F446495

General Info

Members Datasets Scaffolds Average Seq Length
449 288 402 341

Family's Representative Sequence

Representative Sequence 3300053100|Ga0500660_067721|Ga0500660_067721_420_1556
Length 378
Sequence LRPLCARSAWVSISALARIVLDYKSFTDWRTPVIKIAKKHGLATLAAAGLTLAAMAPAHAGKTLDAIKARGQVICGVNVGLAGFSSADSNGAWTGLDVDTCKAIAASVLGDANKVKWVPLNAQQRFTALQSGEVDVLARNTTFSLTRDASLGLHMTAVTYYDGQGFMVPVKSKVKSAKALKNATVCVQSGTTTEKNLTDFSKANNLNMKPVVFEKQEAVNAAYFSGRCQAYTTDASGLASVRNKEAKVPADHLILPELISKEPLGPMVRRGDDEWFAIVKWVVYGLIEAEEYGVTQANVDAMTKDSKDPVVMRLTGSGEDTGKLLGLDKEWLVRAVKAVGNYGEIFERNVGPKTPLALPRGQNNQWNKGGQMYAMPVR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2643221717 Acidovorax sp. Root267 Isolate Unclassified
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738541307 Variovorax sp. GV008 Isolate Unclassified
17 2738543012 Acidovorax sp. CF301 Isolate Unclassified
18 2738543019 Variovorax sp. GV040 Isolate Unclassified
19 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
20 2816332133 Acidovorax radicis 2721A Isolate Unclassified
21 2818991446 Variovorax sp. 1180 Isolate Unclassified
22 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
23 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
24 2842677519 Variovorax sp. R-72495 Isolate Unclassified
25 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
26 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2885211737 Variovorax sp. 553 Isolate Unclassified
29 2899924645 Variovorax sp. 369 Isolate Unclassified
30 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
31 2904456579 Variovorax sp. 2002 Isolate Unclassified
32 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
33 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
34 2928037797 Variovorax sp. 1126 Isolate Unclassified
35 2928044640 Variovorax sp. 1128 Isolate Unclassified
36 2928051484 Variovorax sp. 1133 Isolate Unclassified
37 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
38 2928070936 Variovorax gossypii 1167 Isolate Unclassified
39 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
40 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
41 2929520902 Variovorax beijingensis 502 Isolate Unclassified
42 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
43 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
44 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
45 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
46 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
47 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
48 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
49 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
52 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
53 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
54 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
61 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
62 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
65 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
66 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
67 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
73 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
74 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
181 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
182 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
183 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
184 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
185 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
186 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
207 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
208 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
209 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
210 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
211 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
268 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
269 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
274 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
282 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
283 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 0
Isolates 10.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.75
Nodule 0.89
Rhizoplane 1.11
Rhizosphere 46.99
Stem 0
Stem Tuber 0
Unclassified 12.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000009 3300002704 Bacteria 224358
2 JGI25156J39149_1000009 3300002705 Bacteria 224379
3 JGI25154J39366_1000024 3300002738 Bacteria 211372
4 JGI25158J39367_1007303 3300002739 Bacteria 1561
5 JGI25157J39369_1000007 3300002741 Bacteria 224377
6 JGI25152J39213_1003701 3300002773 Bacteria 5128
7 JGI25150J39212_1001859 3300002774 Bacteria 5576
8 JGI25159J45721_1000546 3300002987 Bacteria 17108
9 JGI25159J45721_1003871 3300002987 Bacteria 5128
10 JGI25159J45721_1004681 3300002987 Bacteria 4471
11 JGI25151J46595_10002356 3300003187 Bacteria 11484
12 JGI25151J46595_10007640 3300003187 Bacteria 5275
13 JGI25151J46595_10013840 3300003187 Bacteria 3617
14 JGI25153J46596_10007642 3300003215 Bacteria 5275
15 JGI25153J46596_10010817 3300003215 Bacteria 4090
16 rootH1_10037382 3300003316 Bacteria 3911
17 JGI25160J50197_1000117 3300003354 Bacteria 72240
18 JGI25160J50197_1005635 3300003354 Bacteria 5183
19 JGI25160J50197_1008233 3300003354 Bacteria 3990
20 JGI25161J50226_1000009 3300003374 Bacteria 224699
21 JGI25161J50226_1002188 3300003374 Bacteria 5207
22 JGI25161J50226_1005799 3300003374 Bacteria 2329
23 Ga0055535_1000520 3300003761 Bacteria 33578
24 Ga0055542_1000021 3300003762 Bacteria 331499
25 Ga0055526_1007648 3300003771 Bacteria 5571
26 Ga0055526_1008775 3300003771 Bacteria 4979
27 Ga0055526_1009223 3300003771 Bacteria 4786
28 Ga0055537_1000020 3300003773 Bacteria 117325
29 Ga0055537_1000285 3300003773 Bacteria 36115
30 Ga0055537_1003192 3300003773 Bacteria 5122
31 Ga0055537_1006280 3300003773 Bacteria 3042
32 Ga0055524_1000047 3300003775 Bacteria 150887
33 Ga0055524_1006369 3300003775 Bacteria 5122
34 Ga0055524_1006386 3300003775 Bacteria 5114
35 Ga0055536_1000972 3300003781 Bacteria 18246
36 Ga0055536_1002662 3300003781 Bacteria 9905
37 Ga0055534_1000018 3300003784 Bacteria 138136
38 Ga0055534_1002128 3300003784 Bacteria 7106
39 Ga0055534_1003298 3300003784 Bacteria 5122
40 Ga0055528_1000509 3300003790 Bacteria 30550
41 Ga0055528_1006838 3300003790 Bacteria 5122
42 Ga0055528_1013772 3300003790 Bacteria 3042
43 Ga0055530_10004362 3300003791 Bacteria 7334
