 Bacteria 129915
259 Ga0495633_0000132 3300046558 Bacteria 100231
260 Ga0495633_0002912 3300046558 Bacteria 11742
261 Ga0495633_0016118 3300046558 Bacteria 3862
262 Ga0495668_0000045 3300046616 Bacteria 225145
263 Ga0495668_0000110 3300046616 Bacteria 132291
264 Ga0495668_0000249 3300046616 Bacteria 76455
265 Ga0495668_0001091 3300046616 Bacteria 28201
266 Ga0495611_0251135 3300046648 Bacteria 820
267 Ga0495625_0000365 3300046660 Bacteria 69161
268 Ga0495625_0000393 3300046660 Bacteria 66807
269 Ga0495625_0028994 3300046660 Bacteria 4143
270 Ga0495625_0060522 3300046660 Bacteria 2683
271 Ga0495625_0117424 3300046660 Bacteria 1813
272 Ga0495625_0393641 3300046660 Bacteria 867
273 Ga0495661_0000007 3300046665 Bacteria 411832
274 Ga0495661_0015075 3300046665 Bacteria 5166
275 Ga0495669_0181658 3300046684 Bacteria 1003
276 Ga0495671_0000056 3300046692 Bacteria 115524
277 Ga0495671_0018068 3300046692 Bacteria 3750
278 Ga0495671_0113487 3300046692 Bacteria 1323
279 Ga0495649_0004257 3300046694 Bacteria 9386
280 Ga0495649_0048183 3300046694 Bacteria 2316
281 Ga0495649_0137724 3300046694 Bacteria 1286
282 Ga0495589_0037643 3300046794 Bacteria 2423
283 Ga0495660_0000418 3300046810 Bacteria 36125
284 Ga0495660_0000490 3300046810 Bacteria 32692
285 Ga0495660_0001909 3300046810 Bacteria 13617
286 Ga0495674_0047182 3300047319 Bacteria 3820
287 Ga0495672_0000113 3300047320 Bacteria 129189
288 Ga0495672_0026021 3300047320 Bacteria 3738
289 Ga0495683_0061127 3300047323 Bacteria 1865
290 Ga0495687_003608 3300047443 Bacteria 11065
291 Ga0495687_006609 3300047443 Bacteria 7055
292 Ga0495687_020301 3300047443 Bacteria 3239
293 Ga0495677_0036937 3300047445 Bacteria 1784
294 Ga0495679_042276 3300047446 Bacteria 1406
295 Ga0495673_0000057 3300047469 Bacteria 239715
296 Ga0495673_0000096 3300047469 Bacteria 182792
297 Ga0495673_0000098 3300047469 Bacteria 182002
298 Ga0495673_0018249 3300047469 Bacteria 3544
299 Ga0495681_0002240 3300047470 Bacteria 13908
300 Ga0495686_0105501 3300047472 Bacteria 1695
301 Ga0495626_0022181 3300048091 Bacteria 3138
302 Ga0496100_0000114 3300048903 Bacteria 46250
303 Ga0496101_0000837 3300048904 Bacteria 18091
304 Ga0496102_0000784 3300048905 Bacteria 30901
305 Ga0496103_0000338 3300048906 Bacteria 42786
306 Ga0496103_0002379 3300048906 Bacteria 11862
307 Ga0496103_0153777 3300048906 Bacteria 1474
308 Ga0496104_0085706 3300048907 Bacteria 3006
309 Ga0496105_0139424 3300048908 Bacteria 1996
310 Ga0496106_0131260 3300048909 Bacteria 1965
311 Ga0496107_0094443 3300048910 Bacteria 2188
312 Ga0496109_0716767 3300048912 Bacteria 938
313 Ga0496111_0339912 3300048914 Bacteria 1111
314 Ga0496113_0004521 3300048916 Bacteria 8565
315 Ga0496116_0006762 3300048919 Bacteria 10320
316 Ga0496116_0107157 3300048919 Bacteria 1653
317 Ga0496116_0113621 3300048919 Bacteria 1584
318 Ga0496117_0000764 3300048920 Bacteria 50654
319 Ga0496118_0003243 3300048921 Bacteria 20746
320 Ga0496118_0043225 3300048921 Bacteria 3544
321 Ga0496118_0045319 3300048921 Bacteria 3434
322 Ga0496119_0016966 3300048922 Bacteria 5507
323 Ga0496119_0113546 3300048922 Bacteria 1499
324 Ga0496120_0173435 3300048923 Bacteria 1065
325 Ga0496121_0002026 3300048924 Bacteria 32144
326 Ga0496121_0011710 3300048924 Bacteria 9684
327 Ga0496121_0035462 3300048924 Bacteria 4471
328 Ga0496121_0047023 3300048924 Bacteria 3685
329 Ga0496121_0161508 3300048924 Bacteria 1638
330 Ga0496122_0094569 3300048925 Bacteria 2022
331 Ga0496123_0001453 3300048926 Bacteria 32981
332 Ga0496123_0078475 3300048926 Bacteria 2022
333 Ga0496123_0187030 3300048926 Bacteria 1075
334 Ga0496124_0072705 3300048927 Bacteria 2847
335 Ga0496124_0123458 3300048927 Bacteria 2066
336 Ga0496124_0196443 3300048927 Bacteria 1538
337 Ga0496125_0018918 3300048928 Bacteria 6518
338 Ga0496125_0026848 3300048928 Bacteria 5231
339 Ga0496125_0028124 3300048928 Bacteria 5083
340 Ga0496125_0151248 3300048928 Bacteria 1593
341 Ga0496125_0310315 3300048928 Bacteria 961
342 Ga0496126_0019719 3300048929 Bacteria 6635
343 Ga0496126_0023387 3300048929 Bacteria 5989
344 Ga0496126_0235870 3300048929 Bacteria 1530
345 Ga0495678_000001 3300049459 Bacteria 1060340
346 Ga0495678_000111 3300049459 Bacteria 97182
347 Ga0495678_005515 3300049459 Bacteria 6966
348 Ga0495678_011057 3300049459 Bacteria 4340
349 Ga0495678_033120 3300049459 Bacteria 2135
350 Ga0495678_052269 3300049459 Bacteria 1574
351 Ga0495678_069934 3300049459 Bacteria 1290
