F446325

General Info

Members Datasets Scaffolds Average Seq Length
449 260 450 345

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100182790|Ga0070663_1001827902
Length 406
Sequence VRARISQATHMSMQTYRYSLTPFNSFEFEQNVRNTARSVYPQYPTRRQNEGEFSLWVVQTDMKILRQVAGIDVAQKELVVSVGRFKEDLTKEIYGFKVFANTPKGFQELVEWSKKKMSSEVSVRFVMEATGVYHESLAYYLAEQGQLVSIVMPAKISNYQKTLEIKTITDKTASECITLFGLDRQLDTWQKPKRLYRNLRHVTRERDQLIEERTVLKNQLHAEQSEAFPDKKSIARVQERINLINKQEKEIMEEIRDYIKEDEQISKLVTLIGSVPGIGLLTATIILSETNGFDLIRNKKQLTSYAGLDVKEKQSGTSVKGKPKISKKGNRYLRKAMHFPALTAIRNDERFKAIYARLVQKHGIKMKAAVAVQRKLLEMTYTMYKTNKPYDKQYLKQTQNEDGTTA

Samples

Sample ID Description Type Environment
1 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
184 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
250 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
251 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
254 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
258 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
259 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 1.34
Rhizosphere 87.08
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1013513 3300001915 Bacteria 1384
2 JGI24740J21852_10034005 3300001979 Unclassified 1611
3 JGI24740J21852_10044376 3300001979 Bacteria 1320
4 JGI24035J26624_1003358 3300002126 Bacteria 1506
5 rootH1_10061898 3300003316 Bacteria 1431
6 rootH1_10061898 3300003323 Bacteria 4393
7 rootH1_10111965 3300003316 Unclassified 1528
8 rootH1_10111966 3300003316 Bacteria 1399
9 rootH1_10194063 3300003316 Bacteria 1401
10 rootH1_10194063 3300003323 Bacteria 3669
11 rootH2_10040015 3300003320 Unclassified 1432
12 rootH2_10093406 3300003320 Bacteria 1442
13 rootH2_10200765 3300003320 Bacteria 1556
14 rootL2_10006763 3300003322 Bacteria 1413
15 rootL2_10190363 3300003322 Bacteria 1485
16 rootL2_10217888 3300003322 Bacteria 2652
17 rootL2_10273874 3300003322 Unclassified 1239
18 rootH1_10247472 3300003323 Bacteria 2617
19 rootH1_10355765 3300003323 Bacteria 1443
20 Ga0065704_10121830 3300005289 Unclassified 1755
21 Ga0065715_10146562 3300005293 Bacteria 1781
22 Ga0070658_10168301 3300005327 Bacteria 1841
23 Ga0070658_10295445 3300005327 Unclassified 1381
24 Ga0070676_10113323 3300005328 Bacteria 1692
25 Ga0070676_10135399 3300005328 Bacteria 1562
26 Ga0070683_100031421 3300005329 Bacteria 4828
27 Ga0070683_100101695 3300005329 Bacteria 2706
28 Ga0070683_100282929 3300005329 Bacteria 1578
29 Ga0070690_100189012 3300005330 Bacteria 1427
30 Ga0070670_100150544 3300005331 Bacteria 2014
31 Ga0070670_100211604 3300005331 Bacteria 1686
32 Ga0070677_10055732 3300005333 Bacteria 1614
33 Ga0068869_100082124 3300005334 Bacteria 2408
34 Ga0070666_10128957 3300005335 Bacteria 1757
35 Ga0070666_10139673 3300005335 Bacteria 1687
36 Ga0070680_100251750 3300005336 Bacteria 1493
37 Ga0070682_100059882 3300005337 Unclassified 2406
38 Ga0070660_100043127 3300005339 Bacteria 3446
39 Ga0070689_100060348 3300005340 Bacteria 2948
40 Ga0070687_100111837 3300005343 Bacteria 1547
41 Ga0070692_10052051 3300005345 Bacteria 2132
42 Ga0070675_100038931 3300005354 Bacteria 3877
43 Ga0070675_100204825 3300005354 Unclassified 1713
44 Ga0070675_100273728 3300005354 Unclassified 1482
45 Ga0070675_100301835 3300005354 Bacteria 1411
46 Ga0070671_100063569 3300005355 Bacteria 3074
47 Ga0070671_100202183 3300005355 Bacteria 1685
48 Ga0070671_100231331 3300005355 Bacteria 1569
49 Ga0070674_100083829 3300005356 Bacteria 2284
50 Ga0070673_100094184 3300005364 Bacteria 2454
51 Ga0070673_100197355 3300005364 Bacteria 1732
52 Ga0070673_100302448 3300005364 Bacteria 1409
53 Ga0070688_100155858 3300005365 Unclassified 1565
54 Ga0070659_100201027 3300005366 Bacteria 1640
55 Ga0070667_100167599 3300005367 Bacteria 1938
56 Ga0070667_100174611 3300005367 Unclassified 1898
57 Ga0070711_100185048 3300005439 Bacteria 1597
58 Ga0070711_100249959 3300005439 Bacteria 1390
59 Ga0070700_100262338 3300005441 Bacteria 1244
60 Ga0070663_100182790 3300005455 Unclassified 1628
61 Ga0070663_100236036 3300005455 Bacteria 1442
62 Ga0070678_100187777 3300005456 Bacteria 1697
63 Ga0070678_100254076 3300005456 Bacteria 1475
64 Ga0070662_100118508 3300005457 Unclassified 2026
