F446421

General Info

Members Datasets Scaffolds Average Seq Length
449 256 434 222

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10380700|Ga0307411_103807002
Length 251
Sequence MARTTTRPAAKPRGGKKAAAPPKLSPEEVRIFYERLAERTPNPETELDYVNDFTLLVAVVLSAQATDASVNLATRDLFEAVNTPEAMVALGEEGLKQHIKTIGLFNTKAKNVIALSQALIEQHGSQVPANRDALQKLPGVGRKTANVVMNCAFGAETFAVDTHVFRVSNRTGLAPGKDVDAVERILDAETPQPWRRDAHHYLILHGRYVCKARTPECWRCVVADICRYEPKTPPPGSTKEAKVIAARRGRA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
7 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
8 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
9 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
10 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
11 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
12 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
13 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
14 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
190 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
239 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
253 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
256 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 0
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.17
Nodule 0.67
Rhizoplane 2
Rhizosphere 61.47
Stem 0
Stem Tuber 0
Unclassified 10.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
2 JGI24738J21930_10051444 3300002075 Bacteria 840
3 JGI25150J39212_1000333 3300002774 Bacteria 23253
4 JGI25151J46595_10006895 3300003187 Bacteria 5640
5 JGI25165J46597_1000104 3300003214 Bacteria 152363
6 JGI25153J46596_10000055 3300003215 Bacteria 135518
7 Ga0055542_1000041 3300003762 Bacteria 208892
8 Ga0055529_1000040 3300003763 Bacteria 230562
9 Ga0055536_1008174 3300003781 Bacteria 4548
10 Ga0055530_10000355 3300003791 Bacteria 41390
11 Ga0055530_10001551 3300003791 Bacteria 16496
12 Ga0055540_1000238 3300003792 Bacteria 50223
13 Ga0055531_10003290 3300003794 Bacteria 10355
14 Ga0055531_10032165 3300003794 Bacteria 1719
15 Ga0065165_1002875 3300005262 Bacteria 13257
16 Ga0065704_10003487 3300005289 Bacteria 7552
17 Ga0065704_10011948 3300005289 Bacteria 3159
18 Ga0065704_10070205 3300005289 Bacteria 83747
19 Ga0065704_10112941 3300005289 Bacteria 1919
20 Ga0065707_10110114 3300005295 Bacteria 2443
21 Ga0070658_10000001 3300005327 Bacteria 856789
22 Ga0070683_101158336 3300005329 Bacteria 743
23 Ga0070670_100142632 3300005331 Bacteria 2072
24 Ga0070680_100000295 3300005336 Bacteria 33407
25 Ga0070680_100249429 3300005336 Bacteria 1501
26 Ga0070682_100097180 3300005337 Bacteria 1938
27 Ga0070660_100001519 3300005339 Bacteria 15915
28 Ga0070660_100002789 3300005339 Bacteria 12001
29 Ga0070660_100106201 3300005339 Bacteria 2230
30 Ga0070661_100000001 3300005344 Bacteria 424830
31 Ga0070692_10106977 3300005345 Bacteria 1542
32 Ga0070668_100049723 3300005347 Bacteria 3226
33 Ga0070669_100016649 3300005353 Bacteria 5247
34 Ga0070669_100234150 3300005353 Bacteria 1457
35 Ga0070675_100482160 3300005354 Bacteria 1115
36 Ga0070671_100000208 3300005355 Bacteria 38891
37 Ga0070671_100004793 3300005355 Bacteria 10754
38 Ga0070671_100096034 3300005355 Bacteria 2485
39 Ga0070659_100000004 3300005366 Bacteria 267958
40 Ga0070659_100001413 3300005366 Bacteria 17310
41 Ga0070659_100003359 3300005366 Bacteria 11387
42 Ga0070659_100031472 3300005366 Bacteria 4109
43 Ga0070667_100000626 3300005367 Bacteria 34381
44 Ga0070667_100056826 3300005367 Bacteria 3306
45 Ga0070708_100355655 3300005445 Bacteria 1380
46 Ga0070678_100000077 3300005456 Bacteria 37044
47 Ga0070678_100664459 3300005456 Bacteria 936
48 Ga0070662_100152259 3300005457 Bacteria 1802
49 Ga0070681_10010156 3300005458 Bacteria 9285
50 Ga0070681_10145461 3300005458 Bacteria 2299
51 Ga0070706_100205369 3300005467 Bacteria 1840
52 Ga0070679_100000017 3300005530 Bacteria 129377
53 Ga0068853_100067089 3300005539 Bacteria 3116
54 Ga0068853_100499749 3300005539 Bacteria 1148
55 Ga0070672_100044540 3300005543 Bacteria 3428
56 Ga0070672_100138060 3300005543 Bacteria 2009
57 Ga0070686_100000511 3300005544 Bacteria 23259
58 Ga0070686_100011481 3300005544 Bacteria 5024
59 Ga0070665_100000070 3300005548 Bacteria 200681
60 Ga0070665_100000495 3300005548 Bacteria 56309
61 Ga0070665_100063332 3300005548 Bacteria 3708
62 Ga0070665_100124606 3300005548 Bacteria 2579
63 Ga0068855_100003516 3300005563 Bacteria 19170
64 Ga0068855_100070850 3300005563 Bacteria 4055
65 Ga0068855_100234873 3300005563 Bacteria 2051
66 Ga0068854_100027029 3300005578 Bacteria 3951
67 Ga0068856_100010183 3300005614 Bacteria 9140
68 Ga0068852_100000232 3300005616 Bacteria 37715
69 Ga0068852_100221662 3300005616 Bacteria 1799
70 Ga0068864_100184877 3300005618 Bacteria 1907
71 Ga0068851_10178138 3300005834 Bacteria 1176
72 Ga0068863_100034439 3300005841 Bacteria 4824
73 Ga0068863_100045936 3300005841 Bacteria 4145
74 Ga0068863_100099081 3300005841 Bacteria 2769
75 Ga0068858_100000626 3300005842 Bacteria 36822
76 Ga0068858_100002691 3300005842 Bacteria 17896
77 Ga0068860_100023009 3300005843 Bacteria 6026
78 Ga0068860_100048388 3300005843 Bacteria 4052
79 Ga0068860_100182377 3300005843 Bacteria 2029
80 Ga0068862_100008681 3300005844 Bacteria 8407
81 Ga0068862_100162400 3300005844 Bacteria 1995
82 Ga0068862_100226378 3300005844 Bacteria 1695
83 Ga0081539_10009763 3300005985 Bacteria 7938
84 Ga0075365_10050682 3300006038 Bacteria 2739
85 Ga0075362_10000114 3300006177 Bacteria 22522
86 Ga0075367_10027505 3300006178 Bacteria 3236
87 Ga0075369_10050109 3300006186 Bacteria 1805
88 Ga0075366_10001187 3300006195 Bacteria 12916
89 Ga0075370_10000048 3300006353 Bacteria 36696
90 Ga0075370_10009796 3300006353 Bacteria 4992
91 Ga0075370_10021752 3300006353 Bacteria 3515
92 Ga0075370_10143217 3300006353 Bacteria 1398
93 Ga0068871_100013858 3300006358 Bacteria 5995
94 Ga0075434_100653296 3300006871 Bacteria 1070
95 Ga0079104_1018999 3300006946 Bacteria 1933
96 Ga0079104_1044280 3300006946 Bacteria 1021
97 Ga0105251_10002813 3300009011 Bacteria 13190
98 Ga0105240_10026265 3300009093 Bacteria 7639
99 Ga0105245_10000620 3300009098 Bacteria 32174
100 Ga0105245_10201933 3300009098 Bacteria 1909
101 Ga0105243_10000608 3300009148 Bacteria 35675
102 Ga0105248_10023803 3300009177 Bacteria 6807
103 Ga0105248_10315058 3300009177 Bacteria 1762
104 Ga0105239_10499405 3300010375 Bacteria 1383
105 Ga0105246_10000234 3300011119 Bacteria 28511
106 Ga0105246_10113819 3300011119 Bacteria 1992