352 Ga0495682_0025853 3300049460 Bacteria 2182
353 Ga0501031_0018082 3300049568 Bacteria 4585
354 Ga0501032_0022029 3300049569 Bacteria 4424
355 Ga0501033_0000050 3300049570 Bacteria 111819
356 Ga0501034_0064559 3300049571 Bacteria 3675
357 Ga0501036_0197082 3300049572 Bacteria 1694
358 Ga0501038_0109821 3300049574 Bacteria 2285
359 Ga0501039_0107869 3300049575 Bacteria 2176
360 Ga0501067_0670295 3300049583 Bacteria 583
361 Ga0501073_0022131 3300049589 Bacteria 4581
362 Ga0501073_0049597 3300049589 Bacteria 2943
363 Ga0501074_0311465 3300049590 Bacteria 1118
364 Ga0501080_0147004 3300049742 Bacteria 2179
365 Ga0501083_0823498 3300049744 Bacteria 604
366 Ga0501269_000422 3300049766 Bacteria 9580
367 Ga0501035_0003062 3300049822 Bacteria 16037
368 Ga0501035_0168936 3300049822 Bacteria 1890
369 Ga0501044_0102277 3300049823 Bacteria 2881
370 Ga0501226_000015 3300049853 Bacteria 164151
371 nmdc:mga03683_271866_c1 3300050489 Bacteria 790
372 nmdc:mga03683_98961_c1 3300050489 Bacteria 1280
373 nmdc:mga03n38_14113_c1 3300050490 Bacteria 3055
374 nmdc:mga03n38_78193_c1 3300050490 Bacteria 1548
375 nmdc:mga00v17_141842_c1 3300050491 Bacteria 1541
376 nmdc:mga06z11_13283_c2 3300050494 Bacteria 1707
377 nmdc:mga06z11_33095_c1 3300050494 Bacteria 2526
378 Ga0500555_057934 3300053103 Unclassified 1047
379 Ga0500556_0000074 3300053104 Bacteria 98799
380 Ga0500618_000078 3300053125 Bacteria 79833
381 Ga0500618_059665 3300053125 Bacteria 858
382 Ga0500559_0000001 3300053136 Bacteria 325464
383 Ga0500559_0021299 3300053136 Bacteria 2747
384 Ga0500568_0179995 3300053139 Bacteria 777
385 Ga0500586_000427 3300053145 Bacteria 8447
386 Ga0500586_000982 3300053145 Bacteria 5884
387 Ga0500616_0017904 3300053153 Bacteria 4012
388 Ga0500627_0127074 3300053158 Bacteria 1151
389 Ga0500639_040533 3300053163 Bacteria 2451
390 Ga0466962_0007719 3300061719 Bacteria 5154
391 Ga0466962_0008450 3300061719 Bacteria 4932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0197082 Ga0501036_0197082_10_456 147
2 3300049583 Ga0501067_0670295 Ga0501067_0670295_29_556 159
3 3300049744 Ga0501083_0823498 Ga0501083_0823498_23_550 159
4 3300041494 Ga0451837_0144495 Ga0451837_0144495_79_588 168
5 3300045049 Ga0466959_0171520 Ga0466959_0171520_954_1505 170
6 3300003322 rootL2_10066127 rootL2_100661277 172
7 3300044719 Ga0466971_0357481 Ga0466971_0357481_25_555 173
8 3300049459 Ga0495678_069934 Ga0495678_069934_748_1269 173
9 3300042439 Ga0439464_0008414 Ga0439464_0008414_14_556 175
10 3300015261 Ga0182006_1019942 Ga0182006_10199423 184
11 3300049574 Ga0501038_0109821 Ga0501038_0109821_1247_1849 184
12 3300049575 Ga0501039_0107869 Ga0501039_0107869_1528_2130 184
13 3300049589 Ga0501073_0049597 Ga0501073_0049597_1276_1878 184
14 3300049590 Ga0501074_0311465 Ga0501074_0311465_414_1016 184
15 3300049823 Ga0501044_0102277 Ga0501044_0102277_1363_1965 184
16 3300038443 Ga0395901_0000038 Ga0395901_0000038_25368_25985 185
17 3300039447 Ga0436361_0158106 Ga0436361_0158106_1388_1987 185
18 3300044694 Ga0466963_0137479 Ga0466963_0137479_419_1027 185
19 3300046507 Ga0495606_0000452 Ga0495606_0000452_10078_10677 185
20 3300046463 Ga0495653_0000113 Ga0495653_0000113_59536_60141 186
21 3300046492 Ga0495585_0004858 Ga0495585_0004858_756_1361 186
22 3300046507 Ga0495606_0000061 Ga0495606_0000061_176842_177447 186
23 3300049459 Ga0495678_033120 Ga0495678_033120_626_1231 186
24 3300009553 Ga0105249_10264695 Ga0105249_102646952 187
25 3300021361 Ga0213872_10013183 Ga0213872_100131834 187
26 3300031730 Ga0307516_10096547 Ga0307516_100965473 187
27 3300039447 Ga0436361_1203940 Ga0436361_1203940_1605_2204 187
28 3300046694 Ga0495649_0048183 Ga0495649_0048183_159_722 187
29 3300050490 nmdc:mga03n38_78193_c1 nmdc:mga03n38_78193_c1_10_582 187
30 3300053103 Ga0500555_057934 Ga0500555_057934_287_931 187
31 3300003354 JGI25160J50197_1000232 JGI25160J50197_100023210 188
32 3300005262 Ga0065165_1000763 Ga0065165_100076310 188
33 3300025284 Ga0209130_1005772 Ga0209130_10057722 188
34 3300025295 Ga0209564_1046983 Ga0209564_10469832 188
35 3300025302 Ga0207426_1000180 Ga0207426_100018029 188
36 3300026067 Ga0207678_10742826 Ga0207678_107428261 188
37 3300035398 Ga0316574_0295565 Ga0316574_0295565_44_631 188
38 3300046457 Ga0495590_0003718 Ga0495590_0003718_1064_1684 188
39 3300046474 Ga0495605_0016074 Ga0495605_0016074_2508_3128 188
40 3300046491 Ga0495584_0038198 Ga0495584_0038198_362_982 188