44 Ga0055540_1000027 3300003792 Bacteria 187454
45 Ga0055540_1001939 3300003792 Bacteria 11570
46 Ga0055531_10009166 3300003794 Bacteria 5099
47 Ga0055531_10010804 3300003794 Bacteria 4493
48 Ga0055543_1003068 3300004625 Bacteria 5134
49 Ga0065165_1007453 3300005262 Bacteria 5370
50 Ga0065165_1038013 3300005262 Bacteria 1454
51 Ga0065165_1038016 3300005262 Bacteria 1454
52 Ga0065707_10088748 3300005295 Bacteria 4563
53 Ga0070660_100005548 3300005339 Bacteria 8740
54 Ga0070674_100006603 3300005356 Bacteria 6782
55 Ga0070674_100322870 3300005356 Bacteria 1238
56 Ga0070701_10012330 3300005438 Bacteria 3852
57 Ga0070701_10045307 3300005438 Bacteria 2256
58 Ga0070708_100401760 3300005445 Bacteria 1292
59 Ga0070662_100019751 3300005457 Bacteria 4580
60 Ga0070681_10005034 3300005458 Bacteria 12741
61 Ga0070681_10049038 3300005458 Bacteria 4218
62 Ga0070681_10160784 3300005458 Bacteria 2170
63 Ga0068867_100000415 3300005459 Bacteria 28504
64 Ga0070706_100024276 3300005467 Bacteria 5581
65 Ga0070698_100202724 3300005471 Bacteria 1919
66 Ga0070699_100064951 3300005518 Bacteria 3166
67 Ga0070699_100369360 3300005518 Bacteria 1294
68 Ga0070679_100016044 3300005530 Bacteria 7215
69 Ga0070679_100118439 3300005530 Bacteria 2633
70 Ga0070679_100397177 3300005530 Bacteria 1325
71 Ga0070697_100163215 3300005536 Bacteria 1883
72 Ga0068853_100147558 3300005539 Bacteria 2115
73 Ga0070672_100013371 3300005543 Bacteria 5797
74 Ga0070665_100144207 3300005548 Bacteria 2385
75 Ga0070704_100022351 3300005549 Bacteria 4114
76 Ga0068855_100091243 3300005563 Bacteria 3514
77 Ga0068856_100083032 3300005614 Bacteria 3181
78 Ga0068859_100137898 3300005617 Bacteria 2513
79 Ga0068864_100102860 3300005618 Bacteria 2536
80 Ga0068866_10005869 3300005718 Bacteria 5099
81 Ga0068861_100000811 3300005719 Bacteria 18865
82 Ga0068858_100006181 3300005842 Bacteria 11680
83 Ga0068858_100280707 3300005842 Bacteria 1586
84 Ga0068860_100002168 3300005843 Bacteria 20685
85 Ga0068862_100003580 3300005844 Bacteria 13297
86 Ga0075365_10000720 3300006038 Bacteria 13378
87 Ga0075365_10132385 3300006038 Bacteria 1726
88 Ga0075363_100016634 3300006048 Bacteria 3636
89 Ga0075363_100019584 3300006048 Bacteria 3384
90 Ga0075363_100033987 3300006048 Bacteria 2660
91 Ga0075364_10008499 3300006051 Bacteria 6140
92 Ga0075364_10019349 3300006051 Bacteria 4273
93 Ga0075364_10072592 3300006051 Bacteria 2268
94 Ga0075366_10012958 3300006195 Bacteria 4739
95 Ga0097621_100070737 3300006237 Bacteria 2882
96 Ga0075370_10001993 3300006353 Bacteria 9255
97 Ga0075370_10062396 3300006353 Bacteria 2123
98 Ga0075370_10067028 3300006353 Bacteria 2049
99 Ga0068871_100194124 3300006358 Bacteria 1750
100 Ga0075428_100014628 3300006844 Bacteria 8714
101 Ga0097620_100137896 3300006931 Bacteria 2513
102 Ga0079104_1023764 3300006946 Bacteria 1625
103 Ga0099826_10000116 3300006948 Bacteria 36767
104 Ga0105244_10005152 3300009036 Bacteria 8761
105 Ga0105244_10007093 3300009036 Bacteria 7164
106 Ga0105240_10008954 3300009093 Bacteria 14231
107 Ga0111539_10000771 3300009094 Bacteria 41650
108 Ga0105245_10078866 3300009098 Bacteria 3006
109 Ga0105237_10028602 3300009545 Bacteria 5675
110 Ga0105237_10111083 3300009545 Bacteria 2733
111 Ga0105238_10059018 3300009551 Bacteria 3845
112 Ga0157347_1001247 3300012502 Bacteria 1956
113 Ga0157370_10008602 3300013104 Bacteria 10991
114 Ga0157370_10126458 3300013104 Bacteria 2386
115 Ga0157378_10049664 3300013297 Bacteria 3732
116 Ga0157378_10133142 3300013297 Bacteria 2303
117 Ga0157375_10000321 3300013308 Bacteria 42980
118 Ga0157375_10130830 3300013308 Bacteria 2628
119 Ga0157380_10011696 3300014326 Bacteria 6346
120 Ga0157380_10046622 3300014326 Bacteria 3405
121 Ga0157380_10208600 3300014326 Bacteria 1739
122 Ga0182008_10000190 3300014497 Bacteria 48677
123 Ga0182008_10001478 3300014497 Bacteria 15700
124 Ga0157379_10049634 3300014968 Bacteria 3747
125 Ga0157379_10125586 3300014968 Bacteria 2308
126 Ga0157379_10352311 3300014968 Bacteria 1348
127 Ga0182006_1002550 3300015261 Bacteria 9881
128 Ga0182007_10000789 3300015262 Bacteria 17718
129 Ga0163161_10000149 3300017792 Bacteria 64127
130 Ga0163161_10007203 3300017792 Bacteria 7688
131 Ga0163161_10323953 3300017792 Bacteria 1219
132 Ga0209435_100008 3300025206 Bacteria 503644
133 Ga0209436_103481 3300025208 Bacteria 4170
134 Ga0209436_106849 3300025208 Bacteria 2446
135 Ga0209436_109378 3300025208 Bacteria 1868
136 Ga0209672_101411 3300025228 Bacteria 8750
137 Ga0209258_100058 3300025242 Bacteria 331567
138 Ga0207425_1000368 3300025245 Bacteria 31204
139 Ga0207425_1004113 3300025245 Bacteria 4451
140 Ga0207425_1005188 3300025245 Bacteria 3751
141 Ga0209646_1000029 3300025246 Bacteria 386414
142 Ga0209026_1000016 3300025250 Bacteria 386457
143 Ga0209148_1000071 3300025254 Bacteria 331551
144 Ga0209759_1000016 3300025256 Bacteria 386414
145 Ga0209129_1000023 3300025258 Bacteria 420646
146 Ga0209129_1003442 3300025258 Bacteria 6870
147 Ga0209129_1003948 3300025258 Bacteria 6136
148 Ga0209129_1009149 3300025258 Bacteria 2651
149 Ga0209565_1000075 3300025263 Bacteria 162259
150 Ga0209565_1000122 3300025263 Bacteria 111132
151 Ga0209565_1000187 3300025263 Bacteria 76001
152 Ga0209565_1000389 3300025263 Bacteria 37285
153 Ga0209565_1001234 3300025263 Bacteria 12012
154 Ga0209673_1000066 3300025273 Bacteria 250037
155 Ga0209673_1000289 3300025273 Bacteria 93941
156 Ga0209673_1000298 3300025273 Bacteria 91771
157 Ga0209673_1000389 3300025273 Bacteria 79243
158 Ga0209673_1007435 3300025273 Bacteria 5052
159 Ga0209130_1000014 3300025284 Bacteria 412039
160 Ga0209130_1000069 3300025284 Bacteria 179177
161 Ga0209130_1000415 3300025284 Bacteria 46113
162 Ga0209130_1001257 3300025284 Bacteria 17680
163 Ga0209675_1000074 3300025291 Bacteria 162260
164 Ga0209675_1000098 3300025291 Bacteria 130512
165 Ga0209675_1000177 3300025291 Bacteria 73574
166 Ga0209675_1000830 3300025291 Bacteria 20316
167 Ga0209675_1003101 3300025291 Bacteria 8113
168 Ga0209676_1000005 3300025292 Bacteria 1076001
169 Ga0209676_1000013 3300025292 Bacteria 816080
170 Ga0209676_1000142 3300025292 Bacteria 175752
171 Ga0209676_1000572 3300025292 Bacteria 55433
172 Ga0209676_1000900 3300025292 Bacteria 37519
173 Ga0209676_1008075 3300025292 Bacteria 4781
174 Ga0209025_1000351 3300025294 Bacteria 99585
175 Ga0209025_1000644 3300025294 Bacteria 61330
176 Ga0209025_1001844 3300025294 Bacteria 24885
177 Ga0209025_1002100 3300025294 Bacteria 22497