107 Ga0157373_10011000 3300013100 Bacteria 6664
108 Ga0157373_10107772 3300013100 Bacteria 1959
109 Ga0157371_10025046 3300013102 Bacteria 4354
110 Ga0157369_10065312 3300013105 Bacteria 3916
111 Ga0163162_10034757 3300013306 Bacteria 5018
112 Ga0163162_10086668 3300013306 Bacteria 3209
113 Ga0157372_10242475 3300013307 Bacteria 2091
114 Ga0157372_10276280 3300013307 Bacteria 1953
115 Ga0157372_10843491 3300013307 Bacteria 1064
116 Ga0157380_10224559 3300014326 Bacteria 1683
117 Ga0157379_10341355 3300014968 Bacteria 1370
118 Ga0157376_10126805 3300014969 Bacteria 2271
119 Ga0183363_1002 3300015690 Bacteria 425040
120 Ga0163161_10002632 3300017792 Bacteria 12772
121 Ga0213873_10000020 3300021358 Bacteria 119758
122 Ga0213876_10000004 3300021384 Bacteria 943822
123 Ga0213876_10000873 3300021384 Bacteria 20190
124 Ga0207425_1000005 3300025245 Bacteria 900502
125 Ga0209026_1011372 3300025250 Bacteria 1607
126 Ga0209677_104262 3300025253 Bacteria 4213
127 Ga0209148_1000008 3300025254 Bacteria 1504371
128 Ga0209129_1001165 3300025258 Bacteria 15153
129 Ga0209233_1000164 3300025261 Bacteria 152430
130 Ga0209565_1034761 3300025263 Bacteria 965
131 Ga0209455_1000002 3300025272 Bacteria 1505459
132 Ga0209455_1002787 3300025272 Bacteria 6523
133 Ga0209676_1000146 3300025292 Bacteria 174095
134 Ga0209676_1000932 3300025292 Bacteria 35988
135 Ga0209676_1002451 3300025292 Bacteria 13155
136 Ga0209676_1003697 3300025292 Bacteria 9143
137 Ga0209025_1000873 3300025294 Bacteria 47373
138 Ga0209025_1014281 3300025294 Bacteria 4903
139 Ga0209758_1000002 3300025297 Bacteria 1400310
140 Ga0209050_1000001 3300025298 Bacteria 3563507
141 Ga0209050_1000068 3300025298 Bacteria 298849
142 Ga0209050_1000166 3300025298 Bacteria 152073
143 Ga0209050_1000262 3300025298 Bacteria 112798
144 Ga0209050_1000801 3300025298 Bacteria 44325
145 Ga0209050_1008186 3300025298 Bacteria 5654
146 Ga0209050_1011178 3300025298 Bacteria 4298
147 Ga0209051_1000364 3300025303 Bacteria 66340
148 Ga0209257_1000132 3300025304 Bacteria 210870
149 Ga0209257_1000277 3300025304 Bacteria 114825
150 Ga0209257_1000543 3300025304 Bacteria 64840
151 Ga0209257_1000558 3300025304 Bacteria 63862
152 Ga0209257_1003410 3300025304 Bacteria 13681
153 Ga0207656_10131541 3300025321 Bacteria 1173
154 Ga0207713_1015342 3300025735 Bacteria 3938
155 Ga0207682_10003572 3300025893 Bacteria 6723
156 Ga0207647_10002267 3300025904 Bacteria 14654
157 Ga0207705_10000002 3300025909 Bacteria 2046852
158 Ga0207705_10000199 3300025909 Bacteria 60726
159 Ga0207695_10020167 3300025913 Bacteria 7643
160 Ga0207660_10000048 3300025917 Bacteria 60104
161 Ga0207660_10195628 3300025917 Bacteria 1577
162 Ga0207657_10000082 3300025919 Bacteria 89667
163 Ga0207657_10013847 3300025919 Bacteria 7892
164 Ga0207657_10086940 3300025919 Bacteria 2616
165 Ga0207657_10107090 3300025919 Bacteria 2313
166 Ga0207657_10252478 3300025919 Bacteria 1405
167 Ga0207649_10000018 3300025920 Bacteria 225137
168 Ga0207649_10053873 3300025920 Bacteria 2502
169 Ga0207649_10331786 3300025920 Bacteria 1121
170 Ga0207652_10000001 3300025921 Bacteria 1006643
171 Ga0207681_10000548 3300025923 Bacteria 25915
172 Ga0207681_10024245 3300025923 Bacteria 3892
173 Ga0207659_10011365 3300025926 Bacteria 5622
174 Ga0207659_10587436 3300025926 Bacteria 949
175 Ga0207687_10011495 3300025927 Bacteria 5786
176 Ga0207687_10047137 3300025927 Bacteria 2986
177 Ga0207687_10059802 3300025927 Bacteria 2686
178 Ga0207644_10000048 3300025931 Bacteria 102494
179 Ga0207644_10006047 3300025931 Bacteria 7892
180 Ga0207644_10042158 3300025931 Bacteria 3233
181 Ga0207690_10000001 3300025932 Bacteria 807539
182 Ga0207690_10000002 3300025932 Bacteria 807473
183 Ga0207690_10000003 3300025932 Bacteria 783011
184 Ga0207690_10000004 3300025932 Bacteria 746138
185 Ga0207690_10004719 3300025932 Bacteria 8048
186 Ga0207690_10021856 3300025932 Bacteria 3973
187 Ga0207690_10025056 3300025932 Bacteria 3742
188 Ga0207706_10162949 3300025933 Bacteria 1960
189 Ga0207709_10000109 3300025935 Bacteria 128086
190 Ga0207691_10107544 3300025940 Bacteria 2483
191 Ga0207711_10117337 3300025941 Bacteria 2373
192 Ga0207711_10218758 3300025941 Bacteria 1741
193 Ga0207711_10352369 3300025941 Bacteria 1363
194 Ga0207711_10580073 3300025941 Bacteria 1046
195 Ga0207667_10012325 3300025949 Bacteria 9861
196 Ga0207667_10021844 3300025949 Bacteria 7083
197 Ga0207667_10049930 3300025949 Bacteria 4415
198 Ga0207640_10000687 3300025981 Bacteria 19687
199 Ga0207640_10259444 3300025981 Bacteria 1353
200 Ga0207658_10002373 3300025986 Bacteria 13816
201 Ga0207658_10266893 3300025986 Bacteria 1461
202 Ga0207677_10000014 3300026023 Bacteria 181712
203 Ga0207703_10000142 3300026035 Bacteria 84567
204 Ga0207703_10001073 3300026035 Bacteria 26059
205 Ga0207703_10257498 3300026035 Bacteria 1576
206 Ga0207639_10357918 3300026041 Bacteria 1305
207 Ga0207639_10907730 3300026041 Bacteria 823
208 Ga0207678_10017196 3300026067 Bacteria 6348
209 Ga0207702_10022540 3300026078 Bacteria 5221
210 Ga0207641_10005328 3300026088 Bacteria 10985
211 Ga0207641_10008148 3300026088 Bacteria 8674
212 Ga0207641_10059060 3300026088 Bacteria 3265
213 Ga0207648_10080123 3300026089 Bacteria 2849
214 Ga0207676_10014157 3300026095 Bacteria 5730
215 Ga0207676_10348844 3300026095 Bacteria 1368
216 Ga0207674_10428209 3300026116 Bacteria 1279
217 Ga0207675_100439503 3300026118 Bacteria 1291
218 Ga0207675_100567968 3300026118 Bacteria 1135
219 Ga0207683_10000370 3300026121 Bacteria 41260
220 Ga0207698_10149464 3300026142 Bacteria 2025
221 Ga0207698_10369794 3300026142 Bacteria 1360
222 Ga0209281_1007606 3300027111 Bacteria 2707
223 Ga0209813_10000082 3300027866 Bacteria 34870
224 Ga0209974_10079126 3300027876 Bacteria 1129
225 Ga0207428_10025038 3300027907 Bacteria 5000
226 Ga0268266_10000187 3300028379 Bacteria 110229
227 Ga0268266_10000202 3300028379 Bacteria 104100
228 Ga0268266_10070950 3300028379 Bacteria 3019
229 Ga0268266_10499298 3300028379 Bacteria 1161
230 Ga0268265_10026432 3300028380 Bacteria 4130
231 Ga0268265_10223888 3300028380 Bacteria 1648
232 Ga0268264_10001653 3300028381 Bacteria 20594
233 Ga0268264_10142843 3300028381 Bacteria 2137
234 Ga0268264_10146976 3300028381 Bacteria 2109
235 Ga0268264_10158970 3300028381 Bacteria 2033
236 Ga0307517_10088208 3300028786 Bacteria 2566
237 Ga0307517_10186930 3300028786 Bacteria 1324
238 Ga0316183_1072845 3300030742 Bacteria 1038
239 Ga0265327_10165478 3300031251 Bacteria 1019
