F446570

General Info

Members Datasets Scaffolds Average Seq Length
450 201 900 374

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10036622|Ga0114129_100366222
Length 399
Sequence MCPVAGAVAAGGLAGGQMAEKRDMVQIEALEKYFGEDKERVHVLKGVSLNVPEGSLYTFLGPSGCGKTTTLRCVAGLERPEAGKISIGGQTVYASGERVYVPTNKRPIGMVFQSYAIWPHMTVAENVAYPLTIQRRPREEIKRKVGDVLKIVGLDGLEDRPAPKLSGGQQQRVAFARALVNEPKVMLLDEPLSNLDAKLRVQMRSEIKALQRRTSITTIFVTHDQSEALAISDQIAVMHGGVLIEIGSPHQLYTRPKRRFTATFLGLTNLIDGKVLEADGDGKPAKMETKKGILSFIPSTTLKKDQAAVISIRPENIPLHKQKPQGLDNVLEGTVKEAVFMGDAYQCKVAVGDDLLAVHTHPFNAVSPGDKVFLHLDPGSCNGLPADDRQGIDESMLGD

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 2
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10036622 3300009147 Bacteria 6927
2 2214839659 2209111006 Bacteria 1720
3 Ga0065715_10022614 3300005293 Bacteria 3280
4 Ga0065707_10001720 3300005295 Bacteria 12087
5 Ga0070658_10057048 3300005327 Bacteria 3176
6 Ga0070676_10046349 3300005328 Bacteria 2535
7 Ga0070670_100023386 3300005331 Bacteria 5319
8 Ga0070670_100164313 3300005331 Bacteria 1924
9 Ga0070680_100017497 3300005336 Bacteria 5652
10 Ga0070680_100022714 3300005336 Bacteria 4998
11 Ga0070680_100025808 3300005336 Bacteria 4698
12 Ga0070680_100209057 3300005336 Bacteria 1646
13 Ga0070682_100024644 3300005337 Bacteria 3583
14 Ga0070660_100058969 3300005339 Bacteria 2976
15 Ga0070660_100155649 3300005339 Bacteria 1839
16 Ga0070689_100224458 3300005340 Bacteria 1542
17 Ga0070691_10071023 3300005341 Bacteria 1690
18 Ga0070687_100129470 3300005343 Bacteria 1455
19 Ga0070687_100148032 3300005343 Bacteria 1375
20 Ga0070692_10021476 3300005345 Bacteria 3141
21 Ga0070668_100010770 3300005347 Bacteria 6799
22 Ga0070669_100003408 3300005353 Bacteria 11442
23 Ga0070675_100012664 3300005354 Bacteria 6616
24 Ga0070671_100060431 3300005355 Bacteria 3155
25 Ga0070674_100132117 3300005356 Bacteria 1863
26 Ga0070673_100016306 3300005364 Bacteria 5250
27 Ga0070673_100039961 3300005364 Bacteria 3595
28 Ga0070659_100029900 3300005366 Bacteria 4212
29 Ga0070667_100037243 3300005367 Bacteria 4078
30 Ga0070667_100073288 3300005367 Bacteria 2919
31 Ga0070703_10000653 3300005406 Bacteria 12085
32 Ga0070714_100056826 3300005435 Bacteria 3348
33 Ga0070714_100089217 3300005435 Bacteria 2699
34 Ga0070701_10032378 3300005438 Bacteria 2602
35 Ga0070705_100001312 3300005440 Bacteria 13332
36 Ga0070700_100002886 3300005441 Bacteria 8833
37 Ga0070694_100065026 3300005444 Bacteria 2498
38 Ga0070694_100090099 3300005444 Bacteria 2150
39 Ga0070708_100070748 3300005445 Bacteria 3139
40 Ga0070708_100364973 3300005445 Bacteria 1361
41 Ga0070662_100011251 3300005457 Bacteria 5899
42 Ga0070681_10027246 3300005458 Bacteria 5746
43 Ga0070681_10028792 3300005458 Bacteria 5583
44 Ga0070681_10042494 3300005458 Bacteria 4554
45 Ga0070681_10050452 3300005458 Bacteria 4151
46 Ga0070681_10078760 3300005458 Bacteria 3252
47 Ga0068867_100147303 3300005459 Bacteria 1846
48 Ga0068867_100148598 3300005459 Bacteria 1839
49 Ga0070707_100209697 3300005468 Bacteria 1899
50 Ga0070707_100237839 3300005468 Bacteria 1773
51 Ga0070699_100000345 3300005518 Bacteria 44889
52 Ga0070679_100002236 3300005530 Bacteria 17481
53 Ga0070679_100015687 3300005530 Bacteria 7284
54 Ga0070679_100038559 3300005530 Bacteria 4750
55 Ga0070697_100011945 3300005536 Bacteria 6798
56 Ga0070697_100165599 3300005536 Bacteria 1869
57 Ga0070697_100188366 3300005536 Unclassified 1750
58 Ga0068853_100074352 3300005539 Bacteria 2965
59 Ga0070672_100036820 3300005543 Bacteria 3730
60 Ga0070672_100132965 3300005543 Bacteria 2046
61 Ga0070695_100003331 3300005545 Bacteria 9398
62 Ga0070695_100032668 3300005545 Bacteria 3253
63 Ga0070696_100000049 3300005546 Bacteria 55513
64 Ga0070696_100022706 3300005546 Bacteria 4264
65 Ga0070696_100043718 3300005546 Bacteria 3100
66 Ga0070693_100011624 3300005547 Bacteria 4437
67 Ga0070704_100095743 3300005549 Bacteria 2224
68 Ga0070704_100100956 3300005549 Bacteria 2174
69 Ga0070704_100173270 3300005549 Bacteria 1718
70 Ga0068855_100052633 3300005563 Bacteria 4792
71 Ga0070664_100005233 3300005564 Bacteria 10409
72 Ga0070664_100322727 3300005564 Bacteria 1399
73 Ga0068857_100002870 3300005577 Bacteria 14176
74 Ga0068856_100207992 3300005614 Bacteria 1972
75 Ga0070702_100009812 3300005615 Bacteria 4698
76 Ga0068859_100000552 3300005617 Bacteria 37180