65 Ga0070662_100260205 3300005457 Bacteria 1398
66 Ga0070681_10185413 3300005458 Bacteria 2001
67 Ga0068867_100135360 3300005459 Bacteria 1920
68 Ga0068867_100173418 3300005459 Bacteria 1710
69 Ga0070679_100151820 3300005530 Bacteria 2293
70 Ga0070679_100328867 3300005530 Bacteria 1477
71 Ga0070684_100053532 3300005535 Bacteria 3514
72 Ga0070684_100125509 3300005535 Bacteria 2312
73 Ga0068853_100046778 3300005539 Bacteria 3711
74 Ga0068853_100186799 3300005539 Bacteria 1881
75 Ga0070672_100252287 3300005543 Bacteria 1486
76 Ga0070686_100125165 3300005544 Bacteria 1770
77 Ga0070696_100132006 3300005546 Bacteria 1818
78 Ga0070693_100089204 3300005547 Unclassified 1856
79 Ga0070693_100171650 3300005547 Bacteria 1389
80 Ga0070665_100222021 3300005548 Bacteria 1890
81 Ga0068855_100296721 3300005563 Bacteria 1791
82 Ga0070664_100188996 3300005564 Bacteria 1834
83 Ga0070664_100297501 3300005564 Bacteria 1458
84 Ga0068857_100059773 3300005577 Bacteria 3387
85 Ga0068857_100061343 3300005577 Bacteria 3341
86 Ga0068857_100184680 3300005577 Unclassified 1898
87 Ga0068857_100288439 3300005577 Bacteria 1511
88 Ga0068854_100115174 3300005578 Unclassified 2033
89 Ga0068854_100207205 3300005578 Bacteria 1545
90 Ga0068854_100228554 3300005578 Bacteria 1475
91 Ga0068856_100047127 3300005614 Bacteria 4246
92 Ga0068852_100139317 3300005616 Bacteria 2243
93 Ga0068852_100255584 3300005616 Bacteria 1680
94 Ga0068859_100067001 3300005617 Bacteria 3625
95 Ga0068859_100205851 3300005617 Bacteria 2053
96 Ga0068859_100472810 3300005617 Bacteria 1349
97 Ga0068864_100226917 3300005618 Bacteria 1726
98 Ga0068866_10083225 3300005718 Bacteria 1724
99 Ga0068861_100130422 3300005719 Unclassified 2040
100 Ga0068861_100184988 3300005719 Bacteria 1737
101 Ga0068851_10048298 3300005834 Bacteria 2157
102 Ga0068863_100137062 3300005841 Bacteria 2338
103 Ga0068863_100196249 3300005841 Bacteria 1940
104 Ga0068863_100276181 3300005841 Unclassified 1627
105 Ga0068863_100367280 3300005841 Bacteria 1404
106 Ga0068858_100141265 3300005842 Unclassified 2261
107 Ga0068858_100231490 3300005842 Bacteria 1752
108 Ga0068860_100009988 3300005843 Bacteria 9407
109 Ga0068860_100376215 3300005843 Unclassified 1401
110 Ga0068862_100267299 3300005844 Bacteria 1563
111 Ga0068862_100276983 3300005844 Unclassified 1536
112 Ga0070716_100023262 3300006173 Unclassified 3283
113 Ga0070716_100101971 3300006173 Bacteria 1761
114 Ga0075366_10072725 3300006195 Bacteria 2049
115 Ga0097621_100158464 3300006237 Unclassified 1944
116 Ga0097621_100243282 3300006237 Bacteria 1573
117 Ga0097621_100245408 3300006237 Bacteria 1567
118 Ga0097621_100346260 3300006237 Bacteria 1320
119 Ga0068871_100168757 3300006358 Unclassified 1875
120 Ga0068871_100252946 3300006358 Bacteria 1535
121 Ga0068871_100301023 3300006358 Bacteria 1408
122 Ga0068865_100166734 3300006881 Bacteria 1685
123 Ga0097620_100067002 3300006931 Bacteria 3625
124 Ga0097620_100205861 3300006931 Bacteria 2053
125 Ga0097620_100472870 3300006931 Bacteria 1349
126 Ga0075435_100210849 3300007076 Bacteria 1648
127 Ga0105251_10022452 3300009011 Bacteria 3277
128 Ga0105240_10006272 3300009093 Bacteria 17495
129 Ga0105240_10294217 3300009093 Bacteria 1860
130 Ga0111539_10386284 3300009094 Bacteria 1630
131 Ga0111539_10538609 3300009094 Bacteria 1360
132 Ga0111539_10551560 3300009094 Unclassified 1342
133 Ga0105247_10183199 3300009101 Bacteria 1399
134 Ga0105241_10074377 3300009174 Unclassified 2646
135 Ga0105242_10262289 3300009176 Bacteria 1561
136 Ga0105242_10278441 3300009176 Unclassified 1518
137 Ga0105242_10287580 3300009176 Bacteria 1496
138 Ga0105237_10260408 3300009545 Bacteria 1737
139 Ga0105238_10262427 3300009551 Bacteria 1707
140 Ga0105249_10021317 3300009553 Bacteria 5800
141 Ga0105249_10057240 3300009553 Unclassified 3571
142 Ga0105249_10252442 3300009553 Bacteria 1749
143 Ga0105249_10348019 3300009553 Bacteria 1500
144 Ga0099796_10028555 3300010159 Bacteria 1792
145 Ga0105239_10260267 3300010375 Bacteria 1950
146 Ga0157373_10050623 3300013100 Bacteria 2958
147 Ga0157373_10074462 3300013100 Bacteria 2395
148 Ga0157371_10086630 3300013102 Bacteria 2218