240 Ga0307508_10001142 3300031616 Bacteria 30562
241 Ga0307508_10015523 3300031616 Bacteria 6939
242 Ga0307405_10021615 3300031731 Bacteria 3620
243 Ga0307405_10167201 3300031731 Bacteria 1564
244 Ga0307405_10291756 3300031731 Bacteria 1233
245 Ga0307413_10261462 3300031824 Bacteria 1290
246 Ga0307410_10101220 3300031852 Bacteria 2065
247 Ga0307410_10450764 3300031852 Bacteria 1049
248 Ga0307410_10491625 3300031852 Bacteria 1008
249 Ga0307406_10046301 3300031901 Bacteria 2736
250 Ga0307406_10064732 3300031901 Bacteria 2374
251 Ga0307412_10006204 3300031911 Bacteria 6743
252 Ga0307412_10049031 3300031911 Bacteria 2781
253 Ga0307412_10652064 3300031911 Bacteria 898
254 Ga0307412_10688384 3300031911 Bacteria 876
255 Ga0307409_100113784 3300031995 Bacteria 2275
256 Ga0307409_100289949 3300031995 Bacteria 1517
257 Ga0307414_10001413 3300032004 Bacteria 12451
258 Ga0307414_10009325 3300032004 Bacteria 5631
259 Ga0307414_10040242 3300032004 Bacteria 3155
260 Ga0307414_10353842 3300032004 Bacteria 1261
261 Ga0307411_10174958 3300032005 Bacteria 1623
262 Ga0307411_10380700 3300032005 Bacteria 1160
263 Ga0307415_100307957 3300032126 Bacteria 1315
264 Ga0307415_100704086 3300032126 Bacteria 912
265 Ga0316582_0002330 3300036647 Bacteria 8885
266 Ga0395899_0018049 3300037312 Bacteria 5370
267 Ga0395900_0230352 3300037418 Bacteria 1863
268 Ga0395905_0227006 3300037471 Bacteria 1746
269 Ga0395901_0067984 3300038443 Bacteria 3712
270 Ga0395901_0246156 3300038443 Bacteria 1863
271 Ga0395901_0603589 3300038443 Bacteria 1106
272 Ga0237819_00485 3300038705 Bacteria 13485
273 Ga0436365_0143339 3300039437 Bacteria 2454
274 Ga0436365_1205090 3300039437 Bacteria 128002
275 Ga0436365_1460153 3300039437 Bacteria 77405
276 Ga0436365_1576765 3300039437 Bacteria 1187
277 Ga0436363_1522628 3300039450 Bacteria 807
278 Ga0436362_0634959 3300039453 Bacteria 65311
279 Ga0451845_0945670 3300041501 Bacteria 1071
280 Ga0466963_0226784 3300044694 Bacteria 1309
281 Ga0466967_0010022 3300045976 Bacteria 7077
282 Ga0466967_0122315 3300045976 Bacteria 2407
283 Ga0495638_0000266 3300046460 Bacteria 70490
284 Ga0495650_0085771 3300046471 Bacteria 1206
285 Ga0495596_0000008 3300046500 Bacteria 150860
286 Ga0495596_0003991 3300046500 Bacteria 7280
287 Ga0495607_0035293 3300046501 Bacteria 3026
288 Ga0495607_0066270 3300046501 Bacteria 2033
289 Ga0495583_0031150 3300046506 Bacteria 2589
290 Ga0495606_0013497 3300046507 Bacteria 6445
291 Ga0495610_0000756 3300046512 Bacteria 30516
292 Ga0495610_0001391 3300046512 Bacteria 21493
293 Ga0495616_0000014 3300046513 Bacteria 191010
294 Ga0495643_0000048 3300046522 Bacteria 212788
295 Ga0495643_0002195 3300046522 Bacteria 15959
296 Ga0495643_0011640 3300046522 Bacteria 5346
297 Ga0495643_0016169 3300046522 Bacteria 4389
298 Ga0495643_0110995 3300046522 Bacteria 1394
299 Ga0495654_0106357 3300046530 Bacteria 1285
300 Ga0495609_0008753 3300046538 Bacteria 4930
301 Ga0495622_0060804 3300046557 Bacteria 1750
302 Ga0495668_0000015 3300046616 Bacteria 441932
303 Ga0495668_0003158 3300046616 Bacteria 12700
304 Ga0495625_0000190 3300046660 Bacteria 97529
305 Ga0495625_0000758 3300046660 Bacteria 45114
306 Ga0495625_0005849 3300046660 Bacteria 11088
307 Ga0495625_0049459 3300046660 Bacteria 3022
308 Ga0495671_0041439 3300046692 Bacteria 2318
309 Ga0495671_0047214 3300046692 Bacteria 2152
310 Ga0495681_0069523 3300047470 Bacteria 1599
311 Ga0495686_0024587 3300047472 Bacteria 3955
312 Ga0495686_0255019 3300047472 Bacteria 984
313 Ga0495615_0000287 3300048090 Bacteria 9004
314 Ga0495626_0001105 3300048091 Bacteria 22816
315 Ga0496100_0023408 3300048903 Bacteria 3752
316 Ga0496101_0036603 3300048904 Bacteria 3476
317 Ga0496101_0142133 3300048904 Bacteria 1830
318 Ga0496106_0004775 3300048909 Bacteria 10020
319 Ga0496110_0180356 3300048913 Bacteria 1917
320 Ga0496113_0000547 3300048916 Bacteria 18610
321 Ga0496113_0622423 3300048916 Bacteria 864
322 Ga0496114_0041639 3300048917 Bacteria 3807
323 Ga0496115_0001624 3300048918 Bacteria 16183
324 Ga0496116_0000062 3300048919 Bacteria 271104
325 Ga0496116_0030542 3300048919 Bacteria 3868
326 Ga0496117_0039456 3300048920 Bacteria 3485
327 Ga0496118_0090628 3300048921 Bacteria 2106
328 Ga0496120_0074877 3300048923 Bacteria 1849
329 Ga0496121_0000087 3300048924 Bacteria 222451
330 Ga0496121_0002997 3300048924 Bacteria 24524
331 Ga0496121_0003483 3300048924 Bacteria 22408
332 Ga0496121_0015523 3300048924 Bacteria 7969
333 Ga0496122_0004355 3300048925 Bacteria 17692
334 Ga0496122_0010703 3300048925 Bacteria 9417
335 Ga0496122_0044776 3300048925 Bacteria 3449
336 Ga0496123_0007023 3300048926 Bacteria 10734
337 Ga0496123_0042501 3300048926 Bacteria 3135
338 Ga0496124_0006636 3300048927 Bacteria 12556
339 Ga0496124_0066775 3300048927 Bacteria 2994
340 Ga0496124_0216397 3300048927 Bacteria 1445
341 Ga0496124_0322103 3300048927 Bacteria 1106
342 Ga0496125_0024095 3300048928 Bacteria 5604
343 Ga0496125_0068113 3300048928 Bacteria 2801
344 Ga0496125_0190151 3300048928 Bacteria 1356
345 Ga0496126_0002737 3300048929 Bacteria 23297
346 Ga0496126_0040893 3300048929 Bacteria 4295
347 Ga0496126_0187694 3300048929 Bacteria 1752
348 Ga0496126_0223333 3300048929 Bacteria 1581
349 Ga0496126_0409728 3300048929 Bacteria 1098
350 Ga0496126_0497681 3300048929 Bacteria 974
351 Ga0501032_0373255 3300049569 Bacteria 917
352 Ga0501033_0359769 3300049570 Bacteria 1018
353 Ga0501033_0538039 3300049570 Bacteria 805
354 Ga0501034_0077707 3300049571 Bacteria 3324
355 Ga0501034_0277453 3300049571 Bacteria 1616
356 Ga0501036_0018010 3300049572 Bacteria 5913
357 Ga0501036_0236885 3300049572 Bacteria 1531
358 Ga0501038_0238239 3300049574 Bacteria 1445
359 Ga0501039_0265357 3300049575 Bacteria 1349
360 Ga0501047_0241322 3300049581 Bacteria 1658
361 Ga0501047_0333703 3300049581 Bacteria 1355
362 Ga0501048_0125333 3300049582 Bacteria 1816
363 Ga0501070_0456321 3300049586 Bacteria 1030
364 Ga0501249_029399 3300049679 Bacteria 1222
365 Ga0501080_0661359 3300049742 Bacteria 924
366 Ga0501035_0061689 3300049822 Bacteria 3336
367 Ga0501035_0296093 3300049822 Bacteria 1364
368 Ga0501044_0000290 3300049823 Bacteria 63934
369 Ga0501044_0098786 3300049823 Bacteria 2938
370 Ga0501044_0109306 3300049823 Bacteria 2774
371 Ga0501045_0270159 3300049824 Bacteria 1266
372 nmdc:mga03683_17_c1 3300050489 Bacteria 91111
373 nmdc:mga03683_18072_c1 3300050489 Bacteria 2676
374 nmdc:mga03683_46471_c1 3300050489 Bacteria 1800