77 Ga0068859_100257674 3300005617 Bacteria 1835
78 Ga0068864_100008659 3300005618 Bacteria 8396
79 Ga0068858_100076610 3300005842 Bacteria 3106
80 Ga0068858_100141630 3300005842 Bacteria 2257
81 Ga0068860_100004203 3300005843 Bacteria 14754
82 Ga0068862_100011218 3300005844 Bacteria 7400
83 Ga0081455_10000905 3300005937 Bacteria 38177
84 Ga0081455_10004536 3300005937 Bacteria 15514
85 Ga0081455_10070000 3300005937 Bacteria 2914
86 Ga0081455_10195648 3300005937 Bacteria 1518
87 Ga0081538_10006009 3300005981 Bacteria 10798
88 Ga0081538_10010064 3300005981 Bacteria 7796
89 Ga0081538_10043372 3300005981 Bacteria 2825
90 Ga0070712_100057036 3300006175 Bacteria 2742
91 Ga0068871_100132584 3300006358 Bacteria 2114
92 Ga0075428_100021585 3300006844 Bacteria 7130
93 Ga0075428_100036608 3300006844 Bacteria 5404
94 Ga0075428_100191099 3300006844 Unclassified 2214
95 Ga0075428_100211257 3300006844 Bacteria 2097
96 Ga0075430_100032980 3300006846 Bacteria 4396
97 Ga0075430_100033790 3300006846 Bacteria 4340
98 Ga0075430_100048886 3300006846 Bacteria 3570
99 Ga0075431_100021938 3300006847 Bacteria 6528
100 Ga0075431_100066945 3300006847 Bacteria 3709
101 Ga0075431_100146275 3300006847 Bacteria 2435
102 Ga0075433_10016804 3300006852 Bacteria 6044
103 Ga0075433_10040888 3300006852 Bacteria 4015
104 Ga0075433_10059308 3300006852 Bacteria 3348
105 Ga0075433_10080137 3300006852 Bacteria 2878
106 Ga0075433_10109978 3300006852 Bacteria 2445
107 Ga0075433_10180304 3300006852 Bacteria 1879
108 Ga0075433_10224411 3300006852 Bacteria 1668
109 Ga0075434_100003707 3300006871 Bacteria 13646
110 Ga0075434_100004807 3300006871 Bacteria 12236
111 Ga0075434_100011406 3300006871 Bacteria 8383
112 Ga0075434_100118741 3300006871 Bacteria 2658
113 Ga0075434_100140187 3300006871 Bacteria 2437
114 Ga0075434_100152000 3300006871 Bacteria 2335
115 Ga0075434_100166016 3300006871 Bacteria 2228
116 Ga0075429_100086659 3300006880 Bacteria 2729
117 Ga0075429_100098481 3300006880 Bacteria 2551
118 Ga0075429_100156072 3300006880 Bacteria 1998
119 Ga0068865_100058874 3300006881 Bacteria 2685
120 Ga0075436_100004143 3300006914 Bacteria 9947
121 Ga0075436_100032420 3300006914 Bacteria 3601
122 Ga0097620_100000552 3300006931 Bacteria 37180
123 Ga0097620_100257678 3300006931 Bacteria 1835
124 Ga0075435_100015160 3300007076 Bacteria 5787
125 Ga0075435_100074101 3300007076 Bacteria 2784
126 Ga0075435_100088170 3300007076 Bacteria 2557
127 Ga0075435_100171785 3300007076 Bacteria 1829
128 Ga0114129_10006717 3300009147 Bacteria 16335
129 Ga0114129_10069217 3300009147 Bacteria 4919
130 Ga0114129_10069553 3300009147 Bacteria 4907
131 Ga0114129_10073769 3300009147 Bacteria 4754
132 Ga0114129_10089120 3300009147 Bacteria 4277
133 Ga0114129_10143369 3300009147 Bacteria 3273
134 Ga0114129_10227719 3300009147 Bacteria 2512
135 Ga0114129_10274378 3300009147 Bacteria 2255
136 Ga0114129_10291525 3300009147 Bacteria 2178
137 Ga0114129_10307342 3300009147 Bacteria 2112
138 Ga0114129_10327071 3300009147 Unclassified 2036
139 Ga0114129_10355657 3300009147 Bacteria 1939
140 Ga0114129_10477027 3300009147 Bacteria 1633
141 Ga0114129_10581340 3300009147 Bacteria 1453
142 Ga0105241_10036903 3300009174 Bacteria 3679
143 Ga0105242_10343826 3300009176 Bacteria 1376
144 Ga0105249_10009067 3300009553 Bacteria 8698
145 Ga0105249_10088367 3300009553 Bacteria 2895
146 Ga0105239_10022099 3300010375 Bacteria 7012
147 Ga0105246_10055167 3300011119 Bacteria 2741
148 Ga0157371_10053211 3300013102 Bacteria 2875
149 Ga0157374_10016773 3300013296 Bacteria 6444
150 Ga0157374_10152679 3300013296 Bacteria 2246
151 Ga0157378_10164273 3300013297 Bacteria 2079
152 Ga0163162_10021342 3300013306 Bacteria 6377
153 Ga0163162_10029579 3300013306 Bacteria 5421
154 Ga0163162_10232913 3300013306 Bacteria 1972
155 Ga0157376_10095270 3300014969 Bacteria 2588
156 Ga0157376_10242491 3300014969 Bacteria 1680
157 Ga0213871_10001636 3300021441 Bacteria 3842
158 Ga0207697_10003634 3300025315 Bacteria 7565
159 Ga0207697_10007890 3300025315 Bacteria 4705
160 Ga0207653_10001487 3300025885 Bacteria 7594
161 Ga0207688_10007463 3300025901 Bacteria 5946
162 Ga0207645_10000674 3300025907 Bacteria 28244
163 Ga0207645_10007228 3300025907 Bacteria 7863
164 Ga0207684_10064642 3300025910 Unclassified 3106