149 Ga0157370_10014130 3300013104 Bacteria 8187
150 Ga0157370_10236093 3300013104 Bacteria 1692
151 Ga0157370_10354147 3300013104 Bacteria 1353
152 Ga0157370_10378152 3300013104 Bacteria 1305
153 Ga0157369_10019708 3300013105 Bacteria 7549
154 Ga0157369_10180532 3300013105 Bacteria 2221
155 Ga0157369_10305576 3300013105 Bacteria 1654
156 Ga0157369_10331392 3300013105 Unclassified 1581
157 Ga0157374_10192901 3300013296 Bacteria 1993
158 Ga0157374_10241799 3300013296 Unclassified 1775
159 Ga0157374_10250621 3300013296 Bacteria 1742
160 Ga0157378_10142669 3300013297 Unclassified 2225
161 Ga0157378_10262991 3300013297 Bacteria 1656
162 Ga0157378_10303451 3300013297 Bacteria 1546
163 Ga0157378_10406786 3300013297 Bacteria 1342
164 Ga0163162_10003450 3300013306 Bacteria 15102
165 Ga0163162_10257301 3300013306 Bacteria 1877
166 Ga0163162_10294816 3300013306 Bacteria 1754
167 Ga0163162_10310542 3300013306 Bacteria 1709
168 Ga0163162_10369994 3300013306 Bacteria 1566
169 Ga0157372_10022384 3300013307 Bacteria 6838
170 Ga0157372_10267203 3300013307 Unclassified 1987
171 Ga0157372_10274196 3300013307 Bacteria 1960
172 Ga0157372_10421692 3300013307 Bacteria 1555
173 Ga0157375_10212583 3300013308 Bacteria 2092
174 Ga0157375_10260533 3300013308 Unclassified 1896
175 Ga0157375_10630583 3300013308 Bacteria 1229
176 Ga0163163_10272294 3300014325 Bacteria 1744
177 Ga0163163_10344090 3300014325 Bacteria 1547
178 Ga0163163_10385225 3300014325 Bacteria 1460
179 Ga0157380_10119705 3300014326 Bacteria 2228
180 Ga0157380_10147545 3300014326 Bacteria 2029
181 Ga0157380_10180578 3300014326 Bacteria 1854
182 Ga0157380_10316459 3300014326 Bacteria 1445
183 Ga0157380_10343686 3300014326 Bacteria 1393
184 Ga0157377_10063188 3300014745 Bacteria 2120
185 Ga0157377_10122813 3300014745 Bacteria 1576
186 Ga0157377_10140814 3300014745 Bacteria 1482
187 Ga0157379_10309764 3300014968 Bacteria 1440
188 Ga0157376_10209323 3300014969 Unclassified 1800
189 Ga0157376_10462844 3300014969 Bacteria 1239
190 Ga0163161_10095031 3300017792 Bacteria 2210
191 Ga0163161_10162940 3300017792 Bacteria 1701
192 Ga0209130_1018888 3300025284 Bacteria 1610
193 Ga0207673_1005216 3300025290 Bacteria 1579
194 Ga0207697_10032289 3300025315 Bacteria 2143
195 Ga0207656_10036032 3300025321 Bacteria 2075
196 Ga0207682_10031325 3300025893 Bacteria 2134
197 Ga0207682_10042967 3300025893 Bacteria 1848
198 Ga0207682_10095912 3300025893 Bacteria 1292
199 Ga0207642_10096257 3300025899 Bacteria 1475
200 Ga0207680_10145998 3300025903 Bacteria 1573
201 Ga0207680_10167585 3300025903 Bacteria 1477
202 Ga0207647_10076447 3300025904 Bacteria 2014
203 Ga0207645_10100326 3300025907 Bacteria 1867
204 Ga0207705_10304279 3300025909 Bacteria 1223
205 Ga0207707_10319754 3300025912 Bacteria 1340
206 Ga0207707_10331228 3300025912 Bacteria 1313
207 Ga0207695_10041596 3300025913 Bacteria 4918
208 Ga0207695_10128072 3300025913 Bacteria 2499
209 Ga0207671_10162481 3300025914 Bacteria 1730
210 Ga0207663_10196856 3300025916 Bacteria 1451
211 Ga0207660_10255172 3300025917 Bacteria 1385
212 Ga0207657_10125919 3300025919 Bacteria 2104
213 Ga0207657_10195095 3300025919 Bacteria 1632
214 Ga0207649_10091949 3300025920 Unclassified 1988
215 Ga0207649_10213208 3300025920 Bacteria 1371
216 Ga0207652_10152349 3300025921 Bacteria 2071
217 Ga0207652_10314669 3300025921 Bacteria 1413
218 Ga0207650_10305341 3300025925 Bacteria 1300
219 Ga0207659_10272511 3300025926 Unclassified 1381
220 Ga0207659_10281712 3300025926 Bacteria 1359
221 Ga0207659_10331763 3300025926 Unclassified 1258
222 Ga0207644_10169237 3300025931 Bacteria 1704
223 Ga0207644_10199329 3300025931 Bacteria 1578
224 Ga0207644_10226962 3300025931 Unclassified 1482
225 Ga0207690_10212949 3300025932 Unclassified 1474
226 Ga0207690_10240761 3300025932 Bacteria 1393
227 Ga0207706_10176162 3300025933 Bacteria 1879
228 Ga0207706_10189937 3300025933 Bacteria 1803
229 Ga0207686_10109405 3300025934 Bacteria 1861
230 Ga0207669_10197690 3300025937 Bacteria 1456
231 Ga0207704_10120438 3300025938 Bacteria 1794
232 Ga0207665_10035627 3300025939 Unclassified 3304
233 Ga0207665_10132368 3300025939 Bacteria 1772
234 Ga0207691_10014260 3300025940 Bacteria 7581