375 nmdc:mga03n38_14062_c1 3300050490 Bacteria 3060
376 nmdc:mga03n38_973_c1 3300050490 Bacteria 7791
377 nmdc:mga00v17_33508_c1 3300050491 Bacteria 3044
378 nmdc:mga00v17_86069_c1 3300050491 Bacteria 1969
379 nmdc:mga0yw44_20344_c1 3300050492 Bacteria 3682
380 nmdc:mga0k408_123047_c1 3300050493 Bacteria 1537
381 nmdc:mga0k408_12_c1 3300050493 Bacteria 125427
382 nmdc:mga0k408_140869_c1 3300050493 Bacteria 1435
383 nmdc:mga0k408_165389_c1 3300050493 Bacteria 1318
384 nmdc:mga0k408_30592_c1 3300050493 Bacteria 3070
385 nmdc:mga0k408_48764_c1 3300050493 Bacteria 2450
386 nmdc:mga06z11_139_c1 3300050494 Bacteria 28685
387 nmdc:mga04h51_4570_c1 3300050495 Bacteria 3458
388 nmdc:mga07m45_11_c1 3300050496 Bacteria 163532
389 nmdc:mga07m45_125740_c1 3300050496 Bacteria 1482
390 nmdc:mga07m45_13393_c1 3300050496 Bacteria 4351
391 nmdc:mga07m45_1849_c1 3300050496 Bacteria 9777
392 nmdc:mga07m45_21384_c1 3300050496 Bacteria 3522
393 nmdc:mga07m45_29_c1 3300050496 Bacteria 85597
394 nmdc:mga07m45_300309_c1 3300050496 Bacteria 934
395 nmdc:mga0n895_223385_c1 3300050512 Bacteria 1912
396 nmdc:mga0sz30_41_c1 3300050516 Bacteria 46173
397 nmdc:mga0sz30_53981_c1 3300050516 Bacteria 1708
398 Ga0500643_000172 3300053087 Bacteria 63436
399 Ga0500643_001235 3300053087 Bacteria 15202
400 Ga0500643_026695 3300053087 Bacteria 1804
401 Ga0500643_038249 3300053087 Bacteria 1424
402 Ga0500583_0141851 3300053092 Bacteria 1194
403 Ga0500651_0324250 3300053093 Bacteria 879
404 Ga0500562_055700 3300053108 Bacteria 1060
405 Ga0500592_000399 3300053116 Bacteria 7280
406 Ga0500592_017377 3300053116 Bacteria 1155
407 Ga0500595_001189 3300053119 Bacteria 14368
408 Ga0500607_000077 3300053121 Bacteria 71543
409 Ga0500607_000763 3300053121 Bacteria 30989
410 Ga0500618_032342 3300053125 Bacteria 1224
411 Ga0500618_072212 3300053125 Bacteria 774
412 Ga0500658_0020549 3300053134 Bacteria 2494
413 Ga0500559_0001165 3300053136 Bacteria 15792
414 Ga0500559_0002676 3300053136 Bacteria 9068
415 Ga0500559_0013219 3300053136 Bacteria 3497
416 Ga0500559_0070962 3300053136 Bacteria 1568
417 Ga0500564_000368 3300053138 Bacteria 12800
418 Ga0500568_0008170 3300053139 Bacteria 5072
419 Ga0500573_0000093 3300053140 Bacteria 40260
420 Ga0500573_0032011 3300053140 Bacteria 3035
421 Ga0500604_0001111 3300053151 Bacteria 7474
422 Ga0500616_0001475 3300053153 Bacteria 22359
423 Ga0500622_0000119 3300053156 Bacteria 82219
424 Ga0500624_000095 3300053157 Bacteria 43267
425 Ga0500627_0000008 3300053158 Bacteria 161914
426 Ga0500627_0055651 3300053158 Bacteria 1732
427 Ga0500627_0078518 3300053158 Bacteria 1469
428 Ga0500636_0002978 3300053177 Bacteria 9481
429 Ga0500636_0221055 3300053177 Bacteria 987
430 Ga0500637_0020334 3300053178 Bacteria 3593
431 Ga0500567_000013 3300053723 Bacteria 38792
432 Ga0500625_000026 3300053729 Bacteria 60801
433 Ga0500645_004034 3300053730 Bacteria 5764
434 Ga0500645_049115 3300053730 Bacteria 1234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100704086 Ga0307415_1007040862 193
2 3300049679 Ga0501249_029399 Ga0501249_029399_258_878 194
3 3300038443 Ga0395901_0603589 Ga0395901_0603589_10_741 207
4 3300030742 Ga0316183_1072845 Ga0316183_10728452 210
5 3300049572 Ga0501036_0236885 Ga0501036_0236885_291_923 210
6 3300005329 Ga0070683_101158336 Ga0070683_1011583361 211
7 3300026118 Ga0207675_100567968 Ga0207675_1005679682 212
8 3300031911 Ga0307412_10652064 Ga0307412_106520641 212
9 3300036647 Ga0316582_0002330 Ga0316582_0002330_5236_5877 212
10 3300048928 Ga0496125_0024095 Ga0496125_0024095_2467_3120 212
11 3300053087 Ga0500643_001235 Ga0500643_001235_9569_10222 212
12 3300053125 Ga0500618_032342 Ga0500618_032342_362_1015 212
13 3300053157 Ga0500624_000095 Ga0500624_000095_13848_14501 212
14 3300053177 Ga0500636_0002978 Ga0500636_0002978_2250_2903 212
15 3300053177 Ga0500636_0221055 Ga0500636_0221055_195_848 212
16 iso_pu_bacteria 2919138771 2919142120 212
17 3300005331 Ga0070670_100142632 Ga0070670_1001426322 213
18 3300005355 Ga0070671_100096034 Ga0070671_1000960343 213
19 3300005367 Ga0070667_100000626 Ga0070667_10000062614 213
20 3300005539 Ga0068853_100067089 Ga0068853_1000670892 213
21 3300005544 Ga0070686_100000511 Ga0070686_1000005113 213
22 3300005841 Ga0068863_100034439 Ga0068863_1000344392 213
23 3300005841 Ga0068863_100099081 Ga0068863_1000990814 213
24 3300005843 Ga0068860_100182377 Ga0068860_1001823772 213
25 3300005844 Ga0068862_100162400 Ga0068862_1001624002 213
26 3300025931 Ga0207644_10042158 Ga0207644_100421583 213
27 3300026041 Ga0207639_10357918 Ga0207639_103579182 213
28 3300026088 Ga0207641_10008148 Ga0207641_100081488 213
29 3300026088 Ga0207641_10059060 Ga0207641_100590603 213
30 3300026095 Ga0207676_10014157 Ga0207676_100141576 213
31 3300028380 Ga0268265_10223888 Ga0268265_102238882 213
32 3300028381 Ga0268264_10146976 Ga0268264_101469762 213
33 3300031901 Ga0307406_10046301 Ga0307406_100463012 213
34 3300031911 Ga0307412_10049031 Ga0307412_100490315 213
35 3300038443 Ga0395901_0067984 Ga0395901_0067984_678_1319 213
36 iso_pu_bacteria 2510917021 2511126444 213
37 iso_pu_bacteria 2643221563 2643834649 213
38 iso_pu_bacteria 2643221608 2644055576 213
39 iso_pu_bacteria 2739367664 2739651148 213
40 iso_pu_bacteria 2739367865 2740029621 213
41 iso_pu_bacteria 2818991438 2819554701 213
42 iso_pu_bacteria 2885429604 2885431959 213
43 iso_pu_bacteria 8054302542 8054305081 213
44 3300002075 JGI24738J21930_10051444 JGI24738J21930_100514442 214
45 3300005336 Ga0070680_100249429 Ga0070680_1002494293 214
46 3300005366 Ga0070659_100031472 Ga0070659_1000314722 214
47 3300005456 Ga0070678_100664459 Ga0070678_1006644591 214
48 3300005457 Ga0070662_100152259 Ga0070662_1001522591 214
49 3300005458 Ga0070681_10145461 Ga0070681_101454613 214
50 3300005563 Ga0068855_100070850 Ga0068855_1000708504 214
51 3300011119 Ga0105246_10000234 Ga0105246_100002347 214
52 3300013100 Ga0157373_10011000 Ga0157373_100110003 214
53 3300025917 Ga0207660_10195628 Ga0207660_101956282 214
54 3300025919 Ga0207657_10252478 Ga0207657_102524782 214
55 3300025920 Ga0207649_10331786 Ga0207649_103317862 214
56 3300025932 Ga0207690_10021856 Ga0207690_100218563 214
57 3300025933 Ga0207706_10162949 Ga0207706_101629492 214
58 3300025949 Ga0207667_10021844 Ga0207667_100218447 214
59 3300026041 Ga0207639_10907730 Ga0207639_109077301 214
60 3300026067 Ga0207678_10017196 Ga0207678_100171964 214
61 3300031616 Ga0307508_10001142 Ga0307508_100011424 214