165 Ga0207707_10004449 3300025912 Bacteria 12348
166 Ga0207707_10036206 3300025912 Bacteria 4316
167 Ga0207707_10126753 3300025912 Bacteria 2233
168 Ga0207660_10004737 3300025917 Bacteria 8855
169 Ga0207660_10024186 3300025917 Bacteria 4109
170 Ga0207662_10177628 3300025918 Bacteria 1369
171 Ga0207657_10009977 3300025919 Bacteria 9505
172 Ga0207657_10123265 3300025919 Bacteria 2131
173 Ga0207649_10043870 3300025920 Bacteria 2736
174 Ga0207652_10039206 3300025921 Bacteria 4020
175 Ga0207652_10229858 3300025921 Bacteria 1671
176 Ga0207646_10255381 3300025922 Bacteria 1584
177 Ga0207681_10042767 3300025923 Bacteria 3028
178 Ga0207650_10003471 3300025925 Bacteria 10827
179 Ga0207650_10007147 3300025925 Bacteria 7610
180 Ga0207650_10033769 3300025925 Bacteria 3707
181 Ga0207659_10292333 3300025926 Bacteria 1335
182 Ga0207664_10003692 3300025929 Bacteria 10265
183 Ga0207664_10080287 3300025929 Bacteria 2651
184 Ga0207644_10073035 3300025931 Bacteria 2514
185 Ga0207690_10019975 3300025932 Bacteria 4131
186 Ga0207690_10132465 3300025932 Bacteria 1826
187 Ga0207706_10001623 3300025933 Bacteria 22301
188 Ga0207704_10223145 3300025938 Bacteria 1396
189 Ga0207691_10008379 3300025940 Bacteria 9935
190 Ga0207689_10075105 3300025942 Bacteria 2778
191 Ga0207689_10102613 3300025942 Bacteria 2350
192 Ga0207667_10040800 3300025949 Bacteria 4940
193 Ga0207668_10023629 3300025972 Bacteria 3955
194 Ga0207658_10035094 3300025986 Bacteria 3590
195 Ga0207703_10171043 3300026035 Bacteria 1911
196 Ga0207678_10017399 3300026067 Bacteria 6312
197 Ga0207678_10031600 3300026067 Bacteria 4618
198 Ga0207708_10000637 3300026075 Bacteria 26948
199 Ga0207702_10297601 3300026078 Bacteria 1530
200 Ga0207648_10074105 3300026089 Bacteria 2966
201 Ga0207648_10110956 3300026089 Bacteria 2408
202 Ga0207676_10016087 3300026095 Bacteria 5410
203 Ga0207674_10002522 3300026116 Bacteria 23081
204 Ga0207674_10186646 3300026116 Bacteria 2023
205 Ga0207675_100242087 3300026118 Bacteria 1743
206 Ga0207683_10003175 3300026121 Bacteria 14350
207 Ga0207683_10005245 3300026121 Bacteria 11128
208 Ga0209999_1016256 3300027543 Bacteria 1354
209 Ga0209982_1001847 3300027552 Bacteria 2923
210 Ga0209983_1002625 3300027665 Bacteria 3904
211 Ga0209971_1001452 3300027682 Bacteria 5897
212 Ga0209966_1016323 3300027695 Bacteria 1403
213 Ga0209974_10006632 3300027876 Bacteria 4028
214 Ga0209974_10016872 3300027876 Bacteria 2424
215 Ga0268265_10000577 3300028380 Bacteria 37110
216 Ga0268264_10002952 3300028381 Bacteria 14772
217 Ga0265338_10225020 3300028800 Bacteria 1399
218 Ga0307408_100008157 3300031548 Bacteria 6918
219 Ga0307408_100044227 3300031548 Bacteria 3172
220 Ga0307408_100128881 3300031548 Bacteria 1971
221 Ga0307413_10023277 3300031824 Bacteria 3355
222 Ga0307413_10034436 3300031824 Bacteria 2895
223 Ga0307413_10092884 3300031824 Bacteria 1971
224 Ga0307410_10016200 3300031852 Bacteria 4440
225 Ga0307410_10068239 3300031852 Bacteria 2455
226 Ga0307412_10020653 3300031911 Bacteria 4011
227 Ga0307412_10049865 3300031911 Bacteria 2760
228 Ga0307409_100020720 3300031995 Bacteria 4489
229 Ga0307416_100003721 3300032002 Bacteria 9044
230 Ga0307416_100006304 3300032002 Bacteria 7414
231 Ga0307416_100165071 3300032002 Bacteria 2053
232 Ga0307414_10011629 3300032004 Bacteria 5170
233 Ga0307414_10305898 3300032004 Bacteria 1347
234 Ga0307411_10004184 3300032005 Bacteria 6861
235 Ga0307411_10215331 3300032005 Bacteria 1486
236 Ga0307415_100007908 3300032126 Bacteria 5853
237 Ga0307415_100012192 3300032126 Bacteria 4962
238 Ga0373949_0053797 3300035090 Bacteria 1020
239 Ga0373945_0016716 3300035116 Bacteria 2478
240 Ga0373946_0020969 3300035171 Bacteria 2530
241 Ga0373942_0021249 3300035207 Bacteria 1636
242 Ga0373935_0003220 3300035692 Bacteria 9426
243 Ga0373935_0026736 3300035692 Bacteria 3565
244 Ga0373937_0051341 3300036401 Bacteria 3780
245 Ga0436360_0574300 3300039438 Bacteria 11535
246 Ga0436361_0945327 3300039447 Bacteria 3240
247 Ga0436361_1012487 3300039447 Bacteria 10320
248 Ga0436363_0442820 3300039450 Bacteria 2983
249 Ga0436362_0577072 3300039453 Bacteria 3722
250 Ga0436362_0694341 3300039453 Bacteria 1974
251 Ga0453683_0000207 3300044673 Bacteria 79577
252 Ga0451576_0110836 3300045051 Bacteria 2856
253 Ga0451576_0177769 3300045051 Bacteria 2222
254 Ga0495580_0007873 3300046472 Bacteria 8526