41 3300046506 Ga0495583_0041879 Ga0495583_0041879_619_1239 188
42 3300046648 Ga0495611_0251135 Ga0495611_0251135_78_698 188
43 3300046794 Ga0495589_0037643 Ga0495589_0037643_1448_2068 188
44 3300047319 Ga0495674_0047182 Ga0495674_0047182_505_1125 188
45 3300047320 Ga0495672_0026021 Ga0495672_0026021_2763_3383 188
46 3300047323 Ga0495683_0061127 Ga0495683_0061127_342_962 188
47 3300047443 Ga0495687_020301 Ga0495687_020301_2489_3109 188
48 3300047469 Ga0495673_0018249 Ga0495673_0018249_261_881 188
49 3300048091 Ga0495626_0022181 Ga0495626_0022181_1121_1741 188
50 3300048903 Ga0496100_0000114 Ga0496100_0000114_7078_7698 188
51 3300048904 Ga0496101_0000837 Ga0496101_0000837_14183_14803 188
52 3300048905 Ga0496102_0000784 Ga0496102_0000784_26_646 188
53 3300048906 Ga0496103_0000338 Ga0496103_0000338_14649_15269 188
54 3300048906 Ga0496103_0153777 Ga0496103_0153777_542_1162 188
55 3300048907 Ga0496104_0085706 Ga0496104_0085706_1262_1882 188
56 3300048908 Ga0496105_0139424 Ga0496105_0139424_483_1103 188
57 3300048909 Ga0496106_0131260 Ga0496106_0131260_1053_1673 188
58 3300048910 Ga0496107_0094443 Ga0496107_0094443_907_1527 188
59 3300048912 Ga0496109_0716767 Ga0496109_0716767_248_868 188
60 3300048916 Ga0496113_0004521 Ga0496113_0004521_1161_1781 188
61 3300048919 Ga0496116_0107157 Ga0496116_0107157_580_1200 188
62 3300048920 Ga0496117_0000764 Ga0496117_0000764_7057_7677 188
63 3300048921 Ga0496118_0003243 Ga0496118_0003243_7036_7656 188
64 3300048924 Ga0496121_0002026 Ga0496121_0002026_25271_25891 188
65 3300048924 Ga0496121_0011710 Ga0496121_0011710_829_1449 188
66 3300049459 Ga0495678_052269 Ga0495678_052269_222_842 188
67 3300049460 Ga0495682_0025853 Ga0495682_0025853_1521_2141 188
68 3300003323 rootH1_10375494 rootH1_103754942 189
69 3300045051 Ga0451576_0003778 Ga0451576_0003778_8771_9370 189
70 3300003578 Ga0006562J51391_1007616 Ga0006562J51391_10076164 190
71 3300046460 Ga0495638_0145153 Ga0495638_0145153_484_1083 190
72 iso_pu_bacteria 2904434214 2904436041 192
73 iso_pu_bacteria 2919497567 2919499035 192
74 3300005289 Ga0065704_10089465 Ga0065704_100894652 193
75 3300046492 Ga0495585_0000163 Ga0495585_0000163_63028_63633 193
76 3300046665 Ga0495661_0000007 Ga0495661_0000007_292301_292906 193
77 iso_pu_bacteria 2898795034 2898797507 193
78 iso_pu_bacteria 2738541297 2738827373 194
79 iso_pu_bacteria 2738541357 2739151170 194
80 iso_pu_bacteria 2738543003 2739193089 194
81 iso_pu_bacteria 2738543026 2739319566 194
82 iso_pu_bacteria 2738543029 2739337807 194
83 iso_pu_bacteria 2751185800 2753359716 194
84 iso_pu_bacteria 2758568016 2758641975 194
85 iso_pu_bacteria 2811994881 2812366291 194
86 iso_pu_bacteria 2821131069 2821134720 194
87 iso_pu_bacteria 2854911287 2854912362 194
88 iso_pu_bacteria 2857564685 2857569042 194
89 iso_pu_bacteria 2894817345 2894820311 194
90 iso_pu_bacteria 2915650412 2915653102 194
91 iso_pu_bacteria 2923519811 2923520315 194
92 3300044712 Ga0453684_0063030 Ga0453684_0063030_2484_3083 195
93 3300045051 Ga0451576_0109910 Ga0451576_0109910_1371_1970 195
94 iso_pu_bacteria 2510065053 2510282065 195
95 iso_pu_bacteria 2510065055 2510291776 195
96 iso_pu_bacteria 2510065058 2510310213 195
97 iso_pu_bacteria 2773857672 2774129722 195
98 iso_pu_bacteria 2808606373 2808907895 195
99 iso_pu_bacteria 2808606379 2808943087 195
100 iso_pu_bacteria 2842711865 2842715274 195
101 iso_pu_bacteria 2857553236 2857557941 195
102 iso_pu_bacteria 2857558681 2857560638 195
103 iso_pu_bacteria 2904424332 2904430067 195
104 iso_pu_bacteria 2917832318 2917836019 195
105 iso_pu_bacteria 2919125081 2919125674 195
106 iso_pu_bacteria 2919476304 2919479545 195
107 iso_pu_bacteria 2974298342 2974300145 195
108 iso_pu_bacteria 2984499530 2984502525 195
109 iso_pu_bacteria 2984504281 2984508859 195
110 iso_pu_bacteria 3007252601 3007252651 195
111 iso_pu_bacteria 8011350971 8011353074 195
112 iso_pu_bacteria 8016728285 8016728851 195
113 iso_pu_bacteria 8055225921 8055226427 196
114 3300011119 Ga0105246_10217915 Ga0105246_102179152 197
115 3300013102 Ga0157371_10028734 Ga0157371_100287342 197
116 3300025284 Ga0209130_1011635 Ga0209130_10116352 197
117 3300028794 Ga0307515_10000307 Ga0307515_1000030731 197
118 3300028800 Ga0265338_10000385 Ga0265338_100003856 197
119 3300031730 Ga0307516_10445110 Ga0307516_104451101 197
120 3300031824 Ga0307413_10813507 Ga0307413_108135072 197
121 3300035695 Ga0373927_0000810 Ga0373927_0000810_7697_8380 197