62 3300046513 Ga0495616_0000014 Ga0495616_0000014_102444_103088 214
63 3300046616 Ga0495668_0003158 Ga0495668_0003158_5107_5751 214
64 3300048924 Ga0496121_0000087 Ga0496121_0000087_337_981 214
65 3300049586 Ga0501070_0456321 Ga0501070_0456321_134_778 214
66 3300053125 Ga0500618_072212 Ga0500618_072212_45_689 214
67 3300053151 Ga0500604_0001111 Ga0500604_0001111_5546_6190 214
68 3300053158 Ga0500627_0055651 Ga0500627_0055651_542_1186 214
69 iso_pu_bacteria 2643221560 2643820331 214
70 iso_pu_bacteria 2852653556 2852656201 214
71 iso_pu_bacteria 2852680915 2852683220 214
72 iso_pu_bacteria 3000865235 3000867039 214
73 iso_pu_bacteria 8057101203 8057104980 214
74 3300005289 Ga0065704_10011948 Ga0065704_100119482 215
75 3300005339 Ga0070660_100106201 Ga0070660_1001062012 215
76 3300005366 Ga0070659_100000004 Ga0070659_100000004159 215
77 3300005548 Ga0070665_100000070 Ga0070665_100000070105 215
78 3300005548 Ga0070665_100000495 Ga0070665_10000049526 215
79 3300005841 Ga0068863_100045936 Ga0068863_1000459365 215
80 3300006871 Ga0075434_100653296 Ga0075434_1006532963 215
81 3300009098 Ga0105245_10201933 Ga0105245_102019332 215
82 3300013307 Ga0157372_10843491 Ga0157372_108434912 215
83 3300017792 Ga0163161_10002632 Ga0163161_100026327 215
84 3300025919 Ga0207657_10107090 Ga0207657_101070902 215
85 3300025926 Ga0207659_10011365 Ga0207659_100113654 215
86 3300025927 Ga0207687_10047137 Ga0207687_100471375 215
87 3300025927 Ga0207687_10059802 Ga0207687_100598023 215
88 3300025932 Ga0207690_10000001 Ga0207690_10000001426 215
89 3300025932 Ga0207690_10000002 Ga0207690_10000002426 215
90 3300025932 Ga0207690_10000003 Ga0207690_10000003426 215
91 3300025932 Ga0207690_10000004 Ga0207690_10000004426 215
92 3300026023 Ga0207677_10000014 Ga0207677_10000014151 215
93 3300026088 Ga0207641_10005328 Ga0207641_100053289 215
94 3300026142 Ga0207698_10369794 Ga0207698_103697941 215
95 3300027876 Ga0209974_10079126 Ga0209974_100791262 215
96 3300028379 Ga0268266_10000187 Ga0268266_1000018785 215
97 3300028379 Ga0268266_10000202 Ga0268266_1000020280 215
98 3300031901 Ga0307406_10064732 Ga0307406_100647323 215
99 3300038705 Ga0237819_00485 Ga0237819_00485_11406_12059 215
100 3300039437 Ga0436365_0143339 Ga0436365_0143339_1700_2347 215
101 3300039450 Ga0436363_1522628 Ga0436363_1522628_22_669 215
102 3300048924 Ga0496121_0002997 Ga0496121_0002997_1615_2277 215
103 3300048928 Ga0496125_0190151 Ga0496125_0190151_509_1159 215
104 3300048929 Ga0496126_0187694 Ga0496126_0187694_853_1503 215
105 3300048929 Ga0496126_0497681 Ga0496126_0497681_167_817 215
106 3300049581 Ga0501047_0241322 Ga0501047_0241322_638_1285 215
107 3300050512 nmdc:mga0n895_223385_c1 nmdc:mga0n895_223385_c1_698_1345 215
108 3300046460 Ga0495638_0000266 Ga0495638_0000266_44551_45213 216
109 3300046660 Ga0495625_0000758 Ga0495625_0000758_27396_28058 216
110 3300046660 Ga0495625_0049459 Ga0495625_0049459_321_980 216
111 3300053119 Ga0500595_001189 Ga0500595_001189_13474_14124 216
112 3300053134 Ga0500658_0020549 Ga0500658_0020549_1488_2147 216
113 3300002774 JGI25150J39212_1000333 JGI25150J39212_100033312 217
114 3300003187 JGI25151J46595_10006895 JGI25151J46595_100068955 217
115 3300003214 JGI25165J46597_1000104 JGI25165J46597_100010499 217
116 3300003215 JGI25153J46596_10000055 JGI25153J46596_1000005572 217
117 3300003762 Ga0055542_1000041 Ga0055542_10000419 217
118 3300003763 Ga0055529_1000040 Ga0055529_100004034 217
119 3300003791 Ga0055530_10000355 Ga0055530_1000035541 217
120 3300003792 Ga0055540_1000238 Ga0055540_100023842 217
121 3300005347 Ga0070668_100049723 Ga0070668_1000497233 217
122 3300005353 Ga0070669_100016649 Ga0070669_1000166493 217
123 3300005355 Ga0070671_100004793 Ga0070671_1000047938 217
124 3300005367 Ga0070667_100056826 Ga0070667_1000568264 217
125 3300005456 Ga0070678_100000077 Ga0070678_10000007730 217
126 3300005539 Ga0068853_100499749 Ga0068853_1004997492 217
127 3300005543 Ga0070672_100044540 Ga0070672_1000445403 217
128 3300005548 Ga0070665_100063332 Ga0070665_1000633323 217
129 3300005563 Ga0068855_100003516 Ga0068855_10000351617 217
130 3300005616 Ga0068852_100221662 Ga0068852_1002216622 217
131 3300005842 Ga0068858_100000626 Ga0068858_1000006266 217
132 3300005842 Ga0068858_100002691 Ga0068858_1000026913 217
133 3300005843 Ga0068860_100023009 Ga0068860_1000230098 217
134 3300005844 Ga0068862_100008681 Ga0068862_1000086812 217
135 3300005844 Ga0068862_100226378 Ga0068862_1002263782 217
136 3300005985 Ga0081539_10009763 Ga0081539_1000976310 217
137 3300006038 Ga0075365_10050682 Ga0075365_100506823 217
138 3300006177 Ga0075362_10000114 Ga0075362_1000011422 217
139 3300006178 Ga0075367_10027505 Ga0075367_100275052 217
140 3300006186 Ga0075369_10050109 Ga0075369_100501092 217
141 3300006195 Ga0075366_10001187 Ga0075366_1000118713 217
142 3300006353 Ga0075370_10000048 Ga0075370_1000004841 217
143 3300006353 Ga0075370_10009796 Ga0075370_100097966 217
144 3300006353 Ga0075370_10143217 Ga0075370_101432172 217
145 3300006358 Ga0068871_100013858 Ga0068871_1000138588 217
146 3300006946 Ga0079104_1018999 Ga0079104_10189993 217
147 3300009011 Ga0105251_10002813 Ga0105251_1000281310 217
148 3300009098 Ga0105245_10000620 Ga0105245_1000062024 217
149 3300009148 Ga0105243_10000608 Ga0105243_1000060823 217
150 3300009177 Ga0105248_10023803 Ga0105248_100238032 217
151 3300010375 Ga0105239_10499405 Ga0105239_104994052 217
152 3300011119 Ga0105246_10113819 Ga0105246_101138192 217
153 3300013306 Ga0163162_10034757 Ga0163162_100347575 217
154 3300013306 Ga0163162_10086668 Ga0163162_100866683 217
155 3300014969 Ga0157376_10126805 Ga0157376_101268055 217
156 3300025245 Ga0207425_1000005 Ga0207425_1000005624 217
157 3300025253 Ga0209677_104262 Ga0209677_1042623 217
158 3300025254 Ga0209148_1000008 Ga0209148_1000008284 217
159 3300025258 Ga0209129_1001165 Ga0209129_100116511 217
160 3300025261 Ga0209233_1000164 Ga0209233_100016446 217
161 3300025272 Ga0209455_1000002 Ga0209455_10000021139 217
162 3300025292 Ga0209676_1002451 Ga0209676_100245113 217
163 3300025294 Ga0209025_1000873 Ga0209025_10008732 217
164 3300025297 Ga0209758_1000002 Ga0209758_1000002720 217
165 3300025298 Ga0209050_1000001 Ga0209050_1000001699 217
166 3300025298 Ga0209050_1000166 Ga0209050_1000166138 217
167 3300025298 Ga0209050_1000262 Ga0209050_100026263 217
168 3300025298 Ga0209050_1000801 Ga0209050_10008016 217
169 3300025303 Ga0209051_1000364 Ga0209051_100036444 217