255 Ga0495580_0038409 3300046472 Bacteria 3429
256 Ga0495585_0176682 3300046492 Bacteria 1100
257 Ga0495586_0140837 3300046535 Bacteria 1354
258 Ga0495674_0269354 3300047319 Bacteria 1398
259 Ga0496101_0016422 3300048904 Bacteria 5001
260 Ga0496102_0003007 3300048905 Bacteria 14280
261 Ga0496102_0374893 3300048905 Bacteria 1339
262 Ga0496103_0066060 3300048906 Bacteria 2257
263 Ga0496105_0193821 3300048908 Bacteria 1661
264 Ga0496106_0016293 3300048909 Bacteria 5500
265 Ga0496106_0041680 3300048909 Bacteria 3441
266 Ga0496112_0074851 3300048915 Bacteria 3349
267 Ga0496112_0204232 3300048915 Bacteria 1934
268 Ga0501031_0015231 3300049568 Bacteria 4992
269 Ga0501031_0186029 3300049568 Bacteria 1356
270 Ga0501032_0021166 3300049569 Bacteria 4523
271 Ga0501033_0103690 3300049570 Bacteria 2074
272 Ga0501034_0155860 3300049571 Bacteria 2258
273 Ga0501036_0026399 3300049572 Bacteria 4902
274 Ga0501036_0029604 3300049572 Bacteria 4625
275 Ga0501036_0153745 3300049572 Bacteria 1940
276 Ga0501037_0007087 3300049573 Bacteria 8191
277 Ga0501037_0108637 3300049573 Bacteria 1999
278 Ga0501037_0190702 3300049573 Bacteria 1451
279 Ga0501038_0026998 3300049574 Bacteria 5110
280 Ga0501038_0076292 3300049574 Bacteria 2831
281 Ga0501038_0077433 3300049574 Bacteria 2807
282 Ga0501038_0099216 3300049574 Bacteria 2428
283 Ga0501039_0001351 3300049575 Bacteria 17957
284 Ga0501039_0074649 3300049575 Bacteria 2635
285 Ga0501039_0272834 3300049575 Bacteria 1329
286 Ga0501040_0000609 3300049576 Bacteria 21878
287 Ga0501040_0006663 3300049576 Bacteria 7500
288 Ga0501040_0041210 3300049576 Bacteria 3145
289 Ga0501040_0117103 3300049576 Bacteria 1867
290 Ga0501040_0127965 3300049576 Bacteria 1784
291 Ga0501041_0003454 3300049577 Bacteria 9093
292 Ga0501041_0012702 3300049577 Bacteria 4990
293 Ga0501042_0001221 3300049578 Bacteria 14929
294 Ga0501042_0011705 3300049578 Bacteria 5927
295 Ga0501043_0021450 3300049579 Bacteria 5064
296 Ga0501043_0151885 3300049579 Bacteria 1812
297 Ga0501043_0153993 3300049579 Bacteria 1798
298 Ga0501043_0279835 3300049579 Bacteria 1279
299 Ga0501046_0000104 3300049580 Bacteria 89700
300 Ga0501046_0014792 3300049580 Bacteria 6570
301 Ga0501046_0072966 3300049580 Bacteria 2664
302 Ga0501046_0132176 3300049580 Bacteria 1892
303 Ga0501048_0012125 3300049582 Bacteria 6422
304 Ga0501048_0030696 3300049582 Bacteria 3889
305 Ga0501048_0031692 3300049582 Bacteria 3823
306 Ga0501048_0039916 3300049582 Bacteria 3365
307 Ga0501048_0071907 3300049582 Bacteria 2442
308 Ga0501068_0011908 3300049584 Bacteria 4918
309 Ga0501068_0015412 3300049584 Bacteria 4389
310 Ga0501068_0049390 3300049584 Bacteria 2541
311 Ga0501069_0133869 3300049585 Bacteria 1420
312 Ga0501070_0072095 3300049586 Bacteria 2859
313 Ga0501070_0125510 3300049586 Bacteria 2121
314 Ga0501070_0210429 3300049586 Bacteria 1596
315 Ga0501070_0213126 3300049586 Bacteria 1585
316 Ga0501071_0001228 3300049587 Bacteria 14495
317 Ga0501071_0006044 3300049587 Bacteria 7843
318 Ga0501071_0045732 3300049587 Bacteria 3142
319 Ga0501071_0109732 3300049587 Bacteria 2038
320 Ga0501071_0141318 3300049587 Bacteria 1793
321 Ga0501072_0020708 3300049588 Bacteria 5097
322 Ga0501072_0057111 3300049588 Bacteria 3075
323 Ga0501072_0075883 3300049588 Bacteria 2659
324 Ga0501072_0173820 3300049588 Bacteria 1718
325 Ga0501073_0129540 3300049589 Bacteria 1749
326 Ga0501074_0025308 3300049590 Bacteria 4311
327 Ga0501074_0025430 3300049590 Bacteria 4300
328 Ga0501074_0113134 3300049590 Bacteria 1942
329 Ga0501075_0001407 3300049591 Bacteria 15667
330 Ga0501075_0011189 3300049591 Bacteria 6343
331 Ga0501075_0011268 3300049591 Bacteria 6326
332 Ga0501075_0045870 3300049591 Bacteria 3282
333 Ga0501075_0088779 3300049591 Bacteria 2344
334 Ga0501075_0099545 3300049591 Bacteria 2207
335 Ga0501075_0196836 3300049591 Bacteria 1537
336 Ga0501076_0039756 3300049592 Bacteria 3694
337 Ga0501076_0063755 3300049592 Bacteria 2937
338 Ga0501076_0069632 3300049592 Bacteria 2811
339 Ga0501076_0171837 3300049592 Bacteria 1766
340 Ga0501077_0000922 3300049593 Bacteria 17681
341 Ga0501077_0001111 3300049593 Bacteria 16215
342 Ga0501077_0031035 3300049593 Bacteria 3399
343 Ga0501077_0044584 3300049593 Bacteria 2817
344 Ga0501079_0002163 3300049741 Bacteria 14160
345 Ga0501079_0042487 3300049741 Bacteria 3509