122 3300035725 Ga0373947_0704328 Ga0373947_0704328_23_616 197
123 3300037068 Ga0373925_0110962 Ga0373925_0110962_1394_2077 197
124 3300037471 Ga0395905_0024686 Ga0395905_0024686_4109_4702 197
125 3300037471 Ga0395905_0026423 Ga0395905_0026423_3739_4332 197
126 3300050489 nmdc:mga03683_271866_c1 nmdc:mga03683_271866_c1_19_612 197
127 3300053139 Ga0500568_0179995 Ga0500568_0179995_32_625 197
128 3300053158 Ga0500627_0127074 Ga0500627_0127074_286_879 197
129 iso_pu_bacteria 2599185167 2599398463 197
130 iso_pu_bacteria 2599185179 2599450465 197
131 iso_pu_bacteria 2599185288 2599880438 197
132 iso_pu_bacteria 2599185303 2599946832 197
133 iso_pu_bacteria 2675903420 2677896256 197
134 iso_pu_bacteria 2738541294 2738806660 197
135 iso_pu_bacteria 2738541309 2738894020 197
136 iso_pu_bacteria 2808606385 2808979225 197
137 iso_pu_bacteria 2808606388 2808994892 197
138 iso_pu_bacteria 2834028612 2834034130 197
139 iso_pu_bacteria 2852612431 2852614330 197
140 iso_pu_bacteria 2852667396 2852667932 197
141 iso_pu_bacteria 2904615490 2904625161 197
142 iso_pu_bacteria 2931390751 2931393805 197
143 iso_pu_bacteria 2945928738 2945933339 197
144 iso_pu_bacteria 8054285046 8054291403 197
145 iso_pu_bacteria 8056161164 8056165928 197
146 3300005327 Ga0070658_10005670 Ga0070658_100056707 198
147 3300005338 Ga0068868_100387668 Ga0068868_1003876682 198
148 3300005563 Ga0068855_100001791 Ga0068855_10000179117 198
149 3300009036 Ga0105244_10000994 Ga0105244_1000099417 198
150 3300009093 Ga0105240_10120974 Ga0105240_101209743 198
151 3300009545 Ga0105237_10038105 Ga0105237_100381052 198
152 3300009551 Ga0105238_10073547 Ga0105238_100735473 198
153 3300009551 Ga0105238_10621643 Ga0105238_106216431 198
154 3300013102 Ga0157371_10082398 Ga0157371_100823982 198
155 3300013104 Ga0157370_10000343 Ga0157370_1000034329 198
156 3300013104 Ga0157370_10256708 Ga0157370_102567082 198
157 3300013105 Ga0157369_10000228 Ga0157369_1000022821 198
158 3300013105 Ga0157369_10000889 Ga0157369_1000088927 198
159 3300014497 Ga0182008_10116833 Ga0182008_101168331 198
160 3300015261 Ga0182006_1011059 Ga0182006_10110592 198
161 3300016635 Ga0183361_10002 Ga0183361_10002505 198
162 3300021361 Ga0213872_10081500 Ga0213872_100815001 198
163 3300021361 Ga0213872_10175613 Ga0213872_101756132 198
164 3300022467 Ga0224712_10001155 Ga0224712_100011554 198
165 3300025228 Ga0209672_100498 Ga0209672_10049810 198
166 3300025230 Ga0209563_103105 Ga0209563_1031052 198
167 3300025294 Ga0209025_1019450 Ga0209025_10194504 198
168 3300025295 Ga0209564_1000464 Ga0209564_100046410 198
169 3300025297 Ga0209758_1001809 Ga0209758_100180916 198
170 3300025728 Ga0207655_1016388 Ga0207655_10163883 198
171 3300025909 Ga0207705_10003153 Ga0207705_100031537 198
172 3300025914 Ga0207671_10043615 Ga0207671_100436151 198
173 3300025924 Ga0207694_10182391 Ga0207694_101823911 198
174 3300025924 Ga0207694_10474545 Ga0207694_104745452 198
175 3300025949 Ga0207667_10003656 Ga0207667_1000365611 198
176 3300026023 Ga0207677_10454736 Ga0207677_104547362 198
177 3300026067 Ga0207678_10160590 Ga0207678_101605902 198
178 3300031239 Ga0265328_10011154 Ga0265328_100111542 198
179 3300031247 Ga0265340_10019872 Ga0265340_100198724 198
180 3300031250 Ga0265331_10001390 Ga0265331_1000139014 198
181 3300031251 Ga0265327_10000444 Ga0265327_1000044454 198
182 3300031344 Ga0265316_10349537 Ga0265316_103495372 198
183 3300032126 Ga0307415_100959207 Ga0307415_1009592072 198
184 3300037312 Ga0395899_0000036 Ga0395899_0000036_20191_20799 198
185 3300037312 Ga0395899_0021992 Ga0395899_0021992_3787_4407 198
186 3300037312 Ga0395899_0059063 Ga0395899_0059063_1608_2225 198
187 3300037418 Ga0395900_0000071 Ga0395900_0000071_20191_20799 198
188 3300037418 Ga0395900_0000089 Ga0395900_0000089_119833_120450 198
189 3300037418 Ga0395900_0083131 Ga0395900_0083131_2067_2687 198
190 3300037418 Ga0395900_0087345 Ga0395900_0087345_794_1411 198
191 3300037418 Ga0395900_0120673 Ga0395900_0120673_794_1411 198
192 3300037418 Ga0395900_0615326 Ga0395900_0615326_134_751 198
193 3300037466 Ga0395898_0000115 Ga0395898_0000115_6530_7138 198
194 3300037466 Ga0395898_0000195 Ga0395898_0000195_40471_41088 198
195 3300037466 Ga0395898_0014795 Ga0395898_0014795_7273_7890 198
196 3300037466 Ga0395898_0063629 Ga0395898_0063629_224_841 198
197 3300037471 Ga0395905_0000052 Ga0395905_0000052_83173_83793 198