170 3300025304 Ga0209257_1000543 Ga0209257_100054344 217
171 3300025304 Ga0209257_1000558 Ga0209257_100055841 217
172 3300025735 Ga0207713_1015342 Ga0207713_10153422 217
173 3300025919 Ga0207657_10086940 Ga0207657_100869403 217
174 3300025920 Ga0207649_10053873 Ga0207649_100538733 217
175 3300025923 Ga0207681_10000548 Ga0207681_1000054811 217
176 3300025927 Ga0207687_10011495 Ga0207687_100114955 217
177 3300025931 Ga0207644_10006047 Ga0207644_100060477 217
178 3300025935 Ga0207709_10000109 Ga0207709_1000010921 217
179 3300025940 Ga0207691_10107544 Ga0207691_101075443 217
180 3300025941 Ga0207711_10117337 Ga0207711_101173372 217
181 3300025941 Ga0207711_10218758 Ga0207711_102187582 217
182 3300025949 Ga0207667_10012325 Ga0207667_1001232512 217
183 3300025986 Ga0207658_10002373 Ga0207658_100023732 217
184 3300025986 Ga0207658_10266893 Ga0207658_102668932 217
185 3300026035 Ga0207703_10000142 Ga0207703_1000014223 217
186 3300026035 Ga0207703_10001073 Ga0207703_1000107313 217
187 3300026035 Ga0207703_10257498 Ga0207703_102574982 217
188 3300026089 Ga0207648_10080123 Ga0207648_100801233 217
189 3300026116 Ga0207674_10428209 Ga0207674_104282092 217
190 3300026121 Ga0207683_10000370 Ga0207683_1000037027 217
191 3300026142 Ga0207698_10149464 Ga0207698_101494643 217
192 3300027111 Ga0209281_1007606 Ga0209281_10076062 217
193 3300027866 Ga0209813_10000082 Ga0209813_1000008216 217
194 3300028379 Ga0268266_10070950 Ga0268266_100709502 217
195 3300028380 Ga0268265_10026432 Ga0268265_100264322 217
196 3300028381 Ga0268264_10001653 Ga0268264_100016538 217
197 3300028786 Ga0307517_10088208 Ga0307517_100882081 217
198 3300031251 Ga0265327_10165478 Ga0265327_101654782 217
199 3300031616 Ga0307508_10015523 Ga0307508_100155239 217
200 3300031731 Ga0307405_10021615 Ga0307405_100216154 217
201 3300031731 Ga0307405_10291756 Ga0307405_102917561 217
202 3300041501 Ga0451845_0945670 Ga0451845_0945670_202_855 217
203 3300046471 Ga0495650_0085771 Ga0495650_0085771_350_1006 217
204 3300046500 Ga0495596_0000008 Ga0495596_0000008_30678_31349 217
205 3300046501 Ga0495607_0066270 Ga0495607_0066270_435_1106 217
206 3300046506 Ga0495583_0031150 Ga0495583_0031150_963_1634 217
207 3300046512 Ga0495610_0000756 Ga0495610_0000756_27071_27730 217
208 3300046522 Ga0495643_0000048 Ga0495643_0000048_95815_96474 217
209 3300046522 Ga0495643_0002195 Ga0495643_0002195_4554_5225 217
210 3300046522 Ga0495643_0011640 Ga0495643_0011640_1153_1821 217
211 3300046530 Ga0495654_0106357 Ga0495654_0106357_402_1079 217
212 3300046538 Ga0495609_0008753 Ga0495609_0008753_597_1268 217
213 3300046660 Ga0495625_0005849 Ga0495625_0005849_8447_9118 217
214 3300046692 Ga0495671_0041439 Ga0495671_0041439_959_1612 217
215 3300046692 Ga0495671_0047214 Ga0495671_0047214_1119_1790 217
216 3300047470 Ga0495681_0069523 Ga0495681_0069523_156_827 217
217 3300048090 Ga0495615_0000287 Ga0495615_0000287_977_1636 217
218 3300048904 Ga0496101_0142133 Ga0496101_0142133_808_1464 217
219 3300048916 Ga0496113_0622423 Ga0496113_0622423_64_777 217
220 3300048917 Ga0496114_0041639 Ga0496114_0041639_909_1622 217
221 3300048919 Ga0496116_0000062 Ga0496116_0000062_200932_201588 217
222 3300048919 Ga0496116_0030542 Ga0496116_0030542_81_737 217
223 3300048920 Ga0496117_0039456 Ga0496117_0039456_2215_2871 217
224 3300048921 Ga0496118_0090628 Ga0496118_0090628_1221_1883 217
225 3300048923 Ga0496120_0074877 Ga0496120_0074877_1120_1776 217
226 3300048924 Ga0496121_0003483 Ga0496121_0003483_5074_5730 217
227 3300048924 Ga0496121_0015523 Ga0496121_0015523_1142_1798 217
228 3300048925 Ga0496122_0004355 Ga0496122_0004355_844_1500 217
229 3300048925 Ga0496122_0010703 Ga0496122_0010703_201_857 217
230 3300048925 Ga0496122_0044776 Ga0496122_0044776_880_1539 217
231 3300048926 Ga0496123_0007023 Ga0496123_0007023_6104_6760 217
232 3300048926 Ga0496123_0042501 Ga0496123_0042501_1589_2248 217
233 3300048927 Ga0496124_0006636 Ga0496124_0006636_5568_6224 217
234 3300048927 Ga0496124_0066775 Ga0496124_0066775_1125_1781 217
235 3300048927 Ga0496124_0216397 Ga0496124_0216397_273_986 217
236 3300048927 Ga0496124_0322103 Ga0496124_0322103_73_732 217
237 3300048928 Ga0496125_0068113 Ga0496125_0068113_960_1616 217
238 3300048929 Ga0496126_0002737 Ga0496126_0002737_17138_17794 217
239 3300048929 Ga0496126_0040893 Ga0496126_0040893_1874_2587 217
240 3300049742 Ga0501080_0661359 Ga0501080_0661359_21_686 217
241 3300049823 Ga0501044_0000290 Ga0501044_0000290_16025_16717 217
242 3300050489 nmdc:mga03683_17_c1 nmdc:mga03683_17_c1_23564_24247 217
243 3300050489 nmdc:mga03683_18072_c1 nmdc:mga03683_18072_c1_1307_2005 217
244 3300050489 nmdc:mga03683_46471_c1 nmdc:mga03683_46471_c1_204_869 217
245 3300050490 nmdc:mga03n38_14062_c1 nmdc:mga03n38_14062_c1_1160_1825 217
246 3300050490 nmdc:mga03n38_973_c1 nmdc:mga03n38_973_c1_24_707 217
247 3300050491 nmdc:mga00v17_33508_c1 nmdc:mga00v17_33508_c1_1144_1809 217
248 3300050491 nmdc:mga00v17_86069_c1 nmdc:mga00v17_86069_c1_1104_1772 217
249 3300050492 nmdc:mga0yw44_20344_c1 nmdc:mga0yw44_20344_c1_1242_1907 217
250 3300050493 nmdc:mga0k408_12_c1 nmdc:mga0k408_12_c1_66397_67080 217
251 3300050493 nmdc:mga0k408_140869_c1 nmdc:mga0k408_140869_c1_414_1079 217
252 3300050493 nmdc:mga0k408_165389_c1 nmdc:mga0k408_165389_c1_613_1296 217
253 3300050493 nmdc:mga0k408_30592_c1 nmdc:mga0k408_30592_c1_1432_2112 217
254 3300050493 nmdc:mga0k408_48764_c1 nmdc:mga0k408_48764_c1_1575_2252 217
255 3300050494 nmdc:mga06z11_139_c1 nmdc:mga06z11_139_c1_4425_5090 217
256 3300050495 nmdc:mga04h51_4570_c1 nmdc:mga04h51_4570_c1_2312_2977 217
257 3300050496 nmdc:mga07m45_11_c1 nmdc:mga07m45_11_c1_96485_97168 217
258 3300050496 nmdc:mga07m45_125740_c1 nmdc:mga07m45_125740_c1_337_1023 217
259 3300050496 nmdc:mga07m45_1849_c1 nmdc:mga07m45_1849_c1_1005_1694 217
260 3300050496 nmdc:mga07m45_21384_c1 nmdc:mga07m45_21384_c1_1590_2267 217
261 3300050496 nmdc:mga07m45_29_c1 nmdc:mga07m45_29_c1_4299_4964 217
262 3300050516 nmdc:mga0sz30_41_c1 nmdc:mga0sz30_41_c1_18590_19255 217
263 3300050516 nmdc:mga0sz30_53981_c1 nmdc:mga0sz30_53981_c1_536_1222 217
264 3300053087 Ga0500643_026695 Ga0500643_026695_279_953 217
265 3300053087 Ga0500643_038249 Ga0500643_038249_673_1350 217
266 3300053121 Ga0500607_000077 Ga0500607_000077_38507_39184 217
267 3300053121 Ga0500607_000763 Ga0500607_000763_10436_11095 217
268 3300053136 Ga0500559_0002676 Ga0500559_0002676_4581_5258 217
269 3300053136 Ga0500559_0070962 Ga0500559_0070962_611_1288 217