235 Ga0207691_10249003 3300025940 Bacteria 1534
236 Ga0207689_10096541 3300025942 Bacteria 2427
237 Ga0207689_10168562 3300025942 Bacteria 1804
238 Ga0207689_10184530 3300025942 Bacteria 1721
239 Ga0207661_10041484 3300025944 Bacteria 3623
240 Ga0207661_10083285 3300025944 Unclassified 2646
241 Ga0207661_10205727 3300025944 Bacteria 1732
242 Ga0207679_10000691 3300025945 Bacteria 22567
243 Ga0207679_10185145 3300025945 Bacteria 1726
244 Ga0207679_10303915 3300025945 Bacteria 1376
245 Ga0207667_10180942 3300025949 Bacteria 2165
246 Ga0207651_10219014 3300025960 Bacteria 1537
247 Ga0207651_10245925 3300025960 Unclassified 1461
248 Ga0207651_10288020 3300025960 Bacteria 1360
249 Ga0207712_10004867 3300025961 Bacteria 8491
250 Ga0207712_10010841 3300025961 Bacteria 5800
251 Ga0207712_10026840 3300025961 Bacteria 3842
252 Ga0207712_10094075 3300025961 Bacteria 2213
253 Ga0207712_10219719 3300025961 Bacteria 1518
254 Ga0207712_10324756 3300025961 Bacteria 1271
255 Ga0207640_10213966 3300025981 Bacteria 1470
256 Ga0207640_10277397 3300025981 Bacteria 1315
257 Ga0207658_10190312 3300025986 Bacteria 1705
258 Ga0207658_10271175 3300025986 Bacteria 1451
259 Ga0207677_10266824 3300026023 Bacteria 1398
260 Ga0207703_10334216 3300026035 Bacteria 1391
261 Ga0207639_10014998 3300026041 Bacteria 5460
262 Ga0207639_10205080 3300026041 Bacteria 1694
263 Ga0207639_10249671 3300026041 Bacteria 1547
264 Ga0207639_10265724 3300026041 Bacteria 1503
265 Ga0207639_10340891 3300026041 Bacteria 1336
266 Ga0207678_10119707 3300026067 Unclassified 2247
267 Ga0207678_10123703 3300026067 Unclassified 2207
268 Ga0207678_10189352 3300026067 Unclassified 1758
269 Ga0207702_10066339 3300026078 Bacteria 3093
270 Ga0207702_10129713 3300026078 Bacteria 2267
271 Ga0207702_10378712 3300026078 Bacteria 1360
272 Ga0207641_10121902 3300026088 Bacteria 2328
273 Ga0207641_10268023 3300026088 Bacteria 1601
274 Ga0207641_10286302 3300026088 Unclassified 1552
275 Ga0207641_10348699 3300026088 Bacteria 1410
276 Ga0207648_10093805 3300026089 Bacteria 2625
277 Ga0207648_10136078 3300026089 Bacteria 2164
278 Ga0207648_10148710 3300026089 Bacteria 2067
279 Ga0207648_10205107 3300026089 Bacteria 1749
280 Ga0207676_10369161 3300026095 Bacteria 1332
281 Ga0207674_10072180 3300026116 Bacteria 3468
282 Ga0207674_10186004 3300026116 Bacteria 2028
283 Ga0207674_10205284 3300026116 Bacteria 1920
284 Ga0207674_10346547 3300026116 Unclassified 1436
285 Ga0207675_100214767 3300026118 Bacteria 1851
286 Ga0207675_100326098 3300026118 Bacteria 1500
287 Ga0207683_10126408 3300026121 Unclassified 2298
288 Ga0207683_10143349 3300026121 Bacteria 2153
289 Ga0207683_10298896 3300026121 Bacteria 1473
290 Ga0207698_10225130 3300026142 Bacteria 1698
291 Ga0207698_10255213 3300026142 Bacteria 1607
292 Ga0207698_10362371 3300026142 Bacteria 1373
293 Ga0209967_1007155 3300027364 Unclassified 1522
294 Ga0209984_1005167 3300027424 Bacteria 1560
295 Ga0210000_1009623 3300027462 Unclassified 1424
296 Ga0209968_1006609 3300027526 Unclassified 1747
297 Ga0209974_10024783 3300027876 Bacteria 1985
298 Ga0207428_10228697 3300027907 Bacteria 1392
299 Ga0268266_10248248 3300028379 Bacteria 1645
300 Ga0268265_10082345 3300028380 Bacteria 2544
301 Ga0268265_10215296 3300028380 Bacteria 1677
302 Ga0268264_10000470 3300028381 Bacteria 54746
303 Ga0268264_10315090 3300028381 Bacteria 1477
304 Ga0268264_10382134 3300028381 Bacteria 1349
305 Ga0265336_10025311 3300028666 Bacteria 1870
306 Ga0307517_10001269 3300028786 Bacteria 42402
307 Ga0307515_10015185 3300028794 Bacteria 14206
308 Ga0307515_10146475 3300028794 Bacteria 2497
309 Ga0307515_10200089 3300028794 Unclassified 1876
310 Ga0307515_10238146 3300028794 Bacteria 1597
311 Ga0265338_10172243 3300028800 Bacteria 1658
312 Ga0265339_10092147 3300031249 Bacteria 1587
313 Ga0307513_10088603 3300031456 Bacteria 3162
314 Ga0307513_10090258 3300031456 Bacteria 3126
315 Ga0307513_10246121 3300031456 Bacteria 1588
316 Ga0307513_10289769 3300031456 Unclassified 1409
317 Ga0307509_10189991 3300031507 Bacteria 1906
318 Ga0307509_10267780 3300031507 Bacteria 1478
319 Ga0307405_10133352 3300031731 Bacteria 1720