198 3300038443 Ga0395901_0000012 Ga0395901_0000012_124925_125542 198
199 3300038443 Ga0395901_0053865 Ga0395901_0053865_179_796 198
200 3300039438 Ga0436360_0046226 Ga0436360_0046226_117_737 198
201 3300039438 Ga0436360_0558848 Ga0436360_0558848_491_1090 198
202 3300039438 Ga0436360_1038136 Ga0436360_1038136_307_930 198
203 3300039447 Ga0436361_0483826 Ga0436361_0483826_1570_2166 198
204 3300039447 Ga0436361_0530034 Ga0436361_0530034_2031_2630 198
205 3300039447 Ga0436361_0652019 Ga0436361_0652019_2347_2946 198
206 3300039447 Ga0436361_0664565 Ga0436361_0664565_256_861 198
207 3300039447 Ga0436361_0768132 Ga0436361_0768132_781_1380 198
208 3300039450 Ga0436363_1060263 Ga0436363_1060263_30_626 198
209 3300039453 Ga0436362_0818039 Ga0436362_0818039_1079_1684 198
210 3300041486 Ga0451807_0348260 Ga0451807_0348260_1118_1714 198
211 3300041486 Ga0451807_0485987 Ga0451807_0485987_10_606 198
212 3300044658 Ga0466972_0061189 Ga0466972_0061189_512_1129 198
213 3300044684 Ga0466966_0000481 Ga0466966_0000481_24892_25509 198
214 3300044693 Ga0466961_0000153 Ga0466961_0000153_23902_24510 198
215 3300044694 Ga0466963_0380815 Ga0466963_0380815_372_968 198
216 3300044719 Ga0466971_0002580 Ga0466971_0002580_6040_6657 198
217 3300044719 Ga0466971_0186551 Ga0466971_0186551_168_776 198
218 3300044901 Ga0466960_0030295 Ga0466960_0030295_1188_1787 198
219 3300045049 Ga0466959_0435512 Ga0466959_0435512_130_747 198
220 3300045836 Ga0466958_0008080 Ga0466958_0008080_1413_2030 198
221 3300046452 Ga0495617_000005 Ga0495617_000005_318375_318971 198
222 3300046460 Ga0495638_0010017 Ga0495638_0010017_4618_5241 198
223 3300046460 Ga0495638_0030372 Ga0495638_0030372_1684_2280 198
224 3300046463 Ga0495653_0000008 Ga0495653_0000008_124453_125049 198
225 3300046463 Ga0495653_0233106 Ga0495653_0233106_240_836 198
226 3300046471 Ga0495650_0000368 Ga0495650_0000368_43080_43676 198
227 3300046471 Ga0495650_0000397 Ga0495650_0000397_66475_67071 198
228 3300046471 Ga0495650_0002528 Ga0495650_0002528_6591_7187 198
229 3300046474 Ga0495605_0000267 Ga0495605_0000267_18331_18927 198
230 3300046492 Ga0495585_0000717 Ga0495585_0000717_21959_22555 198
231 3300046507 Ga0495606_0000048 Ga0495606_0000048_86938_87534 198
232 3300046507 Ga0495606_0000251 Ga0495606_0000251_39303_39899 198
233 3300046512 Ga0495610_0000007 Ga0495610_0000007_136121_136717 198
234 3300046512 Ga0495610_0018304 Ga0495610_0018304_961_1557 198
235 3300046520 Ga0495637_0001289 Ga0495637_0001289_4690_5286 198
236 3300046524 Ga0495648_0001241 Ga0495648_0001241_17978_18574 198
237 3300046524 Ga0495648_0050840 Ga0495648_0050840_1148_1744 198
238 3300046530 Ga0495654_0000046 Ga0495654_0000046_48558_49154 198
239 3300046530 Ga0495654_0006272 Ga0495654_0006272_3894_4490 198
240 3300046558 Ga0495633_0016118 Ga0495633_0016118_2502_3098 198
241 3300046616 Ga0495668_0000110 Ga0495668_0000110_46263_46859 198
242 3300046616 Ga0495668_0000249 Ga0495668_0000249_16884_17480 198
243 3300046616 Ga0495668_0001091 Ga0495668_0001091_16087_16683 198
244 3300046660 Ga0495625_0000393 Ga0495625_0000393_23434_24057 198
245 3300046660 Ga0495625_0117424 Ga0495625_0117424_1092_1688 198
246 3300046665 Ga0495661_0015075 Ga0495661_0015075_3951_4547 198
247 3300046684 Ga0495669_0181658 Ga0495669_0181658_355_969 198
248 3300046692 Ga0495671_0000056 Ga0495671_0000056_96831_97427 198
249 3300046692 Ga0495671_0113487 Ga0495671_0113487_382_978 198
250 3300047446 Ga0495679_042276 Ga0495679_042276_464_1060 198
251 3300047469 Ga0495673_0000057 Ga0495673_0000057_93747_94343 198
252 3300047469 Ga0495673_0000098 Ga0495673_0000098_62400_62996 198
253 3300047472 Ga0495686_0105501 Ga0495686_0105501_334_930 198
254 3300048919 Ga0496116_0006762 Ga0496116_0006762_7529_8125 198
255 3300048922 Ga0496119_0016966 Ga0496119_0016966_1239_1838 198
256 3300048922 Ga0496119_0113546 Ga0496119_0113546_392_988 198
257 3300048923 Ga0496120_0173435 Ga0496120_0173435_155_754 198
258 3300048924 Ga0496121_0035462 Ga0496121_0035462_2413_3009 198
259 3300048924 Ga0496121_0161508 Ga0496121_0161508_922_1518 198
260 3300048926 Ga0496123_0001453 Ga0496123_0001453_3137_3733 198
261 3300048926 Ga0496123_0187030 Ga0496123_0187030_99_698 198
262 3300048928 Ga0496125_0028124 Ga0496125_0028124_4465_5064 198
263 3300048929 Ga0496126_0019719 Ga0496126_0019719_4544_5140 198
264 3300049570 Ga0501033_0000050 Ga0501033_0000050_63082_63681 198
265 3300049589 Ga0501073_0022131 Ga0501073_0022131_80_679 198