270 3300053138 Ga0500564_000368 Ga0500564_000368_8481_9158 217
271 3300053140 Ga0500573_0000093 Ga0500573_0000093_23869_24540 217
272 3300053140 Ga0500573_0032011 Ga0500573_0032011_393_1070 217
273 3300053156 Ga0500622_0000119 Ga0500622_0000119_39797_40474 217
274 3300053178 Ga0500637_0020334 Ga0500637_0020334_2248_2925 217
275 3300053723 Ga0500567_000013 Ga0500567_000013_24673_25350 217
276 3300053729 Ga0500625_000026 Ga0500625_000026_42740_43417 217
277 3300053730 Ga0500645_004034 Ga0500645_004034_3547_4224 217
278 3300053730 Ga0500645_049115 Ga0500645_049115_394_1059 217
279 3300003781 Ga0055536_1008174 Ga0055536_10081744 218
280 3300003791 Ga0055530_10001551 Ga0055530_100015512 218
281 3300003794 Ga0055531_10003290 Ga0055531_1000329011 218
282 3300003794 Ga0055531_10032165 Ga0055531_100321652 218
283 3300005262 Ga0065165_1002875 Ga0065165_10028752 218
284 3300005337 Ga0070682_100097180 Ga0070682_1000971802 218
285 3300005355 Ga0070671_100000208 Ga0070671_10000020836 218
286 3300005544 Ga0070686_100011481 Ga0070686_1000114814 218
287 3300005548 Ga0070665_100124606 Ga0070665_1001246063 218
288 3300005618 Ga0068864_100184877 Ga0068864_1001848772 218
289 3300006353 Ga0075370_10021752 Ga0075370_100217523 218
290 3300006946 Ga0079104_1044280 Ga0079104_10442802 218
291 3300009177 Ga0105248_10315058 Ga0105248_103150582 218
292 3300014968 Ga0157379_10341355 Ga0157379_103413552 218
293 3300015690 Ga0183363_1002 Ga0183363_100219 218
294 3300025263 Ga0209565_1034761 Ga0209565_10347612 218
295 3300025292 Ga0209676_1000146 Ga0209676_100014673 218
296 3300025292 Ga0209676_1000932 Ga0209676_100093219 218
297 3300025292 Ga0209676_1003697 Ga0209676_10036974 218
298 3300025294 Ga0209025_1014281 Ga0209025_10142813 218
299 3300025298 Ga0209050_1000068 Ga0209050_1000068268 218
300 3300025298 Ga0209050_1008186 Ga0209050_10081862 218
301 3300025298 Ga0209050_1011178 Ga0209050_10111784 218
302 3300025304 Ga0209257_1000132 Ga0209257_1000132205 218
303 3300025304 Ga0209257_1000277 Ga0209257_100027734 218
304 3300025304 Ga0209257_1003410 Ga0209257_10034102 218
305 3300025893 Ga0207682_10003572 Ga0207682_100035726 218
306 3300025923 Ga0207681_10024245 Ga0207681_100242454 218
307 3300025931 Ga0207644_10000048 Ga0207644_100000488 218
308 3300025941 Ga0207711_10352369 Ga0207711_103523693 218
309 3300025941 Ga0207711_10580073 Ga0207711_105800731 218
310 3300026095 Ga0207676_10348844 Ga0207676_103488442 218
311 3300027907 Ga0207428_10025038 Ga0207428_100250384 218
312 3300028379 Ga0268266_10499298 Ga0268266_104992982 218
313 3300028381 Ga0268264_10158970 Ga0268264_101589702 218
314 3300028786 Ga0307517_10186930 Ga0307517_101869302 218
315 3300031731 Ga0307405_10167201 Ga0307405_101672012 218
316 3300031852 Ga0307410_10450764 Ga0307410_104507641 218
317 3300031852 Ga0307410_10491625 Ga0307410_104916252 218
318 3300031911 Ga0307412_10006204 Ga0307412_100062044 218
319 3300031995 Ga0307409_100113784 Ga0307409_1001137842 218
320 3300032004 Ga0307414_10001413 Ga0307414_100014139 218
321 3300032004 Ga0307414_10009325 Ga0307414_100093252 218
322 3300032004 Ga0307414_10040242 Ga0307414_100402422 218
323 3300032004 Ga0307414_10353842 Ga0307414_103538421 218
324 3300032126 Ga0307415_100307957 Ga0307415_1003079571 218
325 3300039437 Ga0436365_1576765 Ga0436365_1576765_469_1140 218
326 3300045976 Ga0466967_0010022 Ga0466967_0010022_3145_3927 218
327 3300046500 Ga0495596_0003991 Ga0495596_0003991_6226_6885 218
328 3300046501 Ga0495607_0035293 Ga0495607_0035293_635_1324 218
329 3300046507 Ga0495606_0013497 Ga0495606_0013497_5205_5864 218
330 3300046512 Ga0495610_0001391 Ga0495610_0001391_1886_2545 218
331 3300046522 Ga0495643_0110995 Ga0495643_0110995_660_1319 218
332 3300046616 Ga0495668_0000015 Ga0495668_0000015_240671_241327 218
333 3300046660 Ga0495625_0000190 Ga0495625_0000190_73214_73873 218
334 3300047472 Ga0495686_0024587 Ga0495686_0024587_2864_3526 218
335 3300047472 Ga0495686_0255019 Ga0495686_0255019_274_942 218
336 3300048091 Ga0495626_0001105 Ga0495626_0001105_3955_4614 218
337 3300048903 Ga0496100_0023408 Ga0496100_0023408_1229_1951 218
338 3300048904 Ga0496101_0036603 Ga0496101_0036603_1256_1978 218
339 3300048909 Ga0496106_0004775 Ga0496106_0004775_6170_6892 218
340 3300048913 Ga0496110_0180356 Ga0496110_0180356_1005_1727 218
341 3300048916 Ga0496113_0000547 Ga0496113_0000547_13229_13951 218
342 3300048918 Ga0496115_0001624 Ga0496115_0001624_6021_6677 218
343 3300048929 Ga0496126_0223333 Ga0496126_0223333_660_1385 218
344 3300048929 Ga0496126_0409728 Ga0496126_0409728_193_852 218
345 3300049569 Ga0501032_0373255 Ga0501032_0373255_83_739 218
346 3300049570 Ga0501033_0359769 Ga0501033_0359769_136_792 218
347 3300049570 Ga0501033_0538039 Ga0501033_0538039_14_670 218
348 3300049571 Ga0501034_0077707 Ga0501034_0077707_275_931 218
349 3300049572 Ga0501036_0018010 Ga0501036_0018010_4890_5546 218
350 3300049574 Ga0501038_0238239 Ga0501038_0238239_644_1300 218
351 3300049575 Ga0501039_0265357 Ga0501039_0265357_498_1154 218
352 3300049581 Ga0501047_0333703 Ga0501047_0333703_560_1216 218
353 3300049582 Ga0501048_0125333 Ga0501048_0125333_51_707 218
354 3300049822 Ga0501035_0061689 Ga0501035_0061689_128_784 218
355 3300049822 Ga0501035_0296093 Ga0501035_0296093_151_807 218
356 3300049823 Ga0501044_0098786 Ga0501044_0098786_1145_1801 218
357 3300049824 Ga0501045_0270159 Ga0501045_0270159_16_672 218
358 3300050493 nmdc:mga0k408_123047_c1 nmdc:mga0k408_123047_c1_554_1276 218
359 3300050496 nmdc:mga07m45_13393_c1 nmdc:mga07m45_13393_c1_1537_2259 218
360 3300053087 Ga0500643_000172 Ga0500643_000172_11320_11985 218
361 3300053092 Ga0500583_0141851 Ga0500583_0141851_263_925 218
362 3300053093 Ga0500651_0324250 Ga0500651_0324250_12_671 218
363 3300053108 Ga0500562_055700 Ga0500562_055700_186_854 218
364 3300053116 Ga0500592_000399 Ga0500592_000399_3064_3720 218
365 3300053116 Ga0500592_017377 Ga0500592_017377_210_869 218
366 3300053136 Ga0500559_0013219 Ga0500559_0013219_170_835 218
367 3300053139 Ga0500568_0008170 Ga0500568_0008170_91_747 218
368 3300053158 Ga0500627_0000008 Ga0500627_0000008_17052_17708 218
369 3300053158 Ga0500627_0078518 Ga0500627_0078518_625_1281 218
370 iso_pu_bacteria 2848297114 2848298890 218
371 3300025250 Ga0209026_1011372 Ga0209026_10113723 219
372 3300025272 Ga0209455_1002787 Ga0209455_10027874 219
373 3300025981 Ga0207640_10259444 Ga0207640_102594442 219
374 3300031852 Ga0307410_10101220 Ga0307410_101012202 219