320 Ga0307413_10106174 3300031824 Bacteria 1868
321 Ga0307410_10088360 3300031852 Bacteria 2194
322 Ga0307410_10088558 3300031852 Unclassified 2192
323 Ga0307406_10048175 3300031901 Bacteria 2690
324 Ga0307407_10073183 3300031903 Bacteria 2046
325 Ga0307412_10132022 3300031911 Bacteria 1815
326 Ga0307412_10209290 3300031911 Unclassified 1487
327 Ga0307412_10291174 3300031911 Bacteria 1286
328 Ga0307409_100129363 3300031995 Unclassified 2154
329 Ga0307409_100329680 3300031995 Bacteria 1432
330 Ga0307414_10091689 3300032004 Bacteria 2259
331 Ga0307414_10115580 3300032004 Bacteria 2052
332 Ga0307414_10308820 3300032004 Bacteria 1341
333 Ga0307411_10161819 3300032005 Bacteria 1677
334 Ga0307411_10208241 3300032005 Bacteria 1508
335 Ga0307415_100194401 3300032126 Bacteria 1604
336 Ga0373948_0019740 3300034817 Bacteria 1277
337 Ga0373940_0038318 3300035088 Bacteria 1308
338 Ga0373952_0023630 3300035092 Bacteria 1314
339 Ga0373939_0063332 3300035114 Bacteria 1184
340 Ga0373960_0016199 3300035121 Bacteria 1914
341 Ga0373931_0066159 3300035691 Bacteria 1960
342 Ga0373937_0311412 3300036401 Bacteria 1489
343 Ga0395900_0288836 3300037418 Unclassified 1629
344 Ga0395905_0106381 3300037471 Bacteria 2634
345 Ga0395905_0306433 3300037471 Bacteria 1476
346 Ga0395905_0333676 3300037471 Bacteria 1407
347 Ga0395901_0235417 3300038443 Bacteria 1911
348 Ga0439439_0008793 3300041406 Unclassified 2391
349 Ga0439466_0064489 3300041411 Unclassified 1174
350 Ga0451804_0638018 3300041463 Bacteria 1497
351 Ga0451807_1766355 3300041486 Bacteria 2135
352 Ga0451851_1275000 3300041507 Bacteria 1444
353 Ga0439433_0011379 3300041999 Bacteria 1949
354 Ga0439442_006473 3300042002 Bacteria 2351
355 Ga0439445_0007575 3300042004 Bacteria 2523
356 Ga0439449_0085110 3300042007 Unclassified 1166
357 Ga0439462_0023561 3300042015 Bacteria 1614
358 Ga0439434_0005047 3300042435 Bacteria 3860
359 Ga0451577_0152439 3300042876 Archaea 2080
360 Ga0453684_0292441 3300044712 Archaea 1854
361 Ga0466957_0002624 3300044842 Bacteria 9700
362 Ga0466960_0172564 3300044901 Unclassified 1168
363 Ga0495638_0119409 3300046460 Bacteria 1559
364 Ga0495582_0088768 3300046473 Bacteria 1722
365 Ga0495605_0048236 3300046474 Bacteria 2086
366 Ga0495610_0064372 3300046512 Bacteria 1733
367 Ga0495610_0090529 3300046512 Bacteria 1387
368 Ga0495631_0025005 3300046518 Bacteria 2753
369 Ga0495632_0076097 3300046519 Bacteria 1605
370 Ga0495637_0017723 3300046520 Bacteria 3312
371 Ga0495643_0012238 3300046522 Bacteria 5182
372 Ga0495643_0080156 3300046522 Bacteria 1700
373 Ga0495643_0102549 3300046522 Bacteria 1465
374 Ga0495648_0022656 3300046524 Bacteria 4317
375 Ga0495597_0062461 3300046542 Bacteria 1620
376 Ga0495633_0049009 3300046558 Bacteria 1994
377 Ga0495668_0015394 3300046616 Bacteria 4467
378 Ga0495625_0095082 3300046660 Bacteria 2055
379 Ga0495661_0108288 3300046665 Bacteria 1552
380 Ga0495658_0174922 3300046683 Bacteria 1330
381 Ga0495669_0085273 3300046684 Unclassified 1453
382 Ga0495613_0168970 3300046689 Bacteria 1553
383 Ga0495671_0045052 3300046692 Bacteria 2209
384 Ga0495671_0048474 3300046692 Bacteria 2119
385 Ga0495649_0102252 3300046694 Bacteria 1522
386 Ga0495672_0012179 3300047320 Bacteria 6015
387 Ga0495672_0017272 3300047320 Bacteria 4830
388 Ga0495676_0177466 3300047321 Bacteria 1495
389 Ga0495680_0192841 3300047322 Bacteria 1465
390 Ga0495687_066036 3300047443 Bacteria 1470
391 Ga0495687_070419 3300047443 Bacteria 1404
392 Ga0495602_0221277 3300048088 Bacteria 1429
393 Ga0496104_0402357 3300048907 Bacteria 1281
394 Ga0496105_0192056 3300048908 Bacteria 1669
395 Ga0496105_0193700 3300048908 Bacteria 1661
396 Ga0496110_0248996 3300048913 Bacteria 1617
397 Ga0501300_006919 3300049523 Bacteria 1663
398 Ga0501032_0103436 3300049569 Bacteria 1887
399 Ga0501032_0118820 3300049569 Bacteria 1748
400 Ga0501034_0299694 3300049571 Unclassified 1544
401 Ga0501036_0256018 3300049572 Bacteria 1466
402 Ga0501037_0095341 3300049573 Bacteria 2151
403 Ga0501037_0207844 3300049573 Bacteria 1381
404 Ga0501038_0271420 3300049574 Unclassified 1337
405 Ga0501043_0095580 3300049579 Bacteria 2335
406 Ga0501043_0161030 3300049579 Unclassified 1753
