F446472

General Info

Members Datasets Scaffolds Average Seq Length
449 222 898 422

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0181029|Ga0496100_0181029_41_1507
Length 488
Sequence MGDRDGRGCDERDRDDGEDPQPPSSHSEKGSHPRESFGQALYASSAIPLTPQTGGRVKKRIYAGAGASALVAVIXXXXTVSGALAHSGSTPLPASSCSAIQNPAGQYLIASDLPLEGSGRTQTSQMTRAIKFILNRHGWKAGKYSLAYQSCDDATAQAGKWDSGKCSANANAYARNSDVIGVIGTFNSGCAEIIIPVLNRASGGPVAMVSPANTYVGLTHGGPGTVAGEPGKYYPTGKRNYARVVAADDYQGAADAVLTKSLGIKKVYILNDKEAYGLGVASNFRNAAQRLGLNVAGFTAWDGKASSYEALAVKIKASGAQGVFLGGLICENGGKLIKDLRNGLGKNVKIIAPDGFTPVSATIQQGGSATENMFVSVAGLPNSALTGAGKAFVVAFTVADHKVPDPYSVYAAQAAEVLVQAIKQSNGSRADVAKQLFKVHLTNSILGNVSFNSNGDVSSNPVTIYRVTGAKSNSYRVIVPPKSLVKIA

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.86
Metatranscriptomes 11.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20.94
Rhizosphere 77.95
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0181029 3300048903 Bacteria 1524
2 Ga0006759J45824_1030507 3300003163 Bacteria 1345
3 JGI25406J46586_10003486 3300003203 Bacteria 7389
4 Ga0007417J51691_1028887 3300003544 Bacteria 1348
5 Ga0007410J51695_1018393 3300003574 Bacteria 1342
6 Ga0007410J51695_1037313 3300003574 Bacteria 1348
7 Ga0007409J51694_1015140 3300003575 Bacteria 1348
8 Ga0007429J51699_1039337 3300003579 Bacteria 1341
9 Ga0007429J51699_1062163 3300003579 Bacteria 1341
10 Ga0032354_1020654 3300003693 Bacteria 1375
11 Ga0032354_1023329 3300003693 Bacteria 1345
12 Ga0058859_11735953 3300004798 Bacteria 1328
13 Ga0058863_11945381 3300004799 Unclassified 1442
14 Ga0058861_10041292 3300004800 Bacteria 1759
15 Ga0058861_12063506 3300004800 Unclassified 1632
16 Ga0058862_10025393 3300004803 Bacteria 1902
17 Ga0058862_12839372 3300004803 Unclassified 1512
18 Ga0070658_10006766 3300005327 Bacteria 9279
19 Ga0070658_10033215 3300005327 Bacteria 4150
20 Ga0070658_10056369 3300005327 Bacteria 3193
21 Ga0070683_100062948 3300005329 Bacteria 3450
22 Ga0070683_100084851 3300005329 Unclassified 2968
23 Ga0070683_100118403 3300005329 Bacteria 2501
24 Ga0070683_100346104 3300005329 Unclassified 1416
25 Ga0070680_100008055 3300005336 Bacteria 8047
26 Ga0070680_100043387 3300005336 Bacteria 3653
27 Ga0070680_100157247 3300005336 Bacteria 1910
28 Ga0070682_100012787 3300005337 Bacteria 4819
29 Ga0068868_100005162 3300005338 Bacteria 9166
30 Ga0070660_100011112 3300005339 Bacteria 6386
31 Ga0070660_100199307 3300005339 Bacteria 1623
32 Ga0070675_100045143 3300005354 Bacteria 3605
33 Ga0070671_100035346 3300005355 Bacteria 4139
34 Ga0070671_100215404 3300005355 Bacteria 1629
35 Ga0070713_100085931 3300005436 Bacteria 2696
36 Ga0070713_100116618 3300005436 Bacteria 2335
37 Ga0070701_10017866 3300005438 Bacteria 3323
38 Ga0070678_100034014 3300005456 Bacteria 3545
39 Ga0070678_100138668 3300005456 Unclassified 1943
40 Ga0070681_10007555 3300005458 Bacteria 10621
41 Ga0070681_10144330 3300005458 Bacteria 2310
42 Ga0070707_100076583 3300005468 Bacteria 3227
43 Ga0070707_100080037 3300005468 Bacteria 3154
44 Ga0070679_100020177 3300005530 Bacteria 6496
45 Ga0070679_100259281 3300005530 Bacteria 1694
46 Ga0070684_100001266 3300005535 Bacteria 18101
47 Ga0070684_100029343 3300005535 Bacteria 4660
48 Ga0070684_100164272 3300005535 Bacteria 2015
49 Ga0070695_100056621 3300005545 Bacteria 2531
50 Ga0070695_100145323 3300005545 Bacteria 1649
51 Ga0070665_100025701 3300005548 Bacteria 5931
52 Ga0068855_100027776 3300005563 Bacteria 6769
53 Ga0068855_100080158 3300005563 Bacteria 3786
54 Ga0068855_100126595 3300005563 Bacteria 2920
55 Ga0068855_100188626 3300005563 Bacteria 2327
56 Ga0070664_100089253 3300005564 Unclassified 2667
57 Ga0068856_100112166 3300005614 Bacteria 2724
58 Ga0068856_100210679 3300005614 Bacteria 1959
59 Ga0068852_100029619 3300005616 Bacteria 4500
60 Ga0068852_100093311 3300005616 Bacteria 2698
61 Ga0068861_100001726 3300005719 Bacteria 14012
62 Ga0081538_10029134 3300005981 Bacteria 3779
63 Ga0081539_10000452 3300005985 Bacteria 87416
64 Ga0081539_10005438 3300005985 Bacteria 12998
65 Ga0070712_100215187 3300006175 Bacteria 1518
66 Ga0097621_100060613 3300006237 Bacteria 3102
67 Ga0075428_100027664 3300006844 Bacteria 6272
68 Ga0075433_10050655 3300006852 Bacteria 3615
69 Ga0075434_100138488 3300006871 Bacteria 2453
70 Ga0075436_100006444 3300006914 Bacteria 8038