266 3300049742 Ga0501080_0147004 Ga0501080_0147004_523_1122 198
267 3300049822 Ga0501035_0003062 Ga0501035_0003062_5872_6471 198
268 3300053104 Ga0500556_0000074 Ga0500556_0000074_24955_25557 198
269 3300053125 Ga0500618_000078 Ga0500618_000078_38909_39505 198
270 3300053136 Ga0500559_0000001 Ga0500559_0000001_144866_145522 198
271 3300053136 Ga0500559_0021299 Ga0500559_0021299_340_996 198
272 3300053145 Ga0500586_000982 Ga0500586_000982_4545_5141 198
273 3300053163 Ga0500639_040533 Ga0500639_040533_1292_1948 198
274 3300061719 Ga0466962_0007719 Ga0466962_0007719_3743_4360 198
275 3300061719 Ga0466962_0008450 Ga0466962_0008450_408_1016 198
276 iso_pu_bacteria 2513237166 2514051510 198
277 iso_pu_bacteria 2562617112 2563060614 198
278 iso_pu_bacteria 2711768613 2713475791 198
279 iso_pu_bacteria 2921643360 2921653094 198
280 iso_pu_bacteria 642555112 642596227 198
281 3300002738 JGI25154J39366_1001055 JGI25154J39366_10010558 199
282 3300003322 rootL2_10043495 rootL2_100434955 199
283 3300003763 Ga0055529_1000414 Ga0055529_100041410 199
284 3300003771 Ga0055526_1000042 Ga0055526_100004268 199
285 3300005288 Ga0065714_10008226 Ga0065714_100082262 199
286 3300005288 Ga0065714_10202891 Ga0065714_102028911 199
287 3300005289 Ga0065704_10021916 Ga0065704_100219161 199
288 3300005289 Ga0065704_10032612 Ga0065704_100326121 199
289 3300005353 Ga0070669_100001853 Ga0070669_1000018538 199
290 3300005457 Ga0070662_100065180 Ga0070662_1000651802 199
291 3300005539 Ga0068853_100043924 Ga0068853_1000439243 199
292 3300005548 Ga0070665_101284439 Ga0070665_1012844391 199
293 3300005834 Ga0068851_10001064 Ga0068851_100010649 199
294 3300006038 Ga0075365_10165882 Ga0075365_101658822 199
295 3300006042 Ga0075368_10012848 Ga0075368_100128482 199
296 3300006048 Ga0075363_100059212 Ga0075363_1000592122 199
297 3300006048 Ga0075363_100115837 Ga0075363_1001158372 199
298 3300006051 Ga0075364_10014576 Ga0075364_100145764 199
299 3300006177 Ga0075362_10112957 Ga0075362_101129572 199
300 3300006178 Ga0075367_10142277 Ga0075367_101422772 199
301 3300006946 Ga0079104_1022190 Ga0079104_10221902 199
302 3300009011 Ga0105251_10000572 Ga0105251_1000057227 199
303 3300009036 Ga0105244_10009917 Ga0105244_100099175 199
304 3300009092 Ga0105250_10000058 Ga0105250_1000005846 199
305 3300013100 Ga0157373_10000193 Ga0157373_1000019338 199
306 3300013100 Ga0157373_10038749 Ga0157373_100387493 199
307 3300013102 Ga0157371_10002060 Ga0157371_100020606 199
308 3300013104 Ga0157370_10392390 Ga0157370_103923902 199
309 3300013105 Ga0157369_10004655 Ga0157369_100046559 199
310 3300013105 Ga0157369_10016893 Ga0157369_100168937 199
311 3300013306 Ga0163162_10529652 Ga0163162_105296523 199
312 3300013306 Ga0163162_10531334 Ga0163162_105313343 199
313 3300013307 Ga0157372_10473273 Ga0157372_104732732 199
314 3300014497 Ga0182008_10000202 Ga0182008_1000020234 199
315 3300015261 Ga0182006_1000019 Ga0182006_100001949 199
316 3300015261 Ga0182006_1004684 Ga0182006_10046842 199
317 3300015262 Ga0182007_10000237 Ga0182007_1000023726 199
318 3300015265 Ga0182005_1000005 Ga0182005_1000005164 199
319 3300017792 Ga0163161_10016777 Ga0163161_100167776 199
320 3300017792 Ga0163161_10030096 Ga0163161_100300963 199
321 3300017792 Ga0163161_10144952 Ga0163161_101449523 199
322 3300021361 Ga0213872_10000122 Ga0213872_1000012214 199
323 3300021361 Ga0213872_10077678 Ga0213872_100776782 199
324 3300025246 Ga0209646_1000097 Ga0209646_1000097134 199
325 3300025272 Ga0209455_1000047 Ga0209455_100004728 199
326 3300025295 Ga0209564_1000032 Ga0209564_1000032110 199
327 3300025321 Ga0207656_10001219 Ga0207656_100012192 199
328 3300025711 Ga0207696_1000017 Ga0207696_1000017392 199
329 3300025728 Ga0207655_1012009 Ga0207655_10120095 199
330 3300025728 Ga0207655_1054739 Ga0207655_10547391 199
331 3300025735 Ga0207713_1001351 Ga0207713_100135116 199
332 3300025923 Ga0207681_10000430 Ga0207681_1000043022 199
333 3300025933 Ga0207706_10006944 Ga0207706_100069449 199
334 3300026041 Ga0207639_10074026 Ga0207639_100740263 199
335 3300027111 Ga0209281_1028323 Ga0209281_10283232 199
336 3300027312 Ga0209371_1019207 Ga0209371_10192073 199
337 3300028794 Ga0307515_10085058 Ga0307515_100850583 199
338 3300030500 Ga0268256_1021490 Ga0268256_10214902 199
339 3300031730 Ga0307516_10675457 Ga0307516_106754571 199
340 3300032004 Ga0307414_10330911 Ga0307414_103309111 199
341 3300037466 Ga0395898_1093834 Ga0395898_1093834_23_634 199