407 Ga0501046_0168427 3300049580 Bacteria 1645
408 Ga0501046_0193205 3300049580 Unclassified 1517
409 Ga0501047_0088237 3300049581 Bacteria 2978
410 Ga0501047_0206498 3300049581 Bacteria 1823
411 Ga0501047_0239203 3300049581 Bacteria 1666
412 Ga0501048_0112295 3300049582 Bacteria 1924
413 Ga0501048_0155144 3300049582 Unclassified 1619
414 Ga0501073_0110086 3300049589 Bacteria 1911
415 Ga0501257_027823 3300049686 Bacteria 1354
416 Ga0501083_0098824 3300049744 Unclassified 1925
417 Ga0501266_007235 3300049763 Bacteria 1388
418 Ga0501035_0141980 3300049822 Bacteria 2087
419 Ga0501035_0280111 3300049822 Unclassified 1409
420 Ga0501044_0004181 3300049823 Bacteria 16227
421 Ga0501044_0236644 3300049823 Unclassified 1771
422 nmdc:mga0k408_126501_c1 3300050493 Bacteria 1516
423 nmdc:mga08y16_316842_c1 3300050511 Bacteria 1606
424 nmdc:mga08y16_384013_c1 3300050511 Bacteria 1439
425 nmdc:mga0rr50_311797_c1 3300050513 Bacteria 1318
426 Ga0500578_0104584 3300053086 Bacteria 1789
427 Ga0500578_0137473 3300053086 Bacteria 1529
428 Ga0500644_0024918 3300053088 Bacteria 1834
429 Ga0500646_0004398 3300053090 Bacteria 3570
430 Ga0500651_0104273 3300053093 Bacteria 1736
431 Ga0500607_068612 3300053121 Bacteria 1834
432 Ga0500618_011971 3300053125 Bacteria 2286
433 Ga0500628_022469 3300053129 Unclassified 1290
434 Ga0500559_0034254 3300053136 Unclassified 2189
435 Ga0500559_0058924 3300053136 Bacteria 1708
436 Ga0500568_0058123 3300053139 Bacteria 1503
437 Ga0500588_0010551 3300053146 Bacteria 2235
438 Ga0500590_088483 3300053148 Bacteria 1508
439 Ga0500603_019242 3300053150 Bacteria 1654
440 Ga0500616_0047803 3300053153 Unclassified 2270
441 Ga0500630_069854 3300053159 Bacteria 1663
442 Ga0500633_0000451 3300053160 Bacteria 6471
443 Ga0500634_0031836 3300053161 Unclassified 2877
444 Ga0500636_0007051 3300053177 Bacteria 6483
445 Ga0500637_0113607 3300053178 Unclassified 1570
446 Ga0500637_0120829 3300053178 Bacteria 1520
447 Ga0500637_0120832 3300053178 Bacteria 1520
448 Ga0500656_003003 3300053732 Unclassified 1556
449 Ga0500661_005013 3300055283 Bacteria 2481
450 Ga0501082_0476880 3300060353 Unclassified 1090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100038931 Ga0070675_1000389314 294
2 3300025926 Ga0207659_10281712 Ga0207659_102817121 294
3 3300025960 Ga0207651_10288020 Ga0207651_102880201 294
4 3300053178 Ga0500637_0120832 Ga0500637_0120832_127_1314 296
5 3300055283 Ga0500661_005013 Ga0500661_005013_1160_2347 296
6 3300048907 Ga0496104_0402357 Ga0496104_0402357_128_1246 301
7 3300048908 Ga0496105_0192056 Ga0496105_0192056_342_1460 301
8 3300013105 Ga0157369_10019708 Ga0157369_100197089 302
9 3300041411 Ga0439466_0064489 Ga0439466_0064489_205_1164 302
10 3300042007 Ga0439449_0085110 Ga0439449_0085110_197_1156 302
11 3300049569 Ga0501032_0103436 Ga0501032_0103436_309_1436 307
12 3300049571 Ga0501034_0299694 Ga0501034_0299694_180_1307 307
13 3300049573 Ga0501037_0095341 Ga0501037_0095341_564_1691 307
14 3300049579 Ga0501043_0161030 Ga0501043_0161030_491_1618 307
15 3300049580 Ga0501046_0193205 Ga0501046_0193205_259_1386 307
16 3300049581 Ga0501047_0088237 Ga0501047_0088237_1644_2771 307
17 3300049582 Ga0501048_0155144 Ga0501048_0155144_269_1396 307
18 3300049744 Ga0501083_0098824 Ga0501083_0098824_357_1484 307
19 3300049822 Ga0501035_0280111 Ga0501035_0280111_128_1255 307
20 3300049823 Ga0501044_0236644 Ga0501044_0236644_440_1567 307
21 3300003316 rootH1_10111965 rootH1_101119651 314
22 3300003320 rootH2_10040015 rootH2_100400151 314
23 3300013306 Ga0163162_10257301 Ga0163162_102573012 314
24 3300025986 Ga0207658_10271175 Ga0207658_102711751 314
25 3300031995 Ga0307409_100329680 Ga0307409_1003296801 314
26 3300047320 Ga0495672_0017272 Ga0495672_0017272_2478_3533 314
27 3300005364 Ga0070673_100302448 Ga0070673_1003024481 315
28 3300005459 Ga0068867_100135360 Ga0068867_1001353601 315
29 3300013308 Ga0157375_10630583 Ga0157375_106305832 315
30 3300014325 Ga0163163_10344090 Ga0163163_103440901 315
31 3300017792 Ga0163161_10162940 Ga0163161_101629402 315
32 3300025893 Ga0207682_10031325 Ga0207682_100313252 315
33 3300025940 Ga0207691_10014260 Ga0207691_100142604 315
34 3300026089 Ga0207648_10136078 Ga0207648_101360782 315