178 Ga0209025_1002386 3300025294 Bacteria 20102
179 Ga0209025_1004386 3300025294 Bacteria 12283
180 Ga0209025_1006494 3300025294 Bacteria 9046
181 Ga0209025_1016716 3300025294 Bacteria 4298
182 Ga0209025_1023454 3300025294 Bacteria 3223
183 Ga0209564_1000090 3300025295 Bacteria 249298
184 Ga0209564_1000181 3300025295 Bacteria 151002
185 Ga0209564_1000247 3300025295 Bacteria 116628
186 Ga0209564_1000527 3300025295 Bacteria 62263
187 Ga0209564_1000598 3300025295 Bacteria 56491
188 Ga0209758_1000044 3300025297 Bacteria 398448
189 Ga0209758_1001180 3300025297 Bacteria 33051
190 Ga0209758_1012549 3300025297 Bacteria 4727
191 Ga0209758_1015887 3300025297 Bacteria 3865
192 Ga0209758_1022013 3300025297 Bacteria 2943
193 Ga0209050_1000007 3300025298 Bacteria 1187891
194 Ga0209050_1000008 3300025298 Bacteria 1144179
195 Ga0209050_1001512 3300025298 Bacteria 24562
196 Ga0209050_1007343 3300025298 Bacteria 6202
197 Ga0209050_1007538 3300025298 Bacteria 6066
198 Ga0209256_1000020 3300025299 Bacteria 542402
199 Ga0209256_1000022 3300025299 Bacteria 481843
200 Ga0209256_1000039 3300025299 Bacteria 372337
201 Ga0209256_1021354 3300025299 Bacteria 1991
202 Ga0207426_1000001 3300025302 Bacteria 1341301
203 Ga0207426_1000031 3300025302 Bacteria 460699
204 Ga0207426_1000224 3300025302 Bacteria 130233
205 Ga0207426_1000714 3300025302 Bacteria 38628
206 Ga0209051_1000005 3300025303 Bacteria 1142353
207 Ga0209051_1000036 3300025303 Bacteria 339863
208 Ga0209051_1000500 3300025303 Bacteria 49702
209 Ga0209051_1001023 3300025303 Bacteria 26694
210 Ga0209051_1001418 3300025303 Bacteria 20578
211 Ga0209257_1000011 3300025304 Bacteria 1112630
212 Ga0209257_1000031 3300025304 Bacteria 688770
213 Ga0209257_1000226 3300025304 Bacteria 133836
214 Ga0209257_1006760 3300025304 Bacteria 7226
215 Ga0207655_1000554 3300025728 Bacteria 46735
216 Ga0207655_1004987 3300025728 Bacteria 9194
217 Ga0207645_10037875 3300025907 Bacteria 3095
218 Ga0207684_10021806 3300025910 Bacteria 5468
219 Ga0207707_10006861 3300025912 Bacteria 9931
220 Ga0207707_10055841 3300025912 Bacteria 3435
221 Ga0207695_10351445 3300025913 Bacteria 1361
222 Ga0207662_10129160 3300025918 Bacteria 1592
223 Ga0207652_10038890 3300025921 Bacteria 4035
224 Ga0207652_10301664 3300025921 Bacteria 1446
225 Ga0207681_10032320 3300025923 Bacteria 3425
226 Ga0207659_10158904 3300025926 Bacteria 1772
227 Ga0207644_10054639 3300025931 Bacteria 2877
228 Ga0207706_10026111 3300025933 Bacteria 5229
229 Ga0207686_10026001 3300025934 Bacteria 3413
230 Ga0207686_10095026 3300025934 Bacteria 1977
231 Ga0207709_10032837 3300025935 Bacteria 3042
232 Ga0207709_10036986 3300025935 Bacteria 2898
233 Ga0207709_10251224 3300025935 Bacteria 1292
234 Ga0207670_10038865 3300025936 Bacteria 3111
235 Ga0207691_10063621 3300025940 Bacteria 3345
236 Ga0207711_10017201 3300025941 Bacteria 6009
237 Ga0207689_10105659 3300025942 Bacteria 2313
238 Ga0207667_10118644 3300025949 Bacteria 2726
239 Ga0207703_10005344 3300026035 Bacteria 10343
240 Ga0207703_10020952 3300026035 Bacteria 5115
241 Ga0207703_10056443 3300026035 Bacteria 3199
242 Ga0207703_10231400 3300026035 Bacteria 1657
243 Ga0207639_10038971 3300026041 Bacteria 3538
244 Ga0207648_10000133 3300026089 Bacteria 73580
245 Ga0207648_10024245 3300026089 Bacteria 5418
246 Ga0207676_10169087 3300026095 Bacteria 1903
247 Ga0207676_10356007 3300026095 Bacteria 1355
248 Ga0207675_100000103 3300026118 Bacteria 67419
249 Ga0207683_10008738 3300026121 Bacteria 8648
250 Ga0207683_10260555 3300026121 Bacteria 1583
251 Ga0209282_1000114 3300027666 Bacteria 51706
252 Ga0209974_10001142 3300027876 Bacteria 9447
253 Ga0207428_10045128 3300027907 Bacteria 3552
254 Ga0268266_10175225 3300028379 Bacteria 1949
255 Ga0268266_10204860 3300028379 Bacteria 1807
256 Ga0268264_10045281 3300028381 Bacteria 3652
257 Ga0307515_10000131 3300028794 Bacteria 178919
258 Ga0307515_10010437 3300028794 Bacteria 17795
259 Ga0307515_10211517 3300028794 Bacteria 1782
260 Ga0316177_1049165 3300030731 Bacteria 4951
261 Ga0316176_1022729 3300030732 Bacteria 1537
262 Ga0314311_1006667 3300030733 Bacteria 5104
263 Ga0316179_1013086 3300030734 Bacteria 4563
264 Ga0316180_1120001 3300030736 Bacteria 5923
265 Ga0316181_1240660 3300030744 Bacteria 1748
266 Ga0316182_1209257 3300030745 Bacteria 6688
267 Ga0265332_10000035 3300031238 Bacteria 139554
268 Ga0265328_10007074 3300031239 Bacteria 4700
269 Ga0307513_10000219 3300031456 Bacteria 82663
270 Ga0307509_10001905 3300031507 Bacteria 34457
271 Ga0307509_10028710 3300031507 Bacteria 6182
272 Ga0307408_100000068 3300031548 Bacteria 120700
273 Ga0307408_100024207 3300031548 Bacteria 4143
274 Ga0307408_100187544 3300031548 Bacteria 1663
275 Ga0307508_10018843 3300031616 Bacteria 6271
276 Ga0307514_10048460 3300031649 Bacteria 3309
277 Ga0307516_10190089 3300031730 Bacteria 1780
278 Ga0307413_10336098 3300031824 Bacteria 1160
279 Ga0307406_10000274 3300031901 Bacteria 30854
280 Ga0307406_10046207 3300031901 Bacteria 2738
281 Ga0307412_10188469 3300031911 Bacteria 1557
282 Ga0307416_100259266 3300032002 Bacteria 1698
283 Ga0307416_100270026 3300032002 Bacteria 1669
284 Ga0307416_100352378 3300032002 Bacteria 1490
285 Ga0307411_10012213 3300032005 Bacteria 4674
286 Ga0307415_100257851 3300032126 Bacteria 1421
287 Ga0307510_10091198 3300033180 Bacteria 2890
288 Ga0373937_0071404 3300036401 Bacteria 3202
289 Ga0373937_0097500 3300036401 Bacteria 2727
290 Ga0373925_0034112 3300037068 Bacteria 3751
291 Ga0395905_0012063 3300037471 Bacteria 8328
292 Ga0436360_0220877 3300039438 Bacteria 2414
293 Ga0450911_000152 3300042115 Bacteria 27922
294 Ga0450923_000539 3300042125 Bacteria 4246
295 Ga0450896_005123 3300042133 Bacteria 1785
296 Ga0450906_004202 3300042145 Bacteria 3037
297 Ga0450907_006243 3300042146 Bacteria 1994
298 Ga0450908_001043 3300042184 Bacteria 5371
299 Ga0439434_0008074 3300042435 Bacteria 3086
300 Ga0450918_000923 3300042531 Bacteria 6145
301 Ga0451577_0000237 3300042876 Bacteria 109473
302 Ga0451577_0002148 3300042876 Bacteria 24144
303 Ga0451577_0008909 3300042876 Bacteria 9712
304 Ga0451577_0023335 3300042876 Bacteria 5643
305 Ga0451577_0128452 3300042876 Bacteria 2272
306 Ga0453683_0015775 3300044673 Bacteria 4885
307 Ga0453683_0099366 3300044673 Bacteria 1827
308 Ga0453684_0000121 3300044712 Bacteria 341067
309 Ga0453684_0015045 3300044712 Bacteria 12278
310 Ga0453684_0021884 3300044712 Bacteria 9515
311 Ga0453684_0089656 3300044712 Bacteria 3802