346 Ga0501079_0042600 3300049741 Bacteria 3505
347 Ga0501079_0049465 3300049741 Bacteria 3244
348 Ga0501079_0052042 3300049741 Bacteria 3162
349 Ga0501080_0063725 3300049742 Bacteria 3430
350 Ga0501080_0138577 3300049742 Bacteria 2250
351 Ga0501080_0216007 3300049742 Bacteria 1756
352 Ga0501081_0000756 3300049743 Bacteria 18924
353 Ga0501081_0008939 3300049743 Bacteria 6510
354 Ga0501081_0010269 3300049743 Bacteria 6113
355 Ga0501081_0070351 3300049743 Bacteria 2438
356 Ga0501081_0123267 3300049743 Bacteria 1848
357 Ga0501081_0257791 3300049743 Bacteria 1274
358 Ga0501083_0021880 3300049744 Bacteria 4440
359 Ga0501083_0054679 3300049744 Bacteria 2678
360 Ga0501035_0082960 3300049822 Bacteria 2828
361 Ga0501035_0114662 3300049822 Bacteria 2359
362 Ga0501044_0022201 3300049823 Bacteria 6764
363 Ga0501044_0115281 3300049823 Bacteria 2692
364 Ga0501044_0345638 3300049823 Bacteria 1408
365 Ga0501045_0000512 3300049824 Bacteria 24143
366 Ga0501045_0118639 3300049824 Bacteria 1964
367 Ga0501045_0203722 3300049824 Bacteria 1474
368 nmdc:mga0yw44_50498_c1 3300050492 Bacteria 2515
369 nmdc:mga05p37_11879_c1 3300050507 Bacteria 10383
370 nmdc:mga05p37_119973_c1 3300050507 Bacteria 3231
371 nmdc:mga05p37_124875_c1 3300050507 Bacteria 3161
372 nmdc:mga05p37_2036_c1 3300050507 Bacteria 23578
373 nmdc:mga05p37_252566_c1 3300050507 Bacteria 2114
374 nmdc:mga05p37_28750_c1 3300050507 Bacteria 6782
375 nmdc:mga05p37_297632_c1 3300050507 Bacteria 1918
376 nmdc:mga05p37_3195_c1 3300050507 Bacteria 19065
377 nmdc:mga05p37_369057_c1 3300050507 Bacteria 1685
378 nmdc:mga05p37_385655_c1 3300050507 Bacteria 1640
379 nmdc:mga05p37_43018_c1 3300050507 Bacteria 5554
380 nmdc:mga05p37_45737_c1 3300050507 Bacteria 5382
381 nmdc:mga05p37_4970_c1 3300050507 Bacteria 15581
382 nmdc:mga05p37_507837_c1 3300050507 Bacteria 1382
383 nmdc:mga05p37_68323_c1 3300050507 Bacteria 4370
384 nmdc:mga05p37_75869_c1 3300050507 Bacteria 4139
385 nmdc:mga09592_124472_c1 3300050508 Bacteria 2216
386 nmdc:mga09592_196934_c1 3300050508 Bacteria 1744
387 nmdc:mga09592_218836_c1 3300050508 Bacteria 1650
388 nmdc:mga09592_311689_c1 3300050508 Bacteria 1364
389 nmdc:mga09592_98645_c1 3300050508 Bacteria 2501
390 nmdc:mga0qj67_106926_c1 3300050509 Bacteria 2257
391 nmdc:mga0qj67_151602_c1 3300050509 Bacteria 1881
392 nmdc:mga0qj67_9591_c1 3300050509 Bacteria 7215
393 nmdc:mga06r32_14361_c1 3300050510 Bacteria 7188
394 nmdc:mga06r32_398386_c1 3300050510 Bacteria 1359
395 nmdc:mga06r32_40457_c1 3300050510 Bacteria 4426
396 nmdc:mga06r32_40458_c1 3300050510 Bacteria 4426
397 nmdc:mga06r32_64157_c1 3300050510 Bacteria 3541
398 nmdc:mga06r32_97793_c1 3300050510 Bacteria 2877
399 nmdc:mga08y16_28886_c2 3300050511 Bacteria 5367
400 nmdc:mga08y16_71390_c1 3300050511 Bacteria 3619
401 nmdc:mga0n895_103516_c1 3300050512 Bacteria 2859
402 nmdc:mga0n895_111886_c1 3300050512 Bacteria 2747
403 nmdc:mga0n895_147890_c1 3300050512 Bacteria 2379
404 nmdc:mga0n895_149379_c1 3300050512 Bacteria 2366
405 nmdc:mga0n895_20452_c1 3300050512 Bacteria 6174
406 nmdc:mga0n895_210470_c1 3300050512 Unclassified 1975
407 nmdc:mga0n895_514716_c1 3300050512 Bacteria 1205
408 nmdc:mga0n895_88487_c1 3300050512 Bacteria 3097
409 nmdc:mga0rr50_103778_c1 3300050513 Bacteria 2238
410 nmdc:mga0rr50_236230_c1 3300050513 Bacteria 1514
411 nmdc:mga0rr50_28368_c1 3300050513 Bacteria 3934
412 nmdc:mga0rr50_79777_c1 3300050513 Bacteria 2522
413 nmdc:mga0rr50_88383_c1 3300050513 Bacteria 2407
414 nmdc:mga08x19_68227_c1 3300050514 Bacteria 2314
415 nmdc:mga0a205_122110_c1 3300050515 Bacteria 2505
416 nmdc:mga0a205_123624_c1 3300050515 Bacteria 2487
417 nmdc:mga0a205_125930_c1 3300050515 Bacteria 2461
418 nmdc:mga0a205_187831_c1 3300050515 Bacteria 1959
419 nmdc:mga0a205_19570_c1 3300050515 Bacteria 6385
420 nmdc:mga0a205_20456_c2 3300050515 Bacteria 2696
421 nmdc:mga0a205_215351_c1 3300050515 Bacteria 1808
422 nmdc:mga0a205_332936_c1 3300050515 Bacteria 1388
423 nmdc:mga0a205_4004_c1 3300050515 Bacteria 13176
424 nmdc:mga0a205_6905_c1 3300050515 Bacteria 10265
425 nmdc:mga0a205_87623_c1 3300050515 Bacteria 3008
426 nmdc:mga0a205_89733_c1 3300050515 Bacteria 2971
427 nmdc:mga0a205_92799_c1 3300050515 Bacteria 2917
428 Ga0495595_0085840 3300053084 Bacteria 1505
429 Ga0500566_0000981 3300053094 Bacteria 16437