375 3300031995 Ga0307409_100289949 Ga0307409_1002899492 219
376 3300032005 Ga0307411_10174958 Ga0307411_101749583 219
377 3300037312 Ga0395899_0018049 Ga0395899_0018049_2238_3005 219
378 3300037418 Ga0395900_0230352 Ga0395900_0230352_230_997 219
379 3300037471 Ga0395905_0227006 Ga0395905_0227006_867_1634 219
380 3300038443 Ga0395901_0246156 Ga0395901_0246156_867_1634 219
381 3300046557 Ga0495622_0060804 Ga0495622_0060804_162_836 219
382 3300013307 Ga0157372_10276280 Ga0157372_102762802 220
383 3300031824 Ga0307413_10261462 Ga0307413_102614621 220
384 3300044694 Ga0466963_0226784 Ga0466963_0226784_458_1132 220
385 3300045976 Ga0466967_0122315 Ga0466967_0122315_1316_1990 220
386 3300049823 Ga0501044_0109306 Ga0501044_0109306_1553_2233 220
387 3300050496 nmdc:mga07m45_300309_c1 nmdc:mga07m45_300309_c1_169_855 220
388 3300053153 Ga0500616_0001475 Ga0500616_0001475_9889_10554 220
389 3300005289 Ga0065704_10112941 Ga0065704_101129412 221
390 3300005295 Ga0065707_10110114 Ga0065707_101101143 221
391 3300005366 Ga0070659_100003359 Ga0070659_10000335912 221
392 3300005843 Ga0068860_100048388 Ga0068860_1000483884 221
393 3300014326 Ga0157380_10224559 Ga0157380_102245592 221
394 3300025932 Ga0207690_10025056 Ga0207690_100250564 221
395 3300028381 Ga0268264_10142843 Ga0268264_101428433 221
396 2162886007 SwRhRL2b_contig_3207873 SwRhRL2b_0996.00002090 222
397 3300005289 Ga0065704_10003487 Ga0065704_100034875 222
398 3300005289 Ga0065704_10070205 Ga0065704_1007020566 222
399 3300005327 Ga0070658_10000001 Ga0070658_10000001393 222
400 3300005336 Ga0070680_100000295 Ga0070680_10000029528 222
401 3300005339 Ga0070660_100001519 Ga0070660_10000151914 222
402 3300005339 Ga0070660_100002789 Ga0070660_1000027898 222
403 3300005344 Ga0070661_100000001 Ga0070661_10000000142 222
404 3300005345 Ga0070692_10106977 Ga0070692_101069773 222
405 3300005353 Ga0070669_100234150 Ga0070669_1002341503 222
406 3300005354 Ga0070675_100482160 Ga0070675_1004821602 222
407 3300005366 Ga0070659_100001413 Ga0070659_1000014135 222
408 3300005445 Ga0070708_100355655 Ga0070708_1003556552 222
409 3300005458 Ga0070681_10010156 Ga0070681_100101569 222
410 3300005467 Ga0070706_100205369 Ga0070706_1002053692 222
411 3300005530 Ga0070679_100000017 Ga0070679_100000017101 222
412 3300005543 Ga0070672_100138060 Ga0070672_1001380604 222
413 3300005563 Ga0068855_100234873 Ga0068855_1002348733 222
414 3300005578 Ga0068854_100027029 Ga0068854_1000270294 222
415 3300005614 Ga0068856_100010183 Ga0068856_1000101834 222
416 3300005616 Ga0068852_100000232 Ga0068852_1000002325 222
417 3300005834 Ga0068851_10178138 Ga0068851_101781382 222
418 3300009093 Ga0105240_10026265 Ga0105240_100262657 222
419 3300013100 Ga0157373_10107772 Ga0157373_101077724 222
420 3300013102 Ga0157371_10025046 Ga0157371_100250465 222
421 3300013105 Ga0157369_10065312 Ga0157369_100653123 222
422 3300013307 Ga0157372_10242475 Ga0157372_102424754 222
423 3300021358 Ga0213873_10000020 Ga0213873_1000002010 222
424 3300021384 Ga0213876_10000004 Ga0213876_10000004406 222
425 3300021384 Ga0213876_10000873 Ga0213876_1000087310 222
426 3300025321 Ga0207656_10131541 Ga0207656_101315411 222
427 3300025904 Ga0207647_10002267 Ga0207647_1000226712 222
428 3300025909 Ga0207705_10000002 Ga0207705_100000021487 222
429 3300025909 Ga0207705_10000199 Ga0207705_100001998 222
430 3300025913 Ga0207695_10020167 Ga0207695_100201677 222
431 3300025917 Ga0207660_10000048 Ga0207660_1000004828 222
432 3300025919 Ga0207657_10000082 Ga0207657_1000008277 222
433 3300025919 Ga0207657_10013847 Ga0207657_100138478 222
434 3300025920 Ga0207649_10000018 Ga0207649_1000001865 222
435 3300025921 Ga0207652_10000001 Ga0207652_10000001951 222
436 3300025926 Ga0207659_10587436 Ga0207659_105874361 222
437 3300025932 Ga0207690_10004719 Ga0207690_100047195 222
438 3300025949 Ga0207667_10049930 Ga0207667_100499305 222
439 3300025981 Ga0207640_10000687 Ga0207640_100006873 222
440 3300026078 Ga0207702_10022540 Ga0207702_100225403 222
441 3300026118 Ga0207675_100439503 Ga0207675_1004395031 222
442 3300031911 Ga0307412_10688384 Ga0307412_106883841 222
443 3300032005 Ga0307411_10380700 Ga0307411_103807002 222
444 3300039437 Ga0436365_1205090 Ga0436365_1205090_22461_23162 222
445 3300039437 Ga0436365_1460153 Ga0436365_1460153_69468_70148 222
446 3300039453 Ga0436362_0634959 Ga0436362_0634959_57374_58054 222
447 3300046522 Ga0495643_0016169 Ga0495643_0016169_3520_4203 222
448 3300049571 Ga0501034_0277453 Ga0501034_0277453_123_827 222
449 3300053136 Ga0500559_0001165 Ga0500559_0001165_5738_6442 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10576

EndIII_4Fe-2S

Iron-sulfur binding domain of endonuclease III

210

226

1

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

57

192

0.95

PF00633

HHH

Helix-hairpin-helix motif

122

151

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.9763 1 209
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.9627 1 209
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.9341 1 204
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.9314 1 204
1kea-assembly1.cif.gz_A structure of a thermostable thymine-dna glycosylase 0.8908 4 205
ID Description Score Start End Superfamily
af_P0AB83_133_208_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9967 134 208 1.10.1670.10
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9948 22 132 1.10.340.30
2abkA02 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9889 133 209 1.10.1670.10
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9772 22 132 1.10.340.30
af_Q4CY47_40_146_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9748 29 125 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A844ZYB2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 1.001 1 211 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0016829
GO:0019104
GO:0046872
GO:0051539
AF-A0A3M1GAZ7-F1-model_v4 Endonuclease III 1.001 1 189 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A520GTW6-F1-model_v4 Endonuclease III 1.001 1 163 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A7C1U6L2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9998 1 209 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-A0A4D7B767-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9993 1 209 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078

Feature Viewer

pLDDT pTM Quality
92.55 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map