342 3300039447 Ga0436361_0322493 Ga0436361_0322493_1735_2337 199
343 3300039447 Ga0436361_0813098 Ga0436361_0813098_120650_121276 199
344 3300041404 Ga0439436_0001352 Ga0439436_0001352_1250_1867 199
345 3300041405 Ga0439438_004593 Ga0439438_004593_2197_2814 199
346 3300041407 Ga0439447_000753 Ga0439447_000753_10843_11460 199
347 3300041411 Ga0439466_0006981 Ga0439466_0006981_520_1137 199
348 3300041509 Ga0451843_0449746 Ga0451843_0449746_17_616 199
349 3300041997 Ga0439431_0013338 Ga0439431_0013338_896_1513 199
350 3300042000 Ga0439437_002391 Ga0439437_002391_159_773 199
351 3300042006 Ga0439432_011144 Ga0439432_011144_1713_2330 199
352 3300042010 Ga0439452_012051 Ga0439452_012051_1590_2207 199
353 3300042012 Ga0439455_0008346 Ga0439455_0008346_1109_1723 199
354 3300042013 Ga0439456_016251 Ga0439456_016251_488_1102 199
355 3300042115 Ga0450911_000013 Ga0450911_000013_80194_80808 199
356 3300042139 Ga0450904_000018 Ga0450904_000018_34805_35419 199
357 3300042139 Ga0450904_007887 Ga0450904_007887_408_1022 199
358 3300042156 Ga0439446_0000750 Ga0439446_0000750_3045_3656 199
359 3300042156 Ga0439446_0003852 Ga0439446_0003852_2761_3378 199
360 3300042435 Ga0439434_0002414 Ga0439434_0002414_1433_2050 199
361 3300042438 Ga0439459_0004210 Ga0439459_0004210_1108_1722 199
362 3300042438 Ga0439459_0006997 Ga0439459_0006997_473_1087 199
363 3300042439 Ga0439464_0051285 Ga0439464_0051285_150_764 199
364 3300042532 Ga0450893_0004055 Ga0450893_0004055_1569_2183 199
365 3300046453 Ga0495627_000033 Ga0495627_000033_117029_117634 199
366 3300046457 Ga0495590_0000011 Ga0495590_0000011_188626_189225 199
367 3300046460 Ga0495638_0000080 Ga0495638_0000080_4800_5432 199
368 3300046471 Ga0495650_0000748 Ga0495650_0000748_4436_5068 199
369 3300046501 Ga0495607_0000295 Ga0495607_0000295_29414_30013 199
370 3300046506 Ga0495583_0000076 Ga0495583_0000076_67268_67900 199
371 3300046506 Ga0495583_0000131 Ga0495583_0000131_40778_41386 199
372 3300046507 Ga0495606_0000188 Ga0495606_0000188_11819_12418 199
373 3300046507 Ga0495606_0000757 Ga0495606_0000757_26133_26732 199
374 3300046507 Ga0495606_0002314 Ga0495606_0002314_19138_19737 199
375 3300046512 Ga0495610_0001160 Ga0495610_0001160_9029_9628 199
376 3300046512 Ga0495610_0001725 Ga0495610_0001725_6093_6701 199
377 3300046512 Ga0495610_0002114 Ga0495610_0002114_860_1459 199
378 3300046512 Ga0495610_0019716 Ga0495610_0019716_15_614 199
379 3300046520 Ga0495637_0005155 Ga0495637_0005155_1533_2132 199
380 3300046522 Ga0495643_0000119 Ga0495643_0000119_90695_91294 199
381 3300046522 Ga0495643_0000153 Ga0495643_0000153_43797_44396 199
382 3300046522 Ga0495643_0016480 Ga0495643_0016480_359_961 199
383 3300046523 Ga0495644_0193007 Ga0495644_0193007_53_658 199
384 3300046524 Ga0495648_0000010 Ga0495648_0000010_82907_83539 199
385 3300046524 Ga0495648_0038283 Ga0495648_0038283_2200_2799 199
386 3300046528 Ga0495642_0000269 Ga0495642_0000269_4741_5373 199
387 3300046530 Ga0495654_0000059 Ga0495654_0000059_52334_52942 199
388 3300046530 Ga0495654_0009079 Ga0495654_0009079_1284_1892 199
389 3300046538 Ga0495609_0000576 Ga0495609_0000576_20464_21069 199
390 3300046538 Ga0495609_0006496 Ga0495609_0006496_2024_2656 199
391 3300046538 Ga0495609_0026893 Ga0495609_0026893_1366_1965 199
392 3300046538 Ga0495609_0028325 Ga0495609_0028325_815_1414 199
393 3300046542 Ga0495597_0000043 Ga0495597_0000043_64367_64966 199
394 3300046542 Ga0495597_0000238 Ga0495597_0000238_38055_38654 199
395 3300046557 Ga0495622_0001291 Ga0495622_0001291_7508_8140 199
396 3300046558 Ga0495633_0000076 Ga0495633_0000076_124484_125116 199
397 3300046558 Ga0495633_0000132 Ga0495633_0000132_57376_57975 199
398 3300046558 Ga0495633_0002912 Ga0495633_0002912_4693_5292 199
399 3300046616 Ga0495668_0000045 Ga0495668_0000045_169682_170281 199
400 3300046660 Ga0495625_0000365 Ga0495625_0000365_63737_64369 199
401 3300046660 Ga0495625_0028994 Ga0495625_0028994_441_1040 199
402 3300046660 Ga0495625_0060522 Ga0495625_0060522_842_1441 199
403 3300046660 Ga0495625_0393641 Ga0495625_0393641_71_673 199
404 3300046692 Ga0495671_0018068 Ga0495671_0018068_2003_2629 199
405 3300046694 Ga0495649_0004257 Ga0495649_0004257_5075_5674 199
406 3300046694 Ga0495649_0137724 Ga0495649_0137724_585_1211 199
407 3300046810 Ga0495660_0000418 Ga0495660_0000418_34552_35151 199
408 3300046810 Ga0495660_0000490 Ga0495660_0000490_31120_31725 199