312 Ga0453684_0127682 3300044712 Bacteria 3057
313 Ga0451576_0001958 3300045051 Bacteria 32802
314 Ga0451576_0003156 3300045051 Bacteria 23064
315 Ga0451576_0004341 3300045051 Bacteria 18511
316 Ga0495590_0010535 3300046457 Bacteria 3473
317 Ga0495638_0013283 3300046460 Bacteria 5615
318 Ga0495638_0087432 3300046460 Bacteria 1883
319 Ga0495650_0011333 3300046471 Bacteria 4895
320 Ga0495610_0045026 3300046512 Bacteria 2185
321 Ga0495616_0015647 3300046513 Bacteria 4214
322 Ga0495631_0000339 3300046518 Bacteria 32159
323 Ga0495586_0015260 3300046535 Bacteria 4086
324 Ga0495609_0000288 3300046538 Bacteria 46408
325 Ga0495621_0014988 3300046539 Bacteria 2465
326 Ga0495621_0025165 3300046539 Bacteria 1997
327 Ga0495597_0003726 3300046542 Bacteria 8702
328 Ga0495625_0000044 3300046660 Bacteria 203855
329 Ga0495625_0018329 3300046660 Bacteria 5467
330 Ga0495658_0035725 3300046683 Bacteria 2737
331 Ga0495670_0088754 3300046691 Bacteria 1581
332 Ga0495671_0062168 3300046692 Bacteria 1840
333 Ga0496100_0281789 3300048903 Bacteria 1239
334 Ga0496106_0139661 3300048909 Bacteria 1905
335 Ga0496116_0106159 3300048919 Bacteria 1664
336 Ga0496117_0016771 3300048920 Bacteria 6156
337 Ga0496121_0013477 3300048924 Bacteria 8777
338 Ga0496121_0100711 3300048924 Bacteria 2229
339 Ga0496124_0024896 3300048927 Bacteria 5431
340 Ga0496125_0003303 3300048928 Bacteria 19766
341 Ga0496125_0004616 3300048928 Bacteria 15745
342 Ga0496125_0055984 3300048928 Bacteria 3207
343 Ga0496126_0255332 3300048929 Bacteria 1459
344 Ga0501031_0217136 3300049568 Bacteria 1246
345 Ga0501048_0107248 3300049582 Bacteria 1972
346 Ga0501071_0329411 3300049587 Bacteria 1160
347 Ga0501074_0033350 3300049590 Bacteria 3731
348 Ga0501075_0029823 3300049591 Bacteria 4036
349 Ga0501075_0211276 3300049591 Bacteria 1480
350 Ga0501076_0095408 3300049592 Bacteria 2395
351 Ga0501077_0015539 3300049593 Bacteria 4793
352 Ga0501209_000142 3300049656 Bacteria 7841
353 Ga0501223_022421 3300049663 Bacteria 1233
354 Ga0501225_0001852 3300049705 Bacteria 6638
355 Ga0501079_0005685 3300049741 Bacteria 9312
356 Ga0501080_0006003 3300049742 Bacteria 10888
357 Ga0501080_0100286 3300049742 Bacteria 2687
358 Ga0501081_0036094 3300049743 Bacteria 3369
359 Ga0501262_000035 3300049759 Bacteria 17582
360 Ga0501035_0332505 3300049822 Bacteria 1275
361 Ga0501045_0123203 3300049824 Bacteria 1925
362 Ga0501045_0301971 3300049824 Bacteria 1191
363 nmdc:mga03n38_23888_c1 3300050490 Bacteria 2493
364 nmdc:mga00v17_22901_c1 3300050491 Bacteria 3610
365 nmdc:mga0yw44_42976_c1 3300050492 Unclassified 2697
366 nmdc:mga0k408_55229_c1 3300050493 Bacteria 2303
367 nmdc:mga0k408_6843_c1 3300050493 Bacteria 6081
368 nmdc:mga07m45_32956_c1 3300050496 Bacteria 2875
369 nmdc:mga07m45_7509_c2 3300050496 Bacteria 4054
370 nmdc:mga08y16_866_c1 3300050511 Bacteria 29145
371 Ga0500610_0003490 3300053079 Bacteria 6047
372 Ga0500643_001367 3300053087 Bacteria 14144
373 Ga0500644_0001573 3300053088 Bacteria 5984
374 Ga0500651_0000208 3300053093 Bacteria 36941
375 Ga0500651_0006783 3300053093 Bacteria 6631
376 Ga0500641_0009813 3300053096 Bacteria 3448
377 Ga0500660_067721 3300053100 Bacteria 1689
378 Ga0500571_000048 3300053110 Bacteria 37193
379 Ga0500593_000271 3300053117 Bacteria 21197
380 Ga0500593_002226 3300053117 Bacteria 7080
381 Ga0500594_0000482 3300053118 Bacteria 8730
382 Ga0500607_002108 3300053121 Bacteria 16617
383 Ga0500608_006598 3300053122 Bacteria 4735
384 Ga0500628_001447 3300053129 Bacteria 4064
385 Ga0500655_000951 3300053133 Bacteria 5595
386 Ga0500658_0000160 3300053134 Bacteria 32138
387 Ga0500658_0000259 3300053134 Bacteria 24435
388 Ga0500559_0005158 3300053136 Bacteria 6033
389 Ga0500561_0008268 3300053137 Bacteria 2066
390 Ga0500568_0024406 3300053139 Bacteria 2561
391 Ga0500604_0025793 3300053151 Bacteria 1691
392 Ga0500616_0025608 3300053153 Bacteria 3271
393 Ga0500616_0029305 3300053153 Bacteria 3029
394 Ga0500616_0054757 3300053153 Bacteria 2088
395 Ga0500627_0000453 3300053158 Bacteria 11116
396 Ga0500634_0061818 3300053161 Bacteria 1985
397 Ga0500638_008987 3300053162 Bacteria 4292
398 Ga0500645_026996 3300053730 Bacteria 1743
399 Ga0501084_0001005 3300054114 Bacteria 21910
400 Ga0500661_000189 3300055283 Bacteria 10774
401 Ga0501082_0013908 3300060353 Bacteria 6920
402 Ga0530510_0061565 3300061734 Bacteria 2717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0008909 Ga0451577_0008909_6450_7379 296
2 3300044712 Ga0453684_0021884 Ga0453684_0021884_2134_3063 296
3 3300009545 Ga0105237_10111083 Ga0105237_101110832 310
4 3300050491 nmdc:mga00v17_22901_c1 nmdc:mga00v17_22901_c1_550_1491 313
5 3300050492 nmdc:mga0yw44_42976_c1 nmdc:mga0yw44_42976_c1_686_1627 313
6 3300014326 Ga0157380_10046622 Ga0157380_100466223 323
7 3300027876 Ga0209974_10001142 Ga0209974_100011422 323
8 3300049587 Ga0501071_0329411 Ga0501071_0329411_58_1107 323
9 3300031456 Ga0307513_10000219 Ga0307513_1000021910 324
10 3300014497 Ga0182008_10000190 Ga0182008_100001906 327
11 3300003316 rootH1_10037382 rootH1_100373825 328
12 3300003761 Ga0055535_1000520 Ga0055535_100052024 328
13 3300003762 Ga0055542_1000021 Ga0055542_1000021237 328
14 3300025228 Ga0209672_101411 Ga0209672_1014112 328
15 3300025242 Ga0209258_100058 Ga0209258_100058236 328
16 3300025254 Ga0209148_1000071 Ga0209148_1000071236 328
17 3300025294 Ga0209025_1000351 Ga0209025_100035137 328
18 3300042876 Ga0451577_0023335 Ga0451577_0023335_2310_3344 328
19 3300044712 Ga0453684_0089656 Ga0453684_0089656_1325_2359 328
20 3300053730 Ga0500645_026996 Ga0500645_026996_452_1537 328
21 3300002739 JGI25158J39367_1007303 JGI25158J39367_10073032 329
22 3300002987 JGI25159J45721_1004681 JGI25159J45721_10046813 329
23 3300003187 JGI25151J46595_10013840 JGI25151J46595_100138404 329
24 3300003215 JGI25153J46596_10010817 JGI25153J46596_100108174 329
25 3300003354 JGI25160J50197_1008233 JGI25160J50197_10082332 329
26 3300003374 JGI25161J50226_1005799 JGI25161J50226_10057992 329
27 3300003771 Ga0055526_1007648 Ga0055526_10076484 329
28 3300003773 Ga0055537_1006280 Ga0055537_10062802 329
29 3300003775 Ga0055524_1006386 Ga0055524_10063863 329
30 3300003781 Ga0055536_1000972 Ga0055536_100097210 329
31 3300003790 Ga0055528_1013772 Ga0055528_10137722 329
32 3300003791 Ga0055530_10004362 Ga0055530_100043626 329
33 3300003794 Ga0055531_10009166 Ga0055531_100091664 329
34 3300005356 Ga0070674_100322870 Ga0070674_1003228701 329
35 3300025208 Ga0209436_109378 Ga0209436_1093782 329