71 Ga0075435_100001927 3300007076 Bacteria 13509
72 Ga0105240_10099897 3300009093 Bacteria 3531
73 Ga0105245_10035915 3300009098 Bacteria 4400
74 Ga0114129_10008838 3300009147 Bacteria 14375
75 Ga0114129_10097683 3300009147 Bacteria 4066
76 Ga0114129_10200402 3300009147 Bacteria 2704
77 Ga0105243_10097983 3300009148 Bacteria 2428
78 Ga0105242_10003373 3300009176 Bacteria 12429
79 Ga0105242_10104078 3300009176 Bacteria 2409
80 Ga0105237_10336597 3300009545 Bacteria 1514
81 Ga0105249_10084329 3300009553 Bacteria 2959
82 Ga0105249_10200844 3300009553 Bacteria 1951
83 Ga0105239_10056730 3300010375 Bacteria 4296
84 Ga0105246_10078862 3300011119 Bacteria 2340
85 Ga0157370_10021422 3300013104 Bacteria 6441
86 Ga0157369_10027803 3300013105 Bacteria 6265
87 Ga0157369_10061535 3300013105 Bacteria 4046
88 Ga0157369_10098530 3300013105 Bacteria 3117
89 Ga0157378_10348395 3300013297 Unclassified 1446
90 Ga0163162_10231151 3300013306 Bacteria 1980
91 Ga0182008_10057393 3300014497 Bacteria 1922
92 Ga0197907_10031666 3300020069 Bacteria 1341
93 Ga0197907_10714013 3300020069 Bacteria 1690
94 Ga0206356_10215605 3300020070 Bacteria 1595
95 Ga0206356_10502501 3300020070 Unclassified 1340
96 Ga0206356_10912466 3300020070 Bacteria 1503
97 Ga0206349_1137629 3300020075 Bacteria 1340
98 Ga0206349_1202960 3300020075 Bacteria 1345
99 Ga0206349_1225026 3300020075 Bacteria 1342
100 Ga0206349_1802400 3300020075 Bacteria 1350
101 Ga0206355_1636434 3300020076 Bacteria 1434
102 Ga0206352_10051179 3300020078 Bacteria 1348
103 Ga0206352_10068328 3300020078 Bacteria 1337
104 Ga0206352_11130322 3300020078 Bacteria 1347
105 Ga0206350_11299097 3300020080 Bacteria 1342
106 Ga0206350_11337460 3300020080 Bacteria 1344
107 Ga0206354_10310304 3300020081 Bacteria 2850
108 Ga0206354_10495213 3300020081 Bacteria 1401
109 Ga0206354_10546319 3300020081 Bacteria 3205
110 Ga0206354_11227248 3300020081 Bacteria 1828
111 Ga0206354_11496432 3300020081 Bacteria 2972
112 Ga0206353_11135412 3300020082 Bacteria 8789
113 Ga0154015_1061275 3300020610 Bacteria 1457
114 Ga0154015_1666396 3300020610 Bacteria 1397
115 Ga0224712_10050008 3300022467 Bacteria 1622
116 Ga0224712_10069663 3300022467 Bacteria 1424
117 Ga0224712_10080793 3300022467 Bacteria 1341
118 Ga0207692_10060585 3300025898 Bacteria 1958
119 Ga0207685_10030289 3300025905 Bacteria 1925
120 Ga0207705_10029250 3300025909 Bacteria 3927
121 Ga0207705_10038164 3300025909 Bacteria 3438
122 Ga0207705_10043262 3300025909 Bacteria 3235
123 Ga0207654_10082769 3300025911 Unclassified 1936
124 Ga0207707_10005084 3300025912 Bacteria 11532
125 Ga0207707_10013393 3300025912 Bacteria 7151
126 Ga0207707_10014424 3300025912 Bacteria 6884
127 Ga0207707_10085463 3300025912 Bacteria 2756
128 Ga0207695_10048869 3300025913 Bacteria 4464
129 Ga0207695_10143702 3300025913 Bacteria 2332
130 Ga0207693_10030820 3300025915 Bacteria 4236
131 Ga0207693_10094475 3300025915 Bacteria 2343
132 Ga0207660_10006404 3300025917 Bacteria 7630
133 Ga0207660_10046623 3300025917 Bacteria 3059
134 Ga0207660_10110876 3300025917 Bacteria 2065
135 Ga0207657_10001944 3300025919 Bacteria 22302
136 Ga0207657_10004008 3300025919 Bacteria 15659
137 Ga0207657_10213606 3300025919 Bacteria 1547
138 Ga0207649_10144306 3300025920 Bacteria 1632
139 Ga0207652_10057117 3300025921 Bacteria 3361
140 Ga0207652_10089207 3300025921 Bacteria 2707
141 Ga0207652_10239256 3300025921 Bacteria 1636
142 Ga0207646_10005999 3300025922 Bacteria 12655
143 Ga0207694_10040861 3300025924 Bacteria 3573
144 Ga0207687_10036420 3300025927 Bacteria 3352
145 Ga0207687_10054204 3300025927 Bacteria 2804
146 Ga0207687_10144425 3300025927 Unclassified 1809
147 Ga0207644_10143573 3300025931 Bacteria 1840
148 Ga0207690_10053602 3300025932 Bacteria 2707
149 Ga0207706_10005233 3300025933 Bacteria 12112
150 Ga0207686_10081222 3300025934 Bacteria 2115
151 Ga0207661_10005533 3300025944 Bacteria 8912
152 Ga0207661_10054585 3300025944 Bacteria 3201
153 Ga0207661_10137990 3300025944 Bacteria 2096
154 Ga0207679_10066894 3300025945 Unclassified 2694
155 Ga0207667_10050712 3300025949 Bacteria 4377
156 Ga0207667_10077762 3300025949 Bacteria 3440
157 Ga0207667_10129159 3300025949 Bacteria 2603
158 Ga0207712_10019166 3300025961 Bacteria 4464
159 Ga0207658_10012315 3300025986 Bacteria 5840