409 3300046810 Ga0495660_0001909 Ga0495660_0001909_7861_8460 199
410 3300047320 Ga0495672_0000113 Ga0495672_0000113_57836_58435 199
411 3300047443 Ga0495687_003608 Ga0495687_003608_10419_11018 199
412 3300047443 Ga0495687_006609 Ga0495687_006609_6409_7008 199
413 3300047445 Ga0495677_0036937 Ga0495677_0036937_438_1037 199
414 3300047469 Ga0495673_0000096 Ga0495673_0000096_70175_70774 199
415 3300047470 Ga0495681_0002240 Ga0495681_0002240_11041_11640 199
416 3300048906 Ga0496103_0002379 Ga0496103_0002379_1703_2302 199
417 3300048914 Ga0496111_0339912 Ga0496111_0339912_82_681 199
418 3300048919 Ga0496116_0113621 Ga0496116_0113621_343_948 199
419 3300048921 Ga0496118_0043225 Ga0496118_0043225_1221_1823 199
420 3300048921 Ga0496118_0045319 Ga0496118_0045319_1722_2324 199
421 3300048924 Ga0496121_0047023 Ga0496121_0047023_1602_2204 199
422 3300048925 Ga0496122_0094569 Ga0496122_0094569_664_1266 199
423 3300048926 Ga0496123_0078475 Ga0496123_0078475_664_1266 199
424 3300048927 Ga0496124_0072705 Ga0496124_0072705_716_1315 199
425 3300048927 Ga0496124_0123458 Ga0496124_0123458_884_1486 199
426 3300048927 Ga0496124_0196443 Ga0496124_0196443_565_1167 199
427 3300048928 Ga0496125_0018918 Ga0496125_0018918_5394_6002 199
428 3300048928 Ga0496125_0026848 Ga0496125_0026848_1611_2213 199
429 3300048928 Ga0496125_0151248 Ga0496125_0151248_560_1168 199
430 3300048928 Ga0496125_0310315 Ga0496125_0310315_292_894 199
431 3300048929 Ga0496126_0023387 Ga0496126_0023387_557_1159 199
432 3300048929 Ga0496126_0235870 Ga0496126_0235870_465_1067 199
433 3300049459 Ga0495678_000001 Ga0495678_000001_293900_294499 199
434 3300049459 Ga0495678_000111 Ga0495678_000111_41377_41976 199
435 3300049459 Ga0495678_005515 Ga0495678_005515_3722_4354 199
436 3300049459 Ga0495678_011057 Ga0495678_011057_2742_3341 199
437 3300049568 Ga0501031_0018082 Ga0501031_0018082_810_1421 199
438 3300049569 Ga0501032_0022029 Ga0501032_0022029_2526_3143 199
439 3300049571 Ga0501034_0064559 Ga0501034_0064559_2070_2687 199
440 3300049766 Ga0501269_000422 Ga0501269_000422_2956_3555 199
441 3300049822 Ga0501035_0168936 Ga0501035_0168936_1206_1817 199
442 3300049853 Ga0501226_000015 Ga0501226_000015_140125_140739 199
443 3300050489 nmdc:mga03683_98961_c1 nmdc:mga03683_98961_c1_421_1020 199
444 3300050490 nmdc:mga03n38_14113_c1 nmdc:mga03n38_14113_c1_1423_2031 199
445 3300050491 nmdc:mga00v17_141842_c1 nmdc:mga00v17_141842_c1_295_903 199
446 3300050494 nmdc:mga06z11_13283_c2 nmdc:mga06z11_13283_c2_1043_1651 199
447 3300050494 nmdc:mga06z11_33095_c1 nmdc:mga06z11_33095_c1_527_1135 199
448 3300053125 Ga0500618_059665 Ga0500618_059665_60_659 199
449 3300053145 Ga0500586_000427 Ga0500586_000427_4699_5298 199
450 3300053153 Ga0500616_0017904 Ga0500616_0017904_817_1461 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

45

228

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oaa-assembly1.cif.gz_B crystal structure of e. coli lactose permease g46w,g262w bound to sugar 0.4455 4 192
8ex5-assembly1.cif.gz_A human s1p transporter spns2 in an outward-facing open conformation (state 4) 0.4299 9 192
6s4m-assembly1.cif.gz_A crystal structure of the human organic anion transporter mfsd10 (tetran) 0.4281 10 194
6yog-assembly1.cif.gz_A structure of peptst from coc imisx setup collected by still serial crystallography on crystals prelocated by 2d x-ray phase-contrast imaging 0.425 12 194
7lo7-assembly1.cif.gz_Z nora in complex with fab25 0.4157 1 187
ID Description Score Start End Superfamily
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5297 2 197 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.522 2 197 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5163 9 187 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4884 9 199 1.20.1250.20
af_Q08299_62_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4841 4 197 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A081K8I2-F1-model_v4 Lysine transporter LysE 0.9552 4 194 GO:0005886
GO:0015171
GO:0033228
AF-A0A1D2UNF9-F1-model_v4 deleted 0.9495 4 195
AF-A0A090QK70-F1-model_v4 Transporter LysE family 0.9476 27 199 GO:0005886
GO:0015171
GO:0033228
AF-A0A4R6TX84-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9469 4 198 GO:0005886
GO:0015171
GO:0033228
AF-A0A800LRT2-F1-model_v4 LysE family translocator 0.9458 1 194 GO:0005886
GO:0015171
GO:0033228

Feature Viewer

pLDDT pTM Quality
90.09 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map