430 Ga0501084_0007447 3300054114 Bacteria 9022
431 Ga0501084_0059915 3300054114 Bacteria 3187
432 Ga0501084_0071352 3300054114 Bacteria 2908
433 Ga0501084_0475707 3300054114 Bacteria 1056
434 Ga0590071_004333 3300059421 Bacteria 3451
435 Ga0590071_016004 3300059421 Bacteria 1759
436 Ga0590075_004580 3300059424 Bacteria 3275
437 Ga0590077_001803 3300059426 Bacteria 4796
438 Ga0590077_006862 3300059426 Bacteria 2333
439 Ga0501082_0022733 3300060353 Bacteria 5399
440 Ga0501082_0048610 3300060353 Bacteria 3656
441 Ga0501082_0061266 3300060353 Bacteria 3239
442 Ga0501082_0113741 3300060353 Bacteria 2343
443 Ga0501082_0118884 3300060353 Bacteria 2290
444 Ga0501082_0156776 3300060353 Bacteria 1978
445 Ga0530510_0013495 3300061734 Bacteria 5744
446 Ga0530510_0026705 3300061734 Bacteria 4134
447 Ga0530510_0048087 3300061734 Bacteria 3083
448 Ga0530510_0071629 3300061734 Bacteria 2515
449 Ga0530510_0103257 3300061734 Bacteria 2085
450 8001845566 8001845381 Bacteria 5804942
451 Ga0114129_10036622
452 2214839659
453 Ga0065715_10022614
454 Ga0065707_10001720
455 Ga0070658_10057048
456 Ga0070676_10046349
457 Ga0070670_100023386
458 Ga0070670_100164313
459 Ga0070680_100017497
460 Ga0070680_100022714
461 Ga0070680_100025808
462 Ga0070680_100209057
463 Ga0070682_100024644
464 Ga0070660_100058969
465 Ga0070660_100155649
466 Ga0070689_100224458
467 Ga0070691_10071023
468 Ga0070687_100129470
469 Ga0070687_100148032
470 Ga0070692_10021476
471 Ga0070668_100010770
472 Ga0070669_100003408
473 Ga0070675_100012664
474 Ga0070671_100060431
475 Ga0070674_100132117
476 Ga0070673_100016306
477 Ga0070673_100039961
478 Ga0070659_100029900
479 Ga0070667_100037243
480 Ga0070667_100073288
481 Ga0070703_10000653
482 Ga0070714_100056826
483 Ga0070714_100089217
484 Ga0070701_10032378
485 Ga0070705_100001312
486 Ga0070700_100002886
487 Ga0070694_100065026
488 Ga0070694_100090099
489 Ga0070708_100070748
490 Ga0070708_100364973
491 Ga0070662_100011251
492 Ga0070681_10027246
493 Ga0070681_10028792
494 Ga0070681_10042494
495 Ga0070681_10050452
496 Ga0070681_10078760
497 Ga0068867_100147303
498 Ga0068867_100148598
499 Ga0070707_100209697
500 Ga0070707_100237839
501 Ga0070699_100000345
502 Ga0070679_100002236
503 Ga0070679_100015687
504 Ga0070679_100038559
505 Ga0070697_100011945
506 Ga0070697_100165599
507 Ga0070697_100188366
508 Ga0068853_100074352
509 Ga0070672_100036820
510 Ga0070672_100132965
511 Ga0070695_100003331
512 Ga0070695_100032668
513 Ga0070696_100000049
514 Ga0070696_100022706
515 Ga0070696_100043718
516 Ga0070693_100011624
517 Ga0070704_100095743
518 Ga0070704_100100956
519 Ga0070704_100173270
520 Ga0068855_100052633
521 Ga0070664_100005233
522 Ga0070664_100322727
523 Ga0068857_100002870
524 Ga0068856_100207992
525 Ga0070702_100009812
526 Ga0068859_100000552
527 Ga0068859_100257674
528 Ga0068864_100008659
529 Ga0068858_100076610
530 Ga0068858_100141630
531 Ga0068860_100004203
532 Ga0068862_100011218
533 Ga0081455_10000905
534 Ga0081455_10004536
535 Ga0081455_10070000
536 Ga0081455_10195648
537 Ga0081538_10006009
538 Ga0081538_10010064
539 Ga0081538_10043372
540 Ga0070712_100057036
541 Ga0068871_100132584
542 Ga0075428_100021585
543 Ga0075428_100036608
544 Ga0075428_100191099
545 Ga0075428_100211257
546 Ga0075430_100032980
547 Ga0075430_100033790
548 Ga0075430_100048886
549 Ga0075431_100021938
550 Ga0075431_100066945
551 Ga0075431_100146275
552 Ga0075433_10016804
553 Ga0075433_10040888
554 Ga0075433_10059308
555 Ga0075433_10080137
556 Ga0075433_10109978
557 Ga0075433_10180304
558 Ga0075433_10224411
559 Ga0075434_100003707
560 Ga0075434_100004807
561 Ga0075434_100011406
562 Ga0075434_100118741
563 Ga0075434_100140187
564 Ga0075434_100152000
565 Ga0075434_100166016
566 Ga0075429_100086659
567 Ga0075429_100098481
568 Ga0075429_100156072
569 Ga0068865_100058874
570 Ga0075436_100004143
571 Ga0075436_100032420
572 Ga0097620_100000552
573 Ga0097620_100257678
574 Ga0075435_100015160
575 Ga0075435_100074101
576 Ga0075435_100088170
577 Ga0075435_100171785
578 Ga0114129_10006717
579 Ga0114129_10069217
580 Ga0114129_10069553
581 Ga0114129_10073769
582 Ga0114129_10089120
583 Ga0114129_10143369
584 Ga0114129_10227719
585 Ga0114129_10274378
586 Ga0114129_10291525
587 Ga0114129_10307342
588 Ga0114129_10327071
589 Ga0114129_10355657
590 Ga0114129_10477027
591 Ga0114129_10581340