35 3300026121 Ga0207683_10298896 Ga0207683_102988961 315
36 3300032004 Ga0307414_10308820 Ga0307414_103088201 315
37 3300005841 Ga0068863_100196249 Ga0068863_1001962493 316
38 3300013100 Ga0157373_10050623 Ga0157373_100506232 316
39 3300013104 Ga0157370_10354147 Ga0157370_103541471 316
40 3300026088 Ga0207641_10268023 Ga0207641_102680231 316
41 3300046684 Ga0495669_0085273 Ga0495669_0085273_99_1148 316
42 3300005355 Ga0070671_100063569 Ga0070671_1000635693 317
43 3300048913 Ga0496110_0248996 Ga0496110_0248996_390_1436 317
44 3300005441 Ga0070700_100262338 Ga0070700_1002623381 318
45 3300013296 Ga0157374_10192901 Ga0157374_101929012 318
46 3300053086 Ga0500578_0104584 Ga0500578_0104584_277_1335 318
47 3300060353 Ga0501082_0476880 Ga0501082_0476880_67_1071 318
48 3300005455 Ga0070663_100236036 Ga0070663_1002360362 319
49 3300010159 Ga0099796_10028555 Ga0099796_100285552 319
50 3300013104 Ga0157370_10236093 Ga0157370_102360931 319
51 3300014326 Ga0157380_10119705 Ga0157380_101197052 320
52 3300031456 Ga0307513_10090258 Ga0307513_100902583 320
53 3300005334 Ga0068869_100082124 Ga0068869_1000821242 321
54 3300009093 Ga0105240_10006272 Ga0105240_1000627213 321
55 3300025942 Ga0207689_10096541 Ga0207689_100965412 321
56 3300013297 Ga0157378_10262991 Ga0157378_102629911 322
57 3300046460 Ga0495638_0119409 Ga0495638_0119409_258_1289 322
58 3300046518 Ga0495631_0025005 Ga0495631_0025005_1033_2064 322
59 3300046524 Ga0495648_0022656 Ga0495648_0022656_3153_4184 322
60 3300046616 Ga0495668_0015394 Ga0495668_0015394_3318_4349 322
61 3300025913 Ga0207695_10041596 Ga0207695_100415962 323
62 3300031456 Ga0307513_10088603 Ga0307513_100886034 323
63 3300031901 Ga0307406_10048175 Ga0307406_100481752 323
64 3300031911 Ga0307412_10132022 Ga0307412_101320222 323
65 3300046660 Ga0495625_0095082 Ga0495625_0095082_277_1320 323
66 3300053086 Ga0500578_0137473 Ga0500578_0137473_318_1361 323
67 3300053139 Ga0500568_0058123 Ga0500568_0058123_183_1238 323
68 3300044842 Ga0466957_0002624 Ga0466957_0002624_2742_3785 324
69 3300049581 Ga0501047_0206498 Ga0501047_0206498_620_1693 324
70 3300053093 Ga0500651_0104273 Ga0500651_0104273_384_1415 324
71 3300025960 Ga0207651_10245925 Ga0207651_102459251 325
72 3300041406 Ga0439439_0008793 Ga0439439_0008793_718_1749 326
73 3300041999 Ga0439433_0011379 Ga0439433_0011379_779_1810 326
74 3300042002 Ga0439442_006473 Ga0439442_006473_445_1476 326
75 3300042004 Ga0439445_0007575 Ga0439445_0007575_709_1740 326
76 3300042015 Ga0439462_0023561 Ga0439462_0023561_336_1367 326
77 3300042435 Ga0439434_0005047 Ga0439434_0005047_784_1815 326
78 3300031507 Ga0307509_10189991 Ga0307509_101899913 328
79 3300046558 Ga0495633_0049009 Ga0495633_0049009_493_1536 328
80 3300053146 Ga0500588_0010551 Ga0500588_0010551_97_1149 328
81 3300005335 Ga0070666_10139673 Ga0070666_101396732 329
82 3300005548 Ga0070665_100222021 Ga0070665_1002220212 329
83 3300005614 Ga0068856_100047127 Ga0068856_1000471273 329
84 3300005841 Ga0068863_100276181 Ga0068863_1002761812 329
85 3300006237 Ga0097621_100158464 Ga0097621_1001584643 329
86 3300006358 Ga0068871_100168757 Ga0068871_1001687571 329
87 3300009176 Ga0105242_10278441 Ga0105242_102784411 329
88 3300013296 Ga0157374_10241799 Ga0157374_102417992 329
89 3300013297 Ga0157378_10142669 Ga0157378_101426692 329
90 3300013306 Ga0163162_10310542 Ga0163162_103105421 329
91 3300013308 Ga0157375_10260533 Ga0157375_102605332 329
92 3300014969 Ga0157376_10209323 Ga0157376_102093231 329
93 3300025903 Ga0207680_10145998 Ga0207680_101459981 329
94 3300025931 Ga0207644_10226962 Ga0207644_102269621 329
95 3300025961 Ga0207712_10324756 Ga0207712_103247561 329
96 3300026078 Ga0207702_10066339 Ga0207702_100663393 329
97 3300026088 Ga0207641_10286302 Ga0207641_102863021 329
98 3300026121 Ga0207683_10126408 Ga0207683_101264082 329
99 3300028379 Ga0268266_10248248 Ga0268266_102482481 329
100 3300047322 Ga0495680_0192841 Ga0495680_0192841_106_1170 329
101 3300028666 Ga0265336_10025311 Ga0265336_100253112 330
102 3300028800 Ga0265338_10172243 Ga0265338_101722432 330
103 3300031249 Ga0265339_10092147 Ga0265339_100921471 330
104 3300053153 Ga0500616_0047803 Ga0500616_0047803_948_2000 331