36 3300025258 Ga0209129_1003948 Ga0209129_10039485 329
37 3300025263 Ga0209565_1000187 Ga0209565_100018711 329
38 3300025263 Ga0209565_1001234 Ga0209565_10012343 329
39 3300025273 Ga0209673_1000066 Ga0209673_1000066174 329
40 3300025273 Ga0209673_1000389 Ga0209673_100038911 329
41 3300025273 Ga0209673_1007435 Ga0209673_10074352 329
42 3300025284 Ga0209130_1000415 Ga0209130_100041528 329
43 3300025291 Ga0209675_1000830 Ga0209675_10008306 329
44 3300025292 Ga0209676_1000005 Ga0209676_1000005791 329
45 3300025294 Ga0209025_1006494 Ga0209025_10064945 329
46 3300025295 Ga0209564_1000090 Ga0209564_1000090158 329
47 3300025297 Ga0209758_1012549 Ga0209758_10125493 329
48 3300025298 Ga0209050_1000007 Ga0209050_1000007306 329
49 3300025299 Ga0209256_1000022 Ga0209256_1000022135 329
50 3300025302 Ga0207426_1000031 Ga0207426_1000031291 329
51 3300025303 Ga0209051_1000036 Ga0209051_1000036142 329
52 3300025304 Ga0209257_1000011 Ga0209257_1000011765 329
53 3300003773 Ga0055537_1000285 Ga0055537_10002858 330
54 3300003781 Ga0055536_1002662 Ga0055536_10026628 330
55 3300003784 Ga0055534_1000018 Ga0055534_100001884 330
56 3300003790 Ga0055528_1000509 Ga0055528_10005097 330
57 3300003792 Ga0055540_1001939 Ga0055540_10019394 330
58 3300003794 Ga0055531_10010804 Ga0055531_100108044 330
59 3300006948 Ga0099826_10000116 Ga0099826_100001165 330
60 3300025263 Ga0209565_1000075 Ga0209565_100007572 330
61 3300025273 Ga0209673_1000289 Ga0209673_100028949 330
62 3300025291 Ga0209675_1000074 Ga0209675_100007472 330
63 3300025292 Ga0209676_1000900 Ga0209676_100090011 330
64 3300025294 Ga0209025_1016716 Ga0209025_10167165 330
65 3300025298 Ga0209050_1001512 Ga0209050_100151211 330
66 3300025303 Ga0209051_1000500 Ga0209051_100050041 330
67 3300025304 Ga0209257_1000226 Ga0209257_100022675 330
68 3300027666 Ga0209282_1000114 Ga0209282_100011452 330
69 3300050496 nmdc:mga07m45_32956_c1 nmdc:mga07m45_32956_c1_1326_2360 330
70 3300049568 Ga0501031_0217136 Ga0501031_0217136_50_1045 331
71 3300049582 Ga0501048_0107248 Ga0501048_0107248_765_1760 331
72 3300049590 Ga0501074_0033350 Ga0501074_0033350_1398_2393 331
73 3300049591 Ga0501075_0211276 Ga0501075_0211276_20_1015 331
74 3300049592 Ga0501076_0095408 Ga0501076_0095408_855_1850 331
75 3300049593 Ga0501077_0015539 Ga0501077_0015539_2687_3682 331
76 3300049741 Ga0501079_0005685 Ga0501079_0005685_832_1827 331
77 3300049742 Ga0501080_0006003 Ga0501080_0006003_4826_5821 331
78 3300049743 Ga0501081_0036094 Ga0501081_0036094_1130_2125 331
79 3300049822 Ga0501035_0332505 Ga0501035_0332505_16_1011 331
80 3300049824 Ga0501045_0301971 Ga0501045_0301971_20_1015 331
81 3300054114 Ga0501084_0001005 Ga0501084_0001005_13075_14070 331
82 3300060353 Ga0501082_0013908 Ga0501082_0013908_819_1814 331
83 3300061734 Ga0530510_0061565 Ga0530510_0061565_612_1607 331
84 3300036401 Ga0373937_0097500 Ga0373937_0097500_1617_2645 333
85 3300006038 Ga0075365_10000720 Ga0075365_100007206 334
86 3300006048 Ga0075363_100019584 Ga0075363_1000195846 334
87 3300006048 Ga0075363_100033987 Ga0075363_1000339872 334
88 3300006051 Ga0075364_10072592 Ga0075364_100725922 334
89 3300017792 Ga0163161_10007203 Ga0163161_100072035 334
90 3300025935 Ga0207709_10032837 Ga0207709_100328373 334
91 3300031824 Ga0307413_10336098 Ga0307413_103360981 334
92 3300032002 Ga0307416_100352378 Ga0307416_1003523782 334
93 3300032005 Ga0307411_10012213 Ga0307411_100122132 334
94 3300046660 Ga0495625_0000044 Ga0495625_0000044_115182_116216 334
95 3300050490 nmdc:mga03n38_23888_c1 nmdc:mga03n38_23888_c1_639_1673 334
96 3300050493 nmdc:mga0k408_6843_c1 nmdc:mga0k408_6843_c1_2709_3743 334
97 3300053151 Ga0500604_0025793 Ga0500604_0025793_428_1468 334
98 3300005438 Ga0070701_10045307 Ga0070701_100453073 335
99 3300005458 Ga0070681_10005034 Ga0070681_1000503410 335
100 3300005530 Ga0070679_100118439 Ga0070679_1001184392 335
101 3300006038 Ga0075365_10132385 Ga0075365_101323851 335
102 3300006048 Ga0075363_100016634 Ga0075363_1000166345 335
103 3300006051 Ga0075364_10019349 Ga0075364_100193492 335
104 3300025912 Ga0207707_10006861 Ga0207707_100068615 335
105 iso_pu_bacteria 2883291878 2883294209 335
106 iso_pu_bacteria 2883354860 2883357262 335
107 3300005548 Ga0070665_100144207 Ga0070665_1001442072 336
108 3300028379 Ga0268266_10204860 Ga0268266_102048602 336
109 3300031239 Ga0265328_10007074 Ga0265328_100070742 336
110 3300031649 Ga0307514_10048460 Ga0307514_100484602 336
111 3300053153 Ga0500616_0025608 Ga0500616_0025608_252_1268 336
112 3300005445 Ga0070708_100401760 Ga0070708_1004017602 337
113 3300006358 Ga0068871_100194124 Ga0068871_1001941242 337
114 3300009098 Ga0105245_10078866 Ga0105245_100788662 337
115 3300014968 Ga0157379_10125586 Ga0157379_101255862 337
116 3300017792 Ga0163161_10323953 Ga0163161_103239531 337
117 3300025295 Ga0209564_1000598 Ga0209564_10005983 337
118 3300025907 Ga0207645_10037875 Ga0207645_100378753 337
119 3300025918 Ga0207662_10129160 Ga0207662_101291601 337
120 3300025926 Ga0207659_10158904 Ga0207659_101589042 337
121 3300025934 Ga0207686_10095026 Ga0207686_100950262 337
122 3300025936 Ga0207670_10038865 Ga0207670_100388652 337
123 3300026035 Ga0207703_10056443 Ga0207703_100564432 337
124 3300026089 Ga0207648_10024245 Ga0207648_100242453 337
125 3300026095 Ga0207676_10356007 Ga0207676_103560071 337
126 3300026121 Ga0207683_10008738 Ga0207683_100087387 337
127 3300036401 Ga0373937_0071404 Ga0373937_0071404_1851_2867 337
128 3300048909 Ga0496106_0139661 Ga0496106_0139661_78_1091 337
129 3300049742 Ga0501080_0100286 Ga0501080_0100286_57_1082 337
130 iso_pu_bacteria 2739367655 2739612779 337
131 3300005295 Ga0065707_10088748 Ga0065707_100887482 338
132 3300005356 Ga0070674_100006603 Ga0070674_1000066035 338
133 3300005458 Ga0070681_10049038 Ga0070681_100490382 338
134 3300005459 Ga0068867_100000415 Ga0068867_1000004154 338
135 3300005467 Ga0070706_100024276 Ga0070706_1000242763 338
136 3300005471 Ga0070698_100202724 Ga0070698_1002027242 338
137 3300005518 Ga0070699_100369360 Ga0070699_1003693601 338
138 3300005530 Ga0070679_100397177 Ga0070679_1003971771 338
139 3300005536 Ga0070697_100163215 Ga0070697_1001632151 338
140 3300005539 Ga0068853_100147558 Ga0068853_1001475582 338
141 3300005543 Ga0070672_100013371 Ga0070672_1000133712 338
142 3300005618 Ga0068864_100102860 Ga0068864_1001028602 338
143 3300005718 Ga0068866_10005869 Ga0068866_100058691 338
144 3300005719 Ga0068861_100000811 Ga0068861_10000081110 338
145 3300005842 Ga0068858_100280707 Ga0068858_1002807072 338