592 Ga0105241_10036903
593 Ga0105242_10343826
594 Ga0105249_10009067
595 Ga0105249_10088367
596 Ga0105239_10022099
597 Ga0105246_10055167
598 Ga0157371_10053211
599 Ga0157374_10016773
600 Ga0157374_10152679
601 Ga0157378_10164273
602 Ga0163162_10021342
603 Ga0163162_10029579
604 Ga0163162_10232913
605 Ga0157376_10095270
606 Ga0157376_10242491
607 Ga0213871_10001636
608 Ga0207697_10003634
609 Ga0207697_10007890
610 Ga0207653_10001487
611 Ga0207688_10007463
612 Ga0207645_10000674
613 Ga0207645_10007228
614 Ga0207684_10064642
615 Ga0207707_10004449
616 Ga0207707_10036206
617 Ga0207707_10126753
618 Ga0207660_10004737
619 Ga0207660_10024186
620 Ga0207662_10177628
621 Ga0207657_10009977
622 Ga0207657_10123265
623 Ga0207649_10043870
624 Ga0207652_10039206
625 Ga0207652_10229858
626 Ga0207646_10255381
627 Ga0207681_10042767
628 Ga0207650_10003471
629 Ga0207650_10007147
630 Ga0207650_10033769
631 Ga0207659_10292333
632 Ga0207664_10003692
633 Ga0207664_10080287
634 Ga0207644_10073035
635 Ga0207690_10019975
636 Ga0207690_10132465
637 Ga0207706_10001623
638 Ga0207704_10223145
639 Ga0207691_10008379
640 Ga0207689_10075105
641 Ga0207689_10102613
642 Ga0207667_10040800
643 Ga0207668_10023629
644 Ga0207658_10035094
645 Ga0207703_10171043
646 Ga0207678_10017399
647 Ga0207678_10031600
648 Ga0207708_10000637
649 Ga0207702_10297601
650 Ga0207648_10074105
651 Ga0207648_10110956
652 Ga0207676_10016087
653 Ga0207674_10002522
654 Ga0207674_10186646
655 Ga0207675_100242087
656 Ga0207683_10003175
657 Ga0207683_10005245
658 Ga0209999_1016256
659 Ga0209982_1001847
660 Ga0209983_1002625
661 Ga0209971_1001452
662 Ga0209966_1016323
663 Ga0209974_10006632
664 Ga0209974_10016872
665 Ga0268265_10000577
666 Ga0268264_10002952
667 Ga0265338_10225020
668 Ga0307408_100008157
669 Ga0307408_100044227
670 Ga0307408_100128881
671 Ga0307413_10023277
672 Ga0307413_10034436
673 Ga0307413_10092884
674 Ga0307410_10016200
675 Ga0307410_10068239
676 Ga0307412_10020653
677 Ga0307412_10049865
678 Ga0307409_100020720
679 Ga0307416_100003721
680 Ga0307416_100006304
681 Ga0307416_100165071
682 Ga0307414_10011629
683 Ga0307414_10305898
684 Ga0307411_10004184
685 Ga0307411_10215331
686 Ga0307415_100007908
687 Ga0307415_100012192
688 Ga0373949_0053797
689 Ga0373945_0016716
690 Ga0373946_0020969
691 Ga0373942_0021249
692 Ga0373935_0003220
693 Ga0373935_0026736
694 Ga0373937_0051341
695 Ga0436360_0574300
696 Ga0436361_0945327
697 Ga0436361_1012487
698 Ga0436363_0442820
699 Ga0436362_0577072
700 Ga0436362_0694341
701 Ga0453683_0000207
702 Ga0451576_0110836
703 Ga0451576_0177769
704 Ga0495580_0007873
705 Ga0495580_0038409
706 Ga0495585_0176682
707 Ga0495586_0140837
708 Ga0495674_0269354
709 Ga0496101_0016422
710 Ga0496102_0003007
711 Ga0496102_0374893
712 Ga0496103_0066060
713 Ga0496105_0193821
714 Ga0496106_0016293
715 Ga0496106_0041680
716 Ga0496112_0074851
717 Ga0496112_0204232
718 Ga0501031_0015231
719 Ga0501031_0186029
720 Ga0501032_0021166
721 Ga0501033_0103690
722 Ga0501034_0155860
723 Ga0501036_0026399
724 Ga0501036_0029604
725 Ga0501036_0153745
726 Ga0501037_0007087
727 Ga0501037_0108637
728 Ga0501037_0190702
729 Ga0501038_0026998
730 Ga0501038_0076292
731 Ga0501038_0077433
732 Ga0501038_0099216
733 Ga0501039_0001351
734 Ga0501039_0074649
735 Ga0501039_0272834
736 Ga0501040_0000609
737 Ga0501040_0006663
738 Ga0501040_0041210
739 Ga0501040_0117103
740 Ga0501040_0127965
741 Ga0501041_0003454
742 Ga0501041_0012702
743 Ga0501042_0001221
744 Ga0501042_0011705
745 Ga0501043_0021450
746 Ga0501043_0151885
747 Ga0501043_0153993
748 Ga0501043_0279835
749 Ga0501046_0000104
750 Ga0501046_0014792
751 Ga0501046_0072966
752 Ga0501046_0132176
753 Ga0501048_0012125
754 Ga0501048_0030696
755 Ga0501048_0031692
756 Ga0501048_0039916
757 Ga0501048_0071907
758 Ga0501068_0011908
759 Ga0501068_0015412
760 Ga0501068_0049390
761 Ga0501069_0133869
762 Ga0501070_0072095
763 Ga0501070_0125510
764 Ga0501070_0210429
765 Ga0501070_0213126
766 Ga0501071_0001228
767 Ga0501071_0006044
768 Ga0501071_0045732
769 Ga0501071_0109732
770 Ga0501071_0141318
771 Ga0501072_0020708
772 Ga0501072_0057111
773 Ga0501072_0075883
774 Ga0501072_0173820
775 Ga0501073_0129540
776 Ga0501074_0025308
777 Ga0501074_0025430
778 Ga0501074_0113134
779 Ga0501075_0001407
780 Ga0501075_0011189
781 Ga0501075_0011268