160 Ga0207677_10046783 3300026023 Bacteria 2900
161 Ga0207678_10074761 3300026067 Unclassified 2903
162 Ga0207702_10011290 3300026078 Bacteria 7446
163 Ga0207702_10089542 3300026078 Bacteria 2691
164 Ga0207675_100001015 3300026118 Bacteria 27803
165 Ga0207683_10010834 3300026121 Bacteria 7775
166 Ga0207683_10154691 3300026121 Unclassified 2071
167 Ga0207698_10047746 3300026142 Bacteria 3246
168 Ga0265318_10035385 3300028577 Unclassified 1920
169 Ga0265338_10024938 3300028800 Bacteria 6089
170 Ga0265325_10007121 3300031241 Bacteria 6730
171 Ga0265329_10023574 3300031242 Bacteria 2049
172 Ga0265340_10051648 3300031247 Bacteria 1990
173 Ga0265331_10048673 3300031250 Bacteria 2037
174 Ga0265327_10011103 3300031251 Bacteria 6249
175 Ga0265316_10035300 3300031344 Bacteria 4052
176 Ga0265313_10011264 3300031595 Bacteria 5571
177 Ga0265314_10010433 3300031711 Bacteria 7748
178 Ga0265342_10033387 3300031712 Bacteria 3165
179 Ga0307409_100070532 3300031995 Bacteria 2774
180 Ga0373936_0005230 3300035113 Bacteria 4882
181 Ga0373956_0014478 3300035119 Unclassified 3297
182 Ga0373943_0002293 3300035170 Bacteria 8690
183 Ga0373955_0061143 3300035172 Bacteria 2079
184 Ga0373935_0014873 3300035692 Bacteria 4700
185 Ga0373935_0024469 3300035692 Bacteria 3717
186 Ga0373927_0026732 3300035695 Bacteria 3772
187 Ga0373947_0003182 3300035725 Bacteria 9764
188 Ga0373947_0033603 3300035725 Bacteria 3029
189 Ga0373937_0018571 3300036401 Bacteria 6211
190 Ga0373925_0006082 3300037068 Bacteria 8928
191 Ga0395899_0170800 3300037312 Bacteria 1531
192 Ga0395899_0194884 3300037312 Bacteria 1416
193 Ga0395900_0004103 3300037418 Bacteria 15522
194 Ga0395900_0015574 3300037418 Bacteria 7751
195 Ga0395900_0127501 3300037418 Bacteria 2609
196 Ga0395900_0310201 3300037418 Bacteria 1561
197 Ga0395898_0005507 3300037466 Bacteria 13664
198 Ga0395898_0008537 3300037466 Bacteria 10822
199 Ga0395898_0009700 3300037466 Bacteria 10097
200 Ga0395898_0045848 3300037466 Bacteria 4296
201 Ga0395898_0075884 3300037466 Bacteria 3246
202 Ga0395898_0259293 3300037466 Bacteria 1658
203 Ga0395905_0006822 3300037471 Bacteria 11428
204 Ga0395905_0018981 3300037471 Bacteria 6521
205 Ga0395905_0027454 3300037471 Bacteria 5368
206 Ga0395905_0028465 3300037471 Bacteria 5268
207 Ga0436364_0116090 3300037853 Bacteria 2573
208 Ga0395901_0005779 3300038443 Bacteria 12527
209 Ga0395901_0008519 3300038443 Bacteria 10359
210 Ga0395901_0025577 3300038443 Bacteria 6059
211 Ga0395901_0030939 3300038443 Bacteria 5517
212 Ga0395901_0034506 3300038443 Bacteria 5224
213 Ga0395901_0034746 3300038443 Bacteria 5207
214 Ga0395901_0039714 3300038443 Bacteria 4871
215 Ga0395901_0041397 3300038443 Bacteria 4774
216 Ga0395901_0115358 3300038443 Bacteria 2821
217 Ga0395901_0140930 3300038443 Bacteria 2534
218 Ga0395901_0141309 3300038443 Bacteria 2530
219 Ga0395901_0374775 3300038443 Bacteria 1466
220 Ga0436363_0126299 3300039450 Unclassified 1796
221 Ga0436363_0630718 3300039450 Bacteria 2243
222 Ga0451853_3647204 3300041512 Bacteria 3197
223 Ga0466966_0001346 3300044684 Bacteria 15791
224 Ga0466961_0009411 3300044693 Bacteria 6221
225 Ga0466961_0013046 3300044693 Bacteria 5316
226 Ga0466961_0021252 3300044693 Bacteria 4179
227 Ga0466963_0000966 3300044694 Bacteria 14757
228 Ga0466963_0037760 3300044694 Bacteria 3156
229 Ga0466963_0067089 3300044694 Bacteria 2407
230 Ga0466963_0184628 3300044694 Bacteria 1456
231 Ga0466964_0008733 3300044706 Bacteria 3809
232 Ga0466964_0029399 3300044706 Bacteria 2169
233 Ga0466971_0000772 3300044719 Bacteria 12872
234 Ga0466968_0002959 3300044735 Bacteria 6276
235 Ga0466957_0000801 3300044842 Bacteria 16044
236 Ga0466957_0035491 3300044842 Bacteria 2992
237 Ga0466960_0027198 3300044901 Bacteria 2606
238 Ga0466960_0032197 3300044901 Bacteria 2425
239 Ga0466959_0014682 3300045049 Bacteria 5700
240 Ga0466959_0055081 3300045049 Bacteria 2904
241 Ga0466959_0074304 3300045049 Bacteria 2458
242 Ga0451576_0179242 3300045051 Bacteria 2212
243 Ga0466958_0003509 3300045836 Bacteria 8146
244 Ga0466958_0027867 3300045836 Bacteria 3345
245 Ga0466958_0030581 3300045836 Bacteria 3199
246 Ga0466967_0000742 3300045976 Bacteria 16747
247 Ga0466967_0005156 3300045976 Bacteria 8987
248 Ga0466967_0011039 3300045976 Bacteria 6816