146 3300005843 Ga0068860_100002168 Ga0068860_1000021685 338
147 3300005844 Ga0068862_100003580 Ga0068862_1000035809 338
148 3300006195 Ga0075366_10012958 Ga0075366_100129583 338
149 3300006237 Ga0097621_100070737 Ga0097621_1000707372 338
150 3300009036 Ga0105244_10005152 Ga0105244_100051527 338
151 3300009551 Ga0105238_10059018 Ga0105238_100590182 338
152 3300013297 Ga0157378_10133142 Ga0157378_101331422 338
153 3300013308 Ga0157375_10000321 Ga0157375_1000032119 338
154 3300013308 Ga0157375_10130830 Ga0157375_101308302 338
155 3300014326 Ga0157380_10208600 Ga0157380_102086002 338
156 3300014968 Ga0157379_10049634 Ga0157379_100496343 338
157 3300014968 Ga0157379_10352311 Ga0157379_103523111 338
158 3300025728 Ga0207655_1004987 Ga0207655_10049877 338
159 3300025910 Ga0207684_10021806 Ga0207684_100218064 338
160 3300025912 Ga0207707_10055841 Ga0207707_100558413 338
161 3300025921 Ga0207652_10301664 Ga0207652_103016642 338
162 3300025923 Ga0207681_10032320 Ga0207681_100323203 338
163 3300025931 Ga0207644_10054639 Ga0207644_100546391 338
164 3300025935 Ga0207709_10036986 Ga0207709_100369862 338
165 3300025940 Ga0207691_10063621 Ga0207691_100636212 338
166 3300025941 Ga0207711_10017201 Ga0207711_100172013 338
167 3300025942 Ga0207689_10105659 Ga0207689_101056592 338
168 3300026035 Ga0207703_10020952 Ga0207703_100209525 338
169 3300026035 Ga0207703_10231400 Ga0207703_102314001 338
170 3300026089 Ga0207648_10000133 Ga0207648_1000013325 338
171 3300026095 Ga0207676_10169087 Ga0207676_101690872 338
172 3300026118 Ga0207675_100000103 Ga0207675_1000001039 338
173 3300026121 Ga0207683_10260555 Ga0207683_102605552 338
174 3300028381 Ga0268264_10045281 Ga0268264_100452812 338
175 3300046535 Ga0495586_0015260 Ga0495586_0015260_2534_3550 338
176 3300046538 Ga0495609_0000288 Ga0495609_0000288_327_1346 338
177 3300046542 Ga0495597_0003726 Ga0495597_0003726_2651_3670 338
178 3300046683 Ga0495658_0035725 Ga0495658_0035725_1506_2522 338
179 3300048929 Ga0496126_0255332 Ga0496126_0255332_200_1222 338
180 3300049656 Ga0501209_000142 Ga0501209_000142_3089_4111 338
181 iso_pu_bacteria 2513020051 2513231388 338
182 iso_pu_bacteria 2643221628 2644163242 338
183 iso_pu_bacteria 2643221658 2644327907 338
184 iso_pu_bacteria 2643221672 2644397868 338
185 iso_pu_bacteria 2738541277 2738718047 338
186 iso_pu_bacteria 2738541307 2738885051 338
187 iso_pu_bacteria 2738543019 2739278733 338
188 iso_pu_bacteria 2842677519 2842679649 338
189 iso_pu_bacteria 2904449895 2904455752 338
190 iso_pu_bacteria 2904456579 2904457817 338
191 iso_pu_bacteria 2904541872 2904544778 338
192 iso_pu_bacteria 2919462493 2919467260 338
193 iso_pu_bacteria 2928051484 2928053224 338
194 iso_pu_bacteria 2928064002 2928066829 338
195 iso_pu_bacteria 2928084124 2928084785 338
196 iso_pu_bacteria 2929160207 2929163551 338
197 iso_pu_bacteria 2929520902 2929522735 338
198 iso_pu_bacteria 2945909444 2945912240 338
199 iso_pu_bacteria 2945945610 2945947719 338
200 iso_pu_bacteria 2945972063 2945977423 338
201 iso_pu_bacteria 2945984333 2945985447 338
202 iso_pu_bacteria 2954767861 2954772036 338
203 3300005518 Ga0070699_100064951 Ga0070699_1000649512 339
204 3300028794 Ga0307515_10010437 Ga0307515_100104376 339
205 3300031507 Ga0307509_10001905 Ga0307509_100019059 339
206 3300031507 Ga0307509_10028710 Ga0307509_100287103 339
207 3300031616 Ga0307508_10018843 Ga0307508_100188433 339
208 3300033180 Ga0307510_10091198 Ga0307510_100911983 339
209 3300039438 Ga0436360_0220877 Ga0436360_0220877_206_1231 339
210 3300046460 Ga0495638_0087432 Ga0495638_0087432_569_1624 339
211 3300053153 Ga0500616_0054757 Ga0500616_0054757_308_1363 339
212 iso_pu_bacteria 2599185214 2599626630 339
213 iso_pu_bacteria 2599185226 2599675694 339
214 iso_pu_bacteria 2599185227 2599684167 339
215 iso_pu_bacteria 2599185229 2599696181 339
216 iso_pu_bacteria 2818991446 2819595741 339
217 iso_pu_bacteria 2831265667 2831266752 339
218 iso_pu_bacteria 2838054893 2838057169 339
219 iso_pu_bacteria 2885198086 2885201201 339
220 iso_pu_bacteria 2885211737 2885214855 339
221 iso_pu_bacteria 2899924645 2899925087 339
222 iso_pu_bacteria 2928037797 2928038788 339
223 iso_pu_bacteria 2928044640 2928045607 339
224 iso_pu_bacteria 2928070936 2928071286 339
225 3300002773 JGI25152J39213_1003701 JGI25152J39213_10037014 340
226 3300002774 JGI25150J39212_1001859 JGI25150J39212_10018594 340
227 3300002987 JGI25159J45721_1003871 JGI25159J45721_10038714 340
228 3300003187 JGI25151J46595_10007640 JGI25151J46595_100076405 340
229 3300003215 JGI25153J46596_10007642 JGI25153J46596_100076425 340
230 3300003354 JGI25160J50197_1005635 JGI25160J50197_10056353 340
231 3300003374 JGI25161J50226_1002188 JGI25161J50226_10021883 340
232 3300003771 Ga0055526_1008775 Ga0055526_10087753 340
233 3300003773 Ga0055537_1003192 Ga0055537_10031923 340
234 3300003775 Ga0055524_1006369 Ga0055524_10063693 340
235 3300003784 Ga0055534_1003298 Ga0055534_10032983 340
236 3300003790 Ga0055528_1006838 Ga0055528_10068383 340
237 3300004625 Ga0055543_1003068 Ga0055543_10030682 340
238 3300005262 Ga0065165_1007453 Ga0065165_10074533 340
239 3300005457 Ga0070662_100019751 Ga0070662_1000197512 340
240 3300005563 Ga0068855_100091243 Ga0068855_1000912433 340
241 3300005614 Ga0068856_100083032 Ga0068856_1000830322 340
242 3300005617 Ga0068859_100137898 Ga0068859_1001378983 340
243 3300005842 Ga0068858_100006181 Ga0068858_10000618110 340
244 3300006353 Ga0075370_10001993 Ga0075370_100019937 340
245 3300006931 Ga0097620_100137896 Ga0097620_1001378963 340
246 3300009036 Ga0105244_10007093 Ga0105244_100070936 340
247 3300009545 Ga0105237_10028602 Ga0105237_100286024 340
248 3300012502 Ga0157347_1001247 Ga0157347_10012472 340
249 3300013104 Ga0157370_10008602 Ga0157370_100086027 340
250 3300013104 Ga0157370_10126458 Ga0157370_101264583 340
251 3300013297 Ga0157378_10049664 Ga0157378_100496646 340
252 3300014497 Ga0182008_10001478 Ga0182008_1000147812 340
253 3300015261 Ga0182006_1002550 Ga0182006_10025503 340
254 3300015262 Ga0182007_10000789 Ga0182007_1000078915 340
255 3300017792 Ga0163161_10000149 Ga0163161_1000014929 340
256 3300025208 Ga0209436_106849 Ga0209436_1068492 340
257 3300025245 Ga0207425_1000368 Ga0207425_10003685 340
258 3300025258 Ga0209129_1000023 Ga0209129_100002332 340
259 3300025258 Ga0209129_1003442 Ga0209129_10034425 340
260 3300025284 Ga0209130_1000069 Ga0209130_100006935 340
261 3300025291 Ga0209675_1000177 Ga0209675_100017761 340