782 Ga0501075_0045870
783 Ga0501075_0088779
784 Ga0501075_0099545
785 Ga0501075_0196836
786 Ga0501076_0039756
787 Ga0501076_0063755
788 Ga0501076_0069632
789 Ga0501076_0171837
790 Ga0501077_0000922
791 Ga0501077_0001111
792 Ga0501077_0031035
793 Ga0501077_0044584
794 Ga0501079_0002163
795 Ga0501079_0042487
796 Ga0501079_0042600
797 Ga0501079_0049465
798 Ga0501079_0052042
799 Ga0501080_0063725
800 Ga0501080_0138577
801 Ga0501080_0216007
802 Ga0501081_0000756
803 Ga0501081_0008939
804 Ga0501081_0010269
805 Ga0501081_0070351
806 Ga0501081_0123267
807 Ga0501081_0257791
808 Ga0501083_0021880
809 Ga0501083_0054679
810 Ga0501035_0082960
811 Ga0501035_0114662
812 Ga0501044_0022201
813 Ga0501044_0115281
814 Ga0501044_0345638
815 Ga0501045_0000512
816 Ga0501045_0118639
817 Ga0501045_0203722
818 nmdc:mga0yw44_50498_c1
819 nmdc:mga05p37_11879_c1
820 nmdc:mga05p37_119973_c1
821 nmdc:mga05p37_124875_c1
822 nmdc:mga05p37_2036_c1
823 nmdc:mga05p37_252566_c1
824 nmdc:mga05p37_28750_c1
825 nmdc:mga05p37_297632_c1
826 nmdc:mga05p37_3195_c1
827 nmdc:mga05p37_369057_c1
828 nmdc:mga05p37_385655_c1
829 nmdc:mga05p37_43018_c1
830 nmdc:mga05p37_45737_c1
831 nmdc:mga05p37_4970_c1
832 nmdc:mga05p37_507837_c1
833 nmdc:mga05p37_68323_c1
834 nmdc:mga05p37_75869_c1
835 nmdc:mga09592_124472_c1
836 nmdc:mga09592_196934_c1
837 nmdc:mga09592_218836_c1
838 nmdc:mga09592_311689_c1
839 nmdc:mga09592_98645_c1
840 nmdc:mga0qj67_106926_c1
841 nmdc:mga0qj67_151602_c1
842 nmdc:mga0qj67_9591_c1
843 nmdc:mga06r32_14361_c1
844 nmdc:mga06r32_398386_c1
845 nmdc:mga06r32_40457_c1
846 nmdc:mga06r32_40458_c1
847 nmdc:mga06r32_64157_c1
848 nmdc:mga06r32_97793_c1
849 nmdc:mga08y16_28886_c2
850 nmdc:mga08y16_71390_c1
851 nmdc:mga0n895_103516_c1
852 nmdc:mga0n895_111886_c1
853 nmdc:mga0n895_147890_c1
854 nmdc:mga0n895_149379_c1
855 nmdc:mga0n895_20452_c1
856 nmdc:mga0n895_210470_c1
857 nmdc:mga0n895_514716_c1
858 nmdc:mga0n895_88487_c1
859 nmdc:mga0rr50_103778_c1
860 nmdc:mga0rr50_236230_c1
861 nmdc:mga0rr50_28368_c1
862 nmdc:mga0rr50_79777_c1
863 nmdc:mga0rr50_88383_c1
864 nmdc:mga08x19_68227_c1
865 nmdc:mga0a205_122110_c1
866 nmdc:mga0a205_123624_c1
867 nmdc:mga0a205_125930_c1
868 nmdc:mga0a205_187831_c1
869 nmdc:mga0a205_19570_c1
870 nmdc:mga0a205_20456_c2
871 nmdc:mga0a205_215351_c1
872 nmdc:mga0a205_332936_c1
873 nmdc:mga0a205_4004_c1
874 nmdc:mga0a205_6905_c1
875 nmdc:mga0a205_87623_c1
876 nmdc:mga0a205_89733_c1
877 nmdc:mga0a205_92799_c1
878 Ga0495595_0085840
879 Ga0500566_0000981
880 Ga0501084_0007447
881 Ga0501084_0059915
882 Ga0501084_0071352
883 Ga0501084_0475707
884 Ga0590071_004333
885 Ga0590071_016004
886 Ga0590075_004580
887 Ga0590077_001803
888 Ga0590077_006862
889 Ga0501082_0022733
890 Ga0501082_0048610
891 Ga0501082_0061266
892 Ga0501082_0113741
893 Ga0501082_0118884
894 Ga0501082_0156776
895 Ga0530510_0013495
896 Ga0530510_0026705
897 Ga0530510_0048087
898 Ga0530510_0071629
899 Ga0530510_0103257
900 8001845566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

193

0.96

PF08402

TOBE_2

TOBE domain

310

384

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gus-assembly1.cif.gz_B mopii from clostridium pasteurianum (apo1) 0.93 312 360
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9157 5 248
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9099 7 248
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9096 8 370
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.909 7 248
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9818 6 231 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9685 6 231 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9634 8 230 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9549 8 249 3.40.50.300
af_Q2G1F0_304_346_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9509 316 353 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.952 6 200 GO:0005524
GO:0016887
AF-Q92ZS1-F1-model_v4 ABC transporter, ATP-binding protein, amino terminus 0.9474 8 180 GO:0005524
GO:0016887
GO:0055052
AF-A0A382FBJ4-F1-model_v4 ABC transporter domain-containing protein 0.9474 89 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7H4SIF3-F1-model_v4 deleted 0.9415 5 166
AF-A0A0P7X7L1-F1-model_v4 Iron(III) transport system ATP-binding protein (EC 3.6.3.30) 0.941 2 370 GO:0005524
GO:0016887
GO:0022857
GO:0043190

Map