249 Ga0466967_0019771 3300045976 Bacteria 5424
250 Ga0466967_0020083 3300045976 Bacteria 5389
251 Ga0466967_0022314 3300045976 Bacteria 5162
252 Ga0466967_0032713 3300045976 Bacteria 4395
253 Ga0466967_0066382 3300045976 Bacteria 3214
254 Ga0466967_0136615 3300045976 Bacteria 2280
255 Ga0495592_0102520 3300046454 Bacteria 2037
256 Ga0495592_0107190 3300046454 Bacteria 1982
257 Ga0495592_0159498 3300046454 Bacteria 1553
258 Ga0495603_0015171 3300046455 Unclassified 4661
259 Ga0495629_0001622 3300046459 Bacteria 17679
260 Ga0495629_0090140 3300046459 Bacteria 2139
261 Ga0495641_0001841 3300046461 Bacteria 17419
262 Ga0495641_0010338 3300046461 Bacteria 5417
263 Ga0495651_0026233 3300046462 Bacteria 4538
264 Ga0495651_0027904 3300046462 Bacteria 4400
265 Ga0495651_0098543 3300046462 Bacteria 2181
266 Ga0495653_0016958 3300046463 Bacteria 5924
267 Ga0495653_0039451 3300046463 Bacteria 3699
268 Ga0495580_0143077 3300046472 Bacteria 1658
269 Ga0495582_0000056 3300046473 Bacteria 57084
270 Ga0495639_0022831 3300046475 Bacteria 2747
271 Ga0495639_0055463 3300046475 Bacteria 1808
272 Ga0495662_0041166 3300046476 Bacteria 2230
273 Ga0495594_0041821 3300046499 Bacteria 2509
274 Ga0495608_0004914 3300046511 Bacteria 9575
275 Ga0495608_0049392 3300046511 Bacteria 2793
276 Ga0495628_0095932 3300046516 Bacteria 2291
277 Ga0495630_0007008 3300046517 Bacteria 8035
278 Ga0495630_0044202 3300046517 Bacteria 3328
279 Ga0495630_0105030 3300046517 Bacteria 2138
280 Ga0495630_0221469 3300046517 Bacteria 1444
281 Ga0495631_0039562 3300046518 Bacteria 2092
282 Ga0495666_0010878 3300046526 Bacteria 4537
283 Ga0495652_0008542 3300046529 Bacteria 9340
284 Ga0495652_0030362 3300046529 Bacteria 4741
285 Ga0495665_0003468 3300046531 Bacteria 8557
286 Ga0495640_0012319 3300046533 Bacteria 6539
287 Ga0495586_0042498 3300046535 Bacteria 2448
288 Ga0495587_0008719 3300046536 Bacteria 6508
289 Ga0495645_0034289 3300046543 Bacteria 3703
290 Ga0495667_0013420 3300046559 Bacteria 5547
291 Ga0495667_0056775 3300046559 Bacteria 2574
292 Ga0495635_0021261 3300046663 Bacteria 4523
293 Ga0495659_0039685 3300046664 Bacteria 1674
294 Ga0495657_0008337 3300046675 Bacteria 7940
295 Ga0495599_0061728 3300046678 Bacteria 2341
296 Ga0495623_0008882 3300046679 Bacteria 6523
297 Ga0495646_0007975 3300046680 Bacteria 6732
298 Ga0495658_0001666 3300046683 Bacteria 11556
299 Ga0495658_0009357 3300046683 Bacteria 4882
300 Ga0495613_0002530 3300046689 Bacteria 13759
301 Ga0495613_0010129 3300046689 Bacteria 7003
302 Ga0495613_0031063 3300046689 Bacteria 3967
303 Ga0495624_0137129 3300046690 Bacteria 1499
304 Ga0495600_0017811 3300046809 Bacteria 4521
305 Ga0495600_0024100 3300046809 Bacteria 3916
306 Ga0495581_0025524 3300047315 Unclassified 3426
307 Ga0495604_0003434 3300047317 Bacteria 12641
308 Ga0495604_0016533 3300047317 Bacteria 5898
309 Ga0495674_0011044 3300047319 Bacteria 8527
310 Ga0495676_0004756 3300047321 Bacteria 12436
311 Ga0495680_0007363 3300047322 Bacteria 10109
312 Ga0495680_0008399 3300047322 Bacteria 9392
313 Ga0495675_0003480 3300047444 Bacteria 9481
314 Ga0495684_0024012 3300047471 Bacteria 4691
315 Ga0495684_0056206 3300047471 Bacteria 3001
316 Ga0495593_0005872 3300047673 Bacteria 7235
317 Ga0495602_0148561 3300048088 Bacteria 1845
318 Ga0495614_0023700 3300048089 Bacteria 2649
319 Ga0496100_0021863 3300048903 Bacteria 3860
320 Ga0496100_0031973 3300048903 Bacteria 3276
321 Ga0496100_0052789 3300048903 Bacteria 2644
322 Ga0496100_0087816 3300048903 Unclassified 2115
323 Ga0496101_0001238 3300048904 Bacteria 15269
324 Ga0496101_0006890 3300048904 Bacteria 7334
325 Ga0496101_0014232 3300048904 Bacteria 5345
326 Ga0496101_0038767 3300048904 Bacteria 3385
327 Ga0496101_0051667 3300048904 Bacteria 2962
328 Ga0496102_0020628 3300048905 Bacteria 5824
329 Ga0496102_0048824 3300048905 Bacteria 3848
330 Ga0496102_0058016 3300048905 Bacteria 3536
331 Ga0496102_0077347 3300048905 Bacteria 3062
332 Ga0496102_0194037 3300048905 Unclassified 1914
333 Ga0496103_0010269 3300048906 Bacteria 5537
334 Ga0496103_0024276 3300048906 Bacteria 3658
335 Ga0496103_0050377 3300048906 Bacteria 2576
336 Ga0496103_0060359 3300048906 Bacteria 2357
337 Ga0496103_0083139 3300048906 Unclassified 2015
338 Ga0496104_0001580 3300048907 Bacteria 19607
339 Ga0496104_0003064 3300048907 Bacteria 14407