262 3300025294 Ga0209025_1000644 Ga0209025_100064426 340
263 3300025294 Ga0209025_1002386 Ga0209025_100238611 340
264 3300025295 Ga0209564_1000527 Ga0209564_100052729 340
265 3300025297 Ga0209758_1000044 Ga0209758_1000044301 340
266 3300025297 Ga0209758_1001180 Ga0209758_100118020 340
267 3300025298 Ga0209050_1007538 Ga0209050_10075384 340
268 3300025299 Ga0209256_1000020 Ga0209256_1000020304 340
269 3300025302 Ga0207426_1000001 Ga0207426_1000001939 340
270 3300025303 Ga0209051_1001023 Ga0209051_10010233 340
271 3300025303 Ga0209051_1001418 Ga0209051_10014187 340
272 3300025304 Ga0209257_1006760 Ga0209257_10067603 340
273 3300025728 Ga0207655_1000554 Ga0207655_100055419 340
274 3300025913 Ga0207695_10351445 Ga0207695_103514451 340
275 3300025933 Ga0207706_10026111 Ga0207706_100261113 340
276 3300025934 Ga0207686_10026001 Ga0207686_100260012 340
277 3300025935 Ga0207709_10251224 Ga0207709_102512242 340
278 3300025949 Ga0207667_10118644 Ga0207667_101186443 340
279 3300026035 Ga0207703_10005344 Ga0207703_100053448 340
280 3300026041 Ga0207639_10038971 Ga0207639_100389713 340
281 3300028379 Ga0268266_10175225 Ga0268266_101752253 340
282 3300030731 Ga0316177_1049165 Ga0316177_10491654 340
283 3300030732 Ga0316176_1022729 Ga0316176_10227291 340
284 3300030733 Ga0314311_1006667 Ga0314311_10066673 340
285 3300030734 Ga0316179_1013086 Ga0316179_10130862 340
286 3300030736 Ga0316180_1120001 Ga0316180_11200016 340
287 3300030744 Ga0316181_1240660 Ga0316181_12406602 340
288 3300030745 Ga0316182_1209257 Ga0316182_12092575 340
289 3300031548 Ga0307408_100024207 Ga0307408_1000242072 340
290 3300031911 Ga0307412_10188469 Ga0307412_101884692 340
291 3300032002 Ga0307416_100270026 Ga0307416_1002700261 340
292 3300042115 Ga0450911_000152 Ga0450911_000152_23793_24824 340
293 3300042125 Ga0450923_000539 Ga0450923_000539_1508_2542 340
294 3300042133 Ga0450896_005123 Ga0450896_005123_141_1175 340
295 3300042145 Ga0450906_004202 Ga0450906_004202_567_1601 340
296 3300042146 Ga0450907_006243 Ga0450907_006243_285_1319 340
297 3300042184 Ga0450908_001043 Ga0450908_001043_1077_2111 340
298 3300042435 Ga0439434_0008074 Ga0439434_0008074_1271_2305 340
299 3300042531 Ga0450918_000923 Ga0450918_000923_2049_3083 340
300 3300046460 Ga0495638_0013283 Ga0495638_0013283_3218_4252 340
301 3300046471 Ga0495650_0011333 Ga0495650_0011333_491_1522 340
302 3300046512 Ga0495610_0045026 Ga0495610_0045026_1080_2114 340
303 3300046513 Ga0495616_0015647 Ga0495616_0015647_2612_3646 340
304 3300046518 Ga0495631_0000339 Ga0495631_0000339_5200_6234 340
305 3300046539 Ga0495621_0025165 Ga0495621_0025165_799_1833 340
306 3300046660 Ga0495625_0018329 Ga0495625_0018329_1539_2573 340
307 3300046691 Ga0495670_0088754 Ga0495670_0088754_14_1048 340
308 3300046692 Ga0495671_0062168 Ga0495671_0062168_631_1665 340
309 3300048903 Ga0496100_0281789 Ga0496100_0281789_11_1045 340
310 3300048919 Ga0496116_0106159 Ga0496116_0106159_114_1148 340
311 3300048920 Ga0496117_0016771 Ga0496117_0016771_2291_3328 340
312 3300048924 Ga0496121_0013477 Ga0496121_0013477_6486_7517 340
313 3300048924 Ga0496121_0100711 Ga0496121_0100711_870_1904 340
314 3300048927 Ga0496124_0024896 Ga0496124_0024896_3249_4286 340
315 3300048928 Ga0496125_0003303 Ga0496125_0003303_7102_8133 340
316 3300048928 Ga0496125_0004616 Ga0496125_0004616_7026_8075 340
317 3300048928 Ga0496125_0055984 Ga0496125_0055984_1163_2194 340
318 3300049705 Ga0501225_0001852 Ga0501225_0001852_107_1141 340
319 3300049759 Ga0501262_000035 Ga0501262_000035_5605_6639 340
320 3300050496 nmdc:mga07m45_7509_c2 nmdc:mga07m45_7509_c2_2607_3641 340
321 3300053079 Ga0500610_0003490 Ga0500610_0003490_24_1058 340
322 3300053087 Ga0500643_001367 Ga0500643_001367_7838_8872 340
323 3300053093 Ga0500651_0000208 Ga0500651_0000208_34002_35036 340
324 3300053110 Ga0500571_000048 Ga0500571_000048_5087_6121 340
325 3300053117 Ga0500593_000271 Ga0500593_000271_5107_6141 340
326 3300053118 Ga0500594_0000482 Ga0500594_0000482_1952_2986 340
327 3300053121 Ga0500607_002108 Ga0500607_002108_10611_11645 340
328 3300053133 Ga0500655_000951 Ga0500655_000951_3246_4280 340
329 3300053134 Ga0500658_0000160 Ga0500658_0000160_29534_30568 340
330 3300053134 Ga0500658_0000259 Ga0500658_0000259_21840_22874 340
331 3300053136 Ga0500559_0005158 Ga0500559_0005158_4770_5804 340
332 3300053137 Ga0500561_0008268 Ga0500561_0008268_978_2012 340
333 3300053153 Ga0500616_0029305 Ga0500616_0029305_799_1833 340
334 3300053158 Ga0500627_0000453 Ga0500627_0000453_6378_7412 340
335 3300053161 Ga0500634_0061818 Ga0500634_0061818_770_1804 340
336 3300053162 Ga0500638_008987 Ga0500638_008987_2773_3807 340
337 iso_pu_bacteria 2547132374 2548496939 340
338 iso_pu_bacteria 2643221717 2644645557 340
339 3300005339 Ga0070660_100005548 Ga0070660_1000055484 341
340 3300005458 Ga0070681_10160784 Ga0070681_101607842 341
341 3300005530 Ga0070679_100016044 Ga0070679_1000160445 341
342 3300006844 Ga0075428_100014628 Ga0075428_1000146287 341
343 3300009093 Ga0105240_10008954 Ga0105240_100089543 341
344 3300009094 Ga0111539_10000771 Ga0111539_1000077136 341
345 3300014326 Ga0157380_10011696 Ga0157380_100116964 341
346 3300025921 Ga0207652_10038890 Ga0207652_100388903 341
347 3300027907 Ga0207428_10045128 Ga0207428_100451285 341
348 3300028794 Ga0307515_10211517 Ga0307515_102115172 341
349 3300031238 Ga0265332_10000035 Ga0265332_1000003576 341
350 3300032002 Ga0307416_100259266 Ga0307416_1002592663 341
351 3300050511 nmdc:mga08y16_866_c1 nmdc:mga08y16_866_c1_3436_4464 341
352 iso_pu_bacteria 2643221609 2644062942 341
353 iso_pu_bacteria 2643221611 2644070625 341
354 iso_pu_bacteria 2939631187 2939633016 341
355 3300025292 Ga0209676_1000142 Ga0209676_1000142103 342
356 3300028794 Ga0307515_10000131 Ga0307515_10000131110 342
357 3300037471 Ga0395905_0012063 Ga0395905_0012063_1687_2715 342
358 3300042876 Ga0451577_0000237 Ga0451577_0000237_15408_16442 342
359 3300042876 Ga0451577_0002148 Ga0451577_0002148_16558_17604 342
360 3300042876 Ga0451577_0128452 Ga0451577_0128452_1039_2073 342
361 3300044673 Ga0453683_0015775 Ga0453683_0015775_1746_2780 342
362 3300044673 Ga0453683_0099366 Ga0453683_0099366_388_1434 342
363 3300044712 Ga0453684_0000121 Ga0453684_0000121_93056_94090 342
364 3300044712 Ga0453684_0015045 Ga0453684_0015045_9672_10718 342
365 3300044712 Ga0453684_0127682 Ga0453684_0127682_1562_2608 342
366 3300045051 Ga0451576_0001958 Ga0451576_0001958_15923_16957 342