340 Ga0496104_0024515 3300048907 Bacteria 5549
341 Ga0496104_0064425 3300048907 Bacteria 3476
342 Ga0496104_0104242 3300048907 Bacteria 2717
343 Ga0496104_0324916 3300048907 Unclassified 1451
344 Ga0496105_0006872 3300048908 Bacteria 8758
345 Ga0496105_0011990 3300048908 Bacteria 6863
346 Ga0496105_0021962 3300048908 Bacteria 5167
347 Ga0496105_0024440 3300048908 Bacteria 4908
348 Ga0496105_0028852 3300048908 Bacteria 4540
349 Ga0496105_0085532 3300048908 Bacteria 2605
350 Ga0496105_0138331 3300048908 Bacteria 2005
351 Ga0496105_0242730 3300048908 Unclassified 1461
352 Ga0496106_0007058 3300048909 Bacteria 8297
353 Ga0496106_0008361 3300048909 Bacteria 7663
354 Ga0496106_0018501 3300048909 Bacteria 5153
355 Ga0496107_0003998 3300048910 Bacteria 9928
356 Ga0496107_0046747 3300048910 Bacteria 3115
357 Ga0496107_0079473 3300048910 Unclassified 2390
358 Ga0496108_0000999 3300048911 Bacteria 22085
359 Ga0496108_0017635 3300048911 Bacteria 5842
360 Ga0496108_0069987 3300048911 Bacteria 2961
361 Ga0496109_0002694 3300048912 Bacteria 14888
362 Ga0496109_0014720 3300048912 Bacteria 6806
363 Ga0496109_0018465 3300048912 Bacteria 6126
364 Ga0496109_0034424 3300048912 Bacteria 4561
365 Ga0496109_0041819 3300048912 Bacteria 4151
366 Ga0496109_0074938 3300048912 Bacteria 3111
367 Ga0496109_0256607 3300048912 Bacteria 1647
368 Ga0496110_0000937 3300048913 Bacteria 20485
369 Ga0496110_0002216 3300048913 Bacteria 14522
370 Ga0496110_0031194 3300048913 Bacteria 4598
371 Ga0496110_0093138 3300048913 Bacteria 2697
372 Ga0496110_0099877 3300048913 Bacteria 2601
373 Ga0496110_0120118 3300048913 Bacteria 2367
374 Ga0496111_0001971 3300048914 Bacteria 12192
375 Ga0496111_0003876 3300048914 Bacteria 9355
376 Ga0496111_0024870 3300048914 Bacteria 4223
377 Ga0496111_0034630 3300048914 Bacteria 3606
378 Ga0496111_0089763 3300048914 Bacteria 2251
379 Ga0496111_0142945 3300048914 Bacteria 1773
380 Ga0496111_0187850 3300048914 Unclassified 1536
381 Ga0496112_0006674 3300048915 Bacteria 10159
382 Ga0496112_0011566 3300048915 Bacteria 8066
383 Ga0496112_0027493 3300048915 Bacteria 5484
384 Ga0496112_0052838 3300048915 Bacteria 3989
385 Ga0496112_0070537 3300048915 Bacteria 3454
386 Ga0496112_0116302 3300048915 Bacteria 2645
387 Ga0496112_0137135 3300048915 Bacteria 2416
388 Ga0496112_0265944 3300048915 Bacteria 1664
389 Ga0496112_0305685 3300048915 Bacteria 1535
390 Ga0496113_0001540 3300048916 Bacteria 12917
391 Ga0496113_0050779 3300048916 Bacteria 3093
392 Ga0496113_0058619 3300048916 Bacteria 2898
393 Ga0496113_0191011 3300048916 Bacteria 1626
394 Ga0496113_0208217 3300048916 Bacteria 1556
395 Ga0496114_0000670 3300048917 Bacteria 25410
396 Ga0496114_0018288 3300048917 Bacteria 5665
397 Ga0496114_0027030 3300048917 Bacteria 4700
398 Ga0496114_0029774 3300048917 Bacteria 4488
399 Ga0496114_0038396 3300048917 Bacteria 3962
400 Ga0496114_0114512 3300048917 Bacteria 2312
401 Ga0496114_0121215 3300048917 Bacteria 2249
402 Ga0496114_0124904 3300048917 Bacteria 2217
403 Ga0496114_0143603 3300048917 Bacteria 2068
404 Ga0496114_0206073 3300048917 Bacteria 1724
405 Ga0496114_0284887 3300048917 Unclassified 1457
406 Ga0496115_0005423 3300048918 Bacteria 9276
407 Ga0496115_0012711 3300048918 Bacteria 6345
408 Ga0496115_0012841 3300048918 Bacteria 6316
409 Ga0496115_0016668 3300048918 Bacteria 5600
410 Ga0496115_0048331 3300048918 Bacteria 3403
411 Ga0496115_0066519 3300048918 Bacteria 2913
412 Ga0501047_0042263 3300049581 Bacteria 4405
413 Ga0501047_0076981 3300049581 Bacteria 3210
414 Ga0501067_0025682 3300049583 Bacteria 3265
415 Ga0501067_0028246 3300049583 Bacteria 3107
416 Ga0501067_0088232 3300049583 Unclassified 1721
417 Ga0501069_0004994 3300049585 Bacteria 6878
418 Ga0501069_0009846 3300049585 Bacteria 5054
419 Ga0501070_0000463 3300049586 Bacteria 36856
420 Ga0501070_0099852 3300049586 Bacteria 2401
421 Ga0501070_0139095 3300049586 Bacteria 2005
422 Ga0501071_0232139 3300049587 Unclassified 1390
423 Ga0501074_0024986 3300049590 Bacteria 4340
424 Ga0501079_0163900 3300049741 Bacteria 1734
425 Ga0501080_0058461 3300049742 Bacteria 3589
426 Ga0501035_0174374 3300049822 Bacteria 1856
427 nmdc:mga05p37_18504_c1 3300050507 Bacteria 8416
428 nmdc:mga05p37_2622_c1 3300050507 Bacteria 20935