367 3300045051 Ga0451576_0003156 Ga0451576_0003156_1802_2836 342
368 3300045051 Ga0451576_0004341 Ga0451576_0004341_3044_4090 342
369 3300046457 Ga0495590_0010535 Ga0495590_0010535_1130_2158 342
370 3300049591 Ga0501075_0029823 Ga0501075_0029823_2366_3397 342
371 3300049824 Ga0501045_0123203 Ga0501045_0123203_857_1891 342
372 3300053122 Ga0500608_006598 Ga0500608_006598_3101_4144 342
373 iso_pu_bacteria 2511231002 2511246631 342
374 iso_pu_bacteria 2643221683 2644468294 342
375 iso_pu_bacteria 2738543012 2739245403 342
376 iso_pu_bacteria 2816332133 2816474766 342
377 3300005438 Ga0070701_10012330 Ga0070701_100123304 343
378 3300005549 Ga0070704_100022351 Ga0070704_1000223512 343
379 3300031548 Ga0307408_100000068 Ga0307408_10000006880 343
380 3300031901 Ga0307406_10000274 Ga0307406_1000027420 343
381 3300032126 Ga0307415_100257851 Ga0307415_1002578512 343
382 3300037068 Ga0373925_0034112 Ga0373925_0034112_916_1956 343
383 3300046539 Ga0495621_0014988 Ga0495621_0014988_1097_2137 343
384 3300049663 Ga0501223_022421 Ga0501223_022421_54_1091 343
385 3300053093 Ga0500651_0006783 Ga0500651_0006783_352_1389 343
386 3300053139 Ga0500568_0024406 Ga0500568_0024406_373_1425 343
387 3300050493 nmdc:mga0k408_55229_c1 nmdc:mga0k408_55229_c1_944_2023 345
388 3300002704 JGI25155J39150_1000009 JGI25155J39150_1000009119 346
389 3300002705 JGI25156J39149_1000009 JGI25156J39149_1000009101 346
390 3300002738 JGI25154J39366_1000024 JGI25154J39366_1000024101 346
391 3300002741 JGI25157J39369_1000007 JGI25157J39369_1000007101 346
392 3300002987 JGI25159J45721_1000546 JGI25159J45721_10005464 346
393 3300003187 JGI25151J46595_10002356 JGI25151J46595_100023567 346
394 3300003354 JGI25160J50197_1000117 JGI25160J50197_100011714 346
395 3300003374 JGI25161J50226_1000009 JGI25161J50226_1000009125 346
396 3300003771 Ga0055526_1009223 Ga0055526_10092232 346
397 3300003773 Ga0055537_1000020 Ga0055537_100002036 346
398 3300003775 Ga0055524_1000047 Ga0055524_100004765 346
399 3300003784 Ga0055534_1002128 Ga0055534_10021281 346
400 3300003792 Ga0055540_1000027 Ga0055540_100002780 346
401 3300005262 Ga0065165_1038013 Ga0065165_10380131 346
402 3300005262 Ga0065165_1038016 Ga0065165_10380161 346
403 3300006051 Ga0075364_10008499 Ga0075364_100084995 346
404 3300006353 Ga0075370_10062396 Ga0075370_100623962 346
405 3300006353 Ga0075370_10067028 Ga0075370_100670282 346
406 3300006946 Ga0079104_1023764 Ga0079104_10237641 346
407 3300025206 Ga0209435_100008 Ga0209435_1000087 346
408 3300025208 Ga0209436_103481 Ga0209436_1034812 346
409 3300025245 Ga0207425_1004113 Ga0207425_10041132 346
410 3300025245 Ga0207425_1005188 Ga0207425_10051882 346
411 3300025246 Ga0209646_1000029 Ga0209646_1000029271 346
412 3300025250 Ga0209026_1000016 Ga0209026_1000016271 346
413 3300025256 Ga0209759_1000016 Ga0209759_1000016271 346
414 3300025258 Ga0209129_1009149 Ga0209129_10091492 346
415 3300025263 Ga0209565_1000122 Ga0209565_100012210 346
416 3300025263 Ga0209565_1000389 Ga0209565_10003892 346
417 3300025273 Ga0209673_1000298 Ga0209673_10002986 346
418 3300025284 Ga0209130_1000014 Ga0209130_1000014101 346
419 3300025284 Ga0209130_1001257 Ga0209130_10012576 346
420 3300025291 Ga0209675_1000098 Ga0209675_100009837 346
421 3300025291 Ga0209675_1003101 Ga0209675_10031011 346
422 3300025292 Ga0209676_1000013 Ga0209676_1000013654 346
423 3300025292 Ga0209676_1000572 Ga0209676_100057231 346
424 3300025292 Ga0209676_1008075 Ga0209676_10080752 346
425 3300025294 Ga0209025_1001844 Ga0209025_10018446 346
426 3300025294 Ga0209025_1002100 Ga0209025_100210016 346
427 3300025294 Ga0209025_1004386 Ga0209025_10043865 346
428 3300025294 Ga0209025_1023454 Ga0209025_10234542 346
429 3300025295 Ga0209564_1000181 Ga0209564_100018142 346
430 3300025295 Ga0209564_1000247 Ga0209564_100024788 346
431 3300025297 Ga0209758_1015887 Ga0209758_10158872 346
432 3300025297 Ga0209758_1022013 Ga0209758_10220133 346
433 3300025298 Ga0209050_1000008 Ga0209050_1000008654 346
434 3300025298 Ga0209050_1007343 Ga0209050_10073431 346
435 3300025299 Ga0209256_1000039 Ga0209256_1000039253 346
436 3300025299 Ga0209256_1021354 Ga0209256_10213542 346
437 3300025302 Ga0207426_1000224 Ga0207426_1000224101 346
438 3300025302 Ga0207426_1000714 Ga0207426_10007146 346
439 3300025303 Ga0209051_1000005 Ga0209051_1000005654 346
440 3300025304 Ga0209257_1000031 Ga0209257_1000031244 346
441 3300031548 Ga0307408_100187544 Ga0307408_1001875442 346
442 3300031730 Ga0307516_10190089 Ga0307516_101900892 346
443 3300031901 Ga0307406_10046207 Ga0307406_100462072 346
444 3300053088 Ga0500644_0001573 Ga0500644_0001573_1765_2805 346
445 3300053096 Ga0500641_0009813 Ga0500641_0009813_752_1792 346
446 3300053100 Ga0500660_067721 Ga0500660_067721_420_1556 346
447 3300053117 Ga0500593_002226 Ga0500593_002226_3328_4368 346
448 3300053129 Ga0500628_001447 Ga0500628_001447_1253_2293 346
449 3300055283 Ga0500661_000189 Ga0500661_000189_2913_3953 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

73

298

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9726 31 346
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9577 31 346
7a99-assembly1.cif.gz_A crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp 0.9103 32 128
6gpc-assembly1.cif.gz_A crystal structure of the arginine-bound form of domain 1 from tmargbp 0.8996 33 128
6q3u-assembly1.cif.gz_A gly52ala mutant of arginine-bound argbp from t. maritima 0.8987 32 249
ID Description Score Start End Superfamily
2v25B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9365 31 125 3.40.190.10
2yjpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9289 29 130 3.40.190.10
5eyfA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9227 32 126 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9197 128 233 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9027 128 233 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537MQQ0-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9947 30 108 GO:0006865
AF-A0A4Q8QMC4-F1-model_v4 Amino acid ABC transporter substrate-bindnig protein 0.9918 34 346 GO:0006865
AF-F2IXB3-F1-model_v4 Amino acid ABC transporter, periplasmic amino acid-binding protein 0.9896 48 346 GO:0006865
AF-A0A7S7Q2N8-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9892 31 346 GO:0006865
AF-H0TS08-F1-model_v4 General L-amino acid-binding periplasmic protein 0.9873 31 346 GO:0006865

Feature Viewer

pLDDT pTM Quality
90.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map