429 nmdc:mga05p37_7763_c1 3300050507 Bacteria 12665
430 nmdc:mga0n895_100273_c1 3300050512 Bacteria 2905
431 nmdc:mga0rr50_11123_c1 3300050513 Bacteria 5743
432 nmdc:mga0a205_130868_c1 3300050515 Bacteria 2409
433 Ga0495601_0012270 3300053077 Bacteria 5138
434 Ga0495601_0075818 3300053077 Bacteria 2153
435 Ga0495601_0129746 3300053077 Unclassified 1641
436 Ga0495595_0008252 3300053084 Bacteria 4276
437 Ga0495595_0012524 3300053084 Bacteria 3567
438 Ga0495619_0003653 3300053085 Bacteria 9915
439 Ga0587080_008115 3300059503 Unclassified 1495
440 Ga0587082_007766 3300059504 Bacteria 1474
441 Ga0587094_004250 3300059513 Unclassified 1618
442 Ga0587106_005359 3300059605 Unclassified 1463
443 Ga0587129_001226 3300059608 Bacteria 1366
444 Ga0587076_007394 3300059645 Unclassified 1499
445 Ga0587079_005399 3300059647 Bacteria 1805
446 Ga0587107_004331 3300059652 Bacteria 1438
447 Ga0587111_0009840 3300060346 Bacteria 1625
448 Ga0501082_0252152 3300060353 Bacteria 1536
449 Ga0466962_0000126 3300061719 Bacteria 31190
450 Ga0496100_0181029
451 Ga0006759J45824_1030507
452 JGI25406J46586_10003486
453 Ga0007417J51691_1028887
454 Ga0007410J51695_1018393
455 Ga0007410J51695_1037313
456 Ga0007409J51694_1015140
457 Ga0007429J51699_1039337
458 Ga0007429J51699_1062163
459 Ga0032354_1020654
460 Ga0032354_1023329
461 Ga0058859_11735953
462 Ga0058863_11945381
463 Ga0058861_10041292
464 Ga0058861_12063506
465 Ga0058862_10025393
466 Ga0058862_12839372
467 Ga0070658_10006766
468 Ga0070658_10033215
469 Ga0070658_10056369
470 Ga0070683_100062948
471 Ga0070683_100084851
472 Ga0070683_100118403
473 Ga0070683_100346104
474 Ga0070680_100008055
475 Ga0070680_100043387
476 Ga0070680_100157247
477 Ga0070682_100012787
478 Ga0068868_100005162
479 Ga0070660_100011112
480 Ga0070660_100199307
481 Ga0070675_100045143
482 Ga0070671_100035346
483 Ga0070671_100215404
484 Ga0070713_100085931
485 Ga0070713_100116618
486 Ga0070701_10017866
487 Ga0070678_100034014
488 Ga0070678_100138668
489 Ga0070681_10007555
490 Ga0070681_10144330
491 Ga0070707_100076583
492 Ga0070707_100080037
493 Ga0070679_100020177
494 Ga0070679_100259281
495 Ga0070684_100001266
496 Ga0070684_100029343
497 Ga0070684_100164272
498 Ga0070695_100056621
499 Ga0070695_100145323
500 Ga0070665_100025701
501 Ga0068855_100027776
502 Ga0068855_100080158
503 Ga0068855_100126595
504 Ga0068855_100188626
505 Ga0070664_100089253
506 Ga0068856_100112166
507 Ga0068856_100210679
508 Ga0068852_100029619
509 Ga0068852_100093311
510 Ga0068861_100001726
511 Ga0081538_10029134
512 Ga0081539_10000452
513 Ga0081539_10005438
514 Ga0070712_100215187
515 Ga0097621_100060613
516 Ga0075428_100027664
517 Ga0075433_10050655
518 Ga0075434_100138488
519 Ga0075436_100006444
520 Ga0075435_100001927
521 Ga0105240_10099897
522 Ga0105245_10035915
523 Ga0114129_10008838
524 Ga0114129_10097683
525 Ga0114129_10200402
526 Ga0105243_10097983
527 Ga0105242_10003373
528 Ga0105242_10104078
529 Ga0105237_10336597
530 Ga0105249_10084329
531 Ga0105249_10200844
532 Ga0105239_10056730
533 Ga0105246_10078862
534 Ga0157370_10021422
535 Ga0157369_10027803
536 Ga0157369_10061535
537 Ga0157369_10098530
538 Ga0157378_10348395
539 Ga0163162_10231151
540 Ga0182008_10057393
541 Ga0197907_10031666
542 Ga0197907_10714013
543 Ga0206356_10215605
544 Ga0206356_10502501
545 Ga0206356_10912466
546 Ga0206349_1137629
547 Ga0206349_1202960
548 Ga0206349_1225026
549 Ga0206349_1802400
550 Ga0206355_1636434
551 Ga0206352_10051179
552 Ga0206352_10068328
553 Ga0206352_11130322
554 Ga0206350_11299097
555 Ga0206350_11337460
556 Ga0206354_10310304
557 Ga0206354_10495213
558 Ga0206354_10546319
559 Ga0206354_11227248
560 Ga0206354_11496432
561 Ga0206353_11135412
562 Ga0154015_1061275
563 Ga0154015_1666396
564 Ga0224712_10050008
565 Ga0224712_10069663
566 Ga0224712_10080793
567 Ga0207692_10060585
568 Ga0207685_10030289
569 Ga0207705_10029250
570 Ga0207705_10038164
571 Ga0207705_10043262
572 Ga0207654_10082769
573 Ga0207707_10005084
574 Ga0207707_10013393
575 Ga0207707_10014424
576 Ga0207707_10085463
577 Ga0207695_10048869
578 Ga0207695_10143702
579 Ga0207693_10030820
580 Ga0207693_10094475
581 Ga0207660_10006404
582 Ga0207660_10046623
583 Ga0207660_10110876
584 Ga0207657_10001944
585 Ga0207657_10004008
586 Ga0207657_10213606
587 Ga0207649_10144306
588 Ga0207652_10057117
589 Ga0207652_10089207
590 Ga0207652_10239256
591 Ga0207646_10005999
592 Ga0207694_10040861
593 Ga0207687_10036420
594 Ga0207687_10054204
595 Ga0207687_10144425
596 Ga0207644_10143573
597 Ga0207690_10053602
598 Ga0207706_10005233
599 Ga0207686_10081222
600 Ga0207661_10005533
601 Ga0207661_10054585
602 Ga0207661_10137990
603 Ga0207679_10066894
604 Ga0207667_10050712
605 Ga0207667_10077762
606 Ga0207667_10129159
607 Ga0207712_10019166
608 Ga0207658_10012315
609 Ga0207677_10046783
610 Ga0207678_10074761
611 Ga0207702_10011290
612 Ga0207702_10089542
613 Ga0207675_100001015
614 Ga0207683_10010834
615 Ga0207683_10154691
616 Ga0207698_10047746
617 Ga0265318_10035385
618 Ga0265338_10024938
619 Ga0265325_10007121
620 Ga0265329_10023574
621 Ga0265340_10051648
622 Ga0265331_10048673
623 Ga0265327_10011103
624 Ga0265316_10035300
625 Ga0265313_10011264
626 Ga0265314_10010433
627 Ga0265342_10033387
628 Ga0307409_100070532
629 Ga0373936_0005230
630 Ga0373956_0014478
631 Ga0373943_0002293
632 Ga0373955_0061143
633 Ga0373935_0014873
634 Ga0373935_0024469
635 Ga0373927_0026732
636 Ga0373947_0003182
637 Ga0373947_0033603
638 Ga0373937_0018571
639 Ga0373925_0006082
640 Ga0395899_0170800
641 Ga0395899_0194884
642 Ga0395900_0004103
643 Ga0395900_0015574
644 Ga0395900_0127501
645 Ga0395900_0310201
646 Ga0395898_0005507
647 Ga0395898_0008537
648 Ga0395898_0009700
649 Ga0395898_0045848
650 Ga0395898_0075884
651 Ga0395898_0259293
652 Ga0395905_0006822
653 Ga0395905_0018981
654 Ga0395905_0027454
655 Ga0395905_0028465
656 Ga0436364_0116090
657 Ga0395901_0005779
658 Ga0395901_0008519
659 Ga0395901_0025577
660 Ga0395901_0030939
661 Ga0395901_0034506
662 Ga0395901_0034746
663 Ga0395901_0039714
664 Ga0395901_0041397
665 Ga0395901_0115358
666 Ga0395901_0140930
667 Ga0395901_0141309
668 Ga0395901_0374775
669 Ga0436363_0126299
670 Ga0436363_0630718
671 Ga0451853_3647204
672 Ga0466966_0001346
673 Ga0466961_0009411
674 Ga0466961_0013046
675 Ga0466961_0021252
676 Ga0466963_0000966
677 Ga0466963_0037760
678 Ga0466963_0067089
679 Ga0466963_0184628
680 Ga0466964_0008733
681 Ga0466964_0029399
682 Ga0466971_0000772
683 Ga0466968_0002959
684 Ga0466957_0000801
685 Ga0466957_0035491
686 Ga0466960_0027198
687 Ga0466960_0032197
688 Ga0466959_0014682
689 Ga0466959_0055081
690 Ga0466959_0074304
691 Ga0451576_0179242
692 Ga0466958_0003509
693 Ga0466958_0027867
694 Ga0466958_0030581
695 Ga0466967_0000742
696 Ga0466967_0005156
697 Ga0466967_0011039
698 Ga0466967_0019771
699 Ga0466967_0020083
700 Ga0466967_0022314
701 Ga0466967_0032713
702 Ga0466967_0066382
703 Ga0466967_0136615
704 Ga0495592_0102520
705 Ga0495592_0107190
706 Ga0495592_0159498
707 Ga0495603_0015171
708 Ga0495629_0001622
709 Ga0495629_0090140
710 Ga0495641_0001841
711 Ga0495641_0010338
712 Ga0495651_0026233
713 Ga0495651_0027904
714 Ga0495651_0098543
715 Ga0495653_0016958
716 Ga0495653_0039451
717 Ga0495580_0143077
718 Ga0495582_0000056
719 Ga0495639_0022831
720 Ga0495639_0055463
721 Ga0495662_0041166
722 Ga0495594_0041821
723 Ga0495608_0004914
724 Ga0495608_0049392
725 Ga0495628_0095932
726 Ga0495630_0007008
727 Ga0495630_0044202
728 Ga0495630_0105030
729 Ga0495630_0221469
730 Ga0495631_0039562
731 Ga0495666_0010878
732 Ga0495652_0008542
733 Ga0495652_0030362
734 Ga0495665_0003468
735 Ga0495640_0012319
736 Ga0495586_0042498
737 Ga0495587_0008719
738 Ga0495645_0034289
739 Ga0495667_0013420
740 Ga0495667_0056775
741 Ga0495635_0021261
742 Ga0495659_0039685
743 Ga0495657_0008337
744 Ga0495599_0061728
745 Ga0495623_0008882
746 Ga0495646_0007975
747 Ga0495658_0001666
748 Ga0495658_0009357
749 Ga0495613_0002530
750 Ga0495613_0010129
751 Ga0495613_0031063
752 Ga0495624_0137129
753 Ga0495600_0017811
754 Ga0495600_0024100
755 Ga0495581_0025524
756 Ga0495604_0003434
757 Ga0495604_0016533
758 Ga0495674_0011044
759 Ga0495676_0004756
760 Ga0495680_0007363
761 Ga0495680_0008399
762 Ga0495675_0003480
763 Ga0495684_0024012
764 Ga0495684_0056206
765 Ga0495593_0005872
766 Ga0495602_0148561
767 Ga0495614_0023700
768 Ga0496100_0021863
769 Ga0496100_0031973
770 Ga0496100_0052789
771 Ga0496100_0087816
772 Ga0496101_0001238
773 Ga0496101_0006890
774 Ga0496101_0014232
775 Ga0496101_0038767
776 Ga0496101_0051667
777 Ga0496102_0020628
778 Ga0496102_0048824
779 Ga0496102_0058016
780 Ga0496102_0077347
781 Ga0496102_0194037
782 Ga0496103_0010269
783 Ga0496103_0024276
784 Ga0496103_0050377
785 Ga0496103_0060359
786 Ga0496103_0083139
787 Ga0496104_0001580
788 Ga0496104_0003064
789 Ga0496104_0024515
790 Ga0496104_0064425
791 Ga0496104_0104242
792 Ga0496104_0324916
793 Ga0496105_0006872
794 Ga0496105_0011990
795 Ga0496105_0021962
796 Ga0496105_0024440
797 Ga0496105_0028852
798 Ga0496105_0085532
799 Ga0496105_0138331
800 Ga0496105_0242730
801 Ga0496106_0007058
802 Ga0496106_0008361
803 Ga0496106_0018501
804 Ga0496107_0003998
805 Ga0496107_0046747
806 Ga0496107_0079473
807 Ga0496108_0000999
808 Ga0496108_0017635
809 Ga0496108_0069987
810 Ga0496109_0002694
811 Ga0496109_0014720
812 Ga0496109_0018465
813 Ga0496109_0034424
814 Ga0496109_0041819
815 Ga0496109_0074938
816 Ga0496109_0256607
817 Ga0496110_0000937
818 Ga0496110_0002216
819 Ga0496110_0031194
820 Ga0496110_0093138
821 Ga0496110_0099877
822 Ga0496110_0120118
823 Ga0496111_0001971
824 Ga0496111_0003876
825 Ga0496111_0024870
826 Ga0496111_0034630
827 Ga0496111_0089763
828 Ga0496111_0142945
829 Ga0496111_0187850
830 Ga0496112_0006674
831 Ga0496112_0011566
832 Ga0496112_0027493
833 Ga0496112_0052838
834 Ga0496112_0070537
835 Ga0496112_0116302
836 Ga0496112_0137135
837 Ga0496112_0265944
838 Ga0496112_0305685
839 Ga0496113_0001540
840 Ga0496113_0050779
841 Ga0496113_0058619
842 Ga0496113_0191011
843 Ga0496113_0208217
844 Ga0496114_0000670
845 Ga0496114_0018288
846 Ga0496114_0027030
847 Ga0496114_0029774
848 Ga0496114_0038396
849 Ga0496114_0114512
850 Ga0496114_0121215
851 Ga0496114_0124904
852 Ga0496114_0143603
853 Ga0496114_0206073
854 Ga0496114_0284887
855 Ga0496115_0005423
856 Ga0496115_0012711
857 Ga0496115_0012841
858 Ga0496115_0016668
859 Ga0496115_0048331
860 Ga0496115_0066519
861 Ga0501047_0042263
862 Ga0501047_0076981
863 Ga0501067_0025682
864 Ga0501067_0028246
865 Ga0501067_0088232
866 Ga0501069_0004994
867 Ga0501069_0009846
868 Ga0501070_0000463
869 Ga0501070_0099852
870 Ga0501070_0139095
871 Ga0501071_0232139
872 Ga0501074_0024986
873 Ga0501079_0163900
874 Ga0501080_0058461
875 Ga0501035_0174374
876 nmdc:mga05p37_18504_c1
877 nmdc:mga05p37_2622_c1
878 nmdc:mga05p37_7763_c1
879 nmdc:mga0n895_100273_c1
880 nmdc:mga0rr50_11123_c1
881 nmdc:mga0a205_130868_c1
882 Ga0495601_0012270
883 Ga0495601_0075818
884 Ga0495601_0129746
885 Ga0495595_0008252
886 Ga0495595_0012524
887 Ga0495619_0003653
888 Ga0587080_008115
889 Ga0587082_007766
890 Ga0587094_004250
891 Ga0587106_005359
892 Ga0587129_001226
893 Ga0587076_007394
894 Ga0587079_005399
895 Ga0587107_004331
896 Ga0587111_0009840
897 Ga0501082_0252152
898 Ga0466962_0000126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

113

473

0.81

PF01094

ANF_receptor

Receptor family ligand binding region

126

470

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3td9-assembly1.cif.gz_A-2 crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution 0.8451 37 390
3td9-assembly1.cif.gz_A-2 crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution 0.8337 37 390
4gnr-assembly1.cif.gz_A 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. canada mdr_19a in complex with isoleucine 0.8108 36 390
4gnr-assembly1.cif.gz_A 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. canada mdr_19a in complex with isoleucine 0.8065 36 390
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8012 37 385
ID Description Score Start End Superfamily
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9127 181 386 3.40.50.2300
3sg0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8979 181 306 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8928 181 305 3.40.50.2300
3td9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8894 179 390 3.40.50.2300
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8886 181 386 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A538JHZ6-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9232 1 333 GO:0016020
AF-A0A6I3BSG3-F1-model_v4 ABC transporter substrate-binding protein 0.9186 1 398
AF-A0A6I3BSG3-F1-model_v4 ABC transporter substrate-binding protein 0.9163 1 398
AF-A0A538LEA7-F1-model_v4 Leucine-binding protein domain-containing protein 0.9112 1 288
AF-A0A537YN74-F1-model_v4 Leucine-binding protein domain-containing protein 0.9069 2 397

Map