105 3300005618 Ga0068864_100226917 Ga0068864_1002269172 332
106 3300006173 Ga0070716_100023262 Ga0070716_1000232624 332
107 3300006358 Ga0068871_100252946 Ga0068871_1002529462 332
108 3300014745 Ga0157377_10122813 Ga0157377_101228131 332
109 3300025939 Ga0207665_10035627 Ga0207665_100356272 332
110 3300003316 rootH1_10111966 rootH1_101119662 333
111 3300003320 rootH2_10200765 rootH2_102007651 333
112 3300003322 rootL2_10190363 rootL2_101903631 333
113 3300003322 rootL2_10217888 rootL2_102178881 333
114 3300013297 Ga0157378_10406786 Ga0157378_104067862 333
115 3300049763 Ga0501266_007235 Ga0501266_007235_104_1129 333
116 3300053136 Ga0500559_0034254 Ga0500559_0034254_799_1824 333
117 3300053177 Ga0500636_0007051 Ga0500636_0007051_262_1287 333
118 iso_pu_bacteria 2902048731 2902052197 333
119 3300006195 Ga0075366_10072725 Ga0075366_100727252 334
120 3300050493 nmdc:mga0k408_126501_c1 nmdc:mga0k408_126501_c1_343_1368 334
121 3300053136 Ga0500559_0058924 Ga0500559_0058924_419_1444 334
122 3300003316 rootH1_10194063 rootH1_101940632 335
123 3300003320 rootH2_10093406 rootH2_100934061 335
124 3300003322 rootL2_10273874 rootL2_102738741 335
125 3300005329 Ga0070683_100031421 Ga0070683_1000314216 335
126 3300005535 Ga0070684_100053532 Ga0070684_1000535323 335
127 3300013307 Ga0157372_10022384 Ga0157372_100223843 335
128 3300014326 Ga0157380_10316459 Ga0157380_103164591 335
129 3300025944 Ga0207661_10041484 Ga0207661_100414843 335
130 3300027907 Ga0207428_10228697 Ga0207428_102286971 335
131 3300028786 Ga0307517_10001269 Ga0307517_100012695 335
132 3300037418 Ga0395900_0288836 Ga0395900_0288836_246_1277 335
133 3300037471 Ga0395905_0106381 Ga0395905_0106381_1155_2186 335
134 3300047320 Ga0495672_0012179 Ga0495672_0012179_2316_3350 335
135 3300005289 Ga0065704_10121830 Ga0065704_101218301 336
136 3300009093 Ga0105240_10294217 Ga0105240_102942171 336
137 3300009545 Ga0105237_10260408 Ga0105237_102604081 336
138 3300010375 Ga0105239_10260267 Ga0105239_102602672 336
139 3300025284 Ga0209130_1018888 Ga0209130_10188881 336
140 3300025913 Ga0207695_10128072 Ga0207695_101280722 336
141 3300025914 Ga0207671_10162481 Ga0207671_101624811 336
142 3300028794 Ga0307515_10146475 Ga0307515_101464752 336
143 3300031824 Ga0307413_10106174 Ga0307413_101061741 336
144 3300031852 Ga0307410_10088360 Ga0307410_100883601 336
145 3300031903 Ga0307407_10073183 Ga0307407_100731831 336
146 3300031911 Ga0307412_10209290 Ga0307412_102092901 336
147 3300031995 Ga0307409_100129363 Ga0307409_1001293632 336
148 3300032004 Ga0307414_10091689 Ga0307414_100916891 336
149 3300032005 Ga0307411_10161819 Ga0307411_101618191 336
150 3300032005 Ga0307411_10208241 Ga0307411_102082411 336
151 3300032126 Ga0307415_100194401 Ga0307415_1001944011 336
152 3300046692 Ga0495671_0048474 Ga0495671_0048474_750_1781 336
153 3300003323 rootH1_10355765 rootH1_103557651 337
154 3300005340 Ga0070689_100060348 Ga0070689_1000603482 337
155 3300005365 Ga0070688_100155858 Ga0070688_1001558581 337
156 3300005577 Ga0068857_100061343 Ga0068857_1000613433 337
157 3300005719 Ga0068861_100130422 Ga0068861_1001304221 337
158 3300005841 Ga0068863_100137062 Ga0068863_1001370623 337
159 3300005842 Ga0068858_100141265 Ga0068858_1001412652 337
160 3300005843 Ga0068860_100376215 Ga0068860_1003762151 337
161 3300005844 Ga0068862_100276983 Ga0068862_1002769832 337
162 3300009553 Ga0105249_10057240 Ga0105249_100572403 337
163 3300013306 Ga0163162_10003450 Ga0163162_100034502 337
164 3300014325 Ga0163163_10385225 Ga0163163_103852252 337
165 3300025961 Ga0207712_10004867 Ga0207712_100048674 337
166 3300025961 Ga0207712_10026840 Ga0207712_100268403 337
167 3300025961 Ga0207712_10094075 Ga0207712_100940752 337
168 3300026088 Ga0207641_10348699 Ga0207641_103486991 337
169 3300026116 Ga0207674_10072180 Ga0207674_100721802 337
170 3300026118 Ga0207675_100214767 Ga0207675_1002147671 337
171 3300027364 Ga0209967_1007155 Ga0209967_10071551 337
172 3300027424 Ga0209984_1005167 Ga0209984_10051671 337
173 3300027462 Ga0210000_1009623 Ga0210000_10096231 337
174 3300027526 Ga0209968_1006609 Ga0209968_10066091 337
175 3300027876 Ga0209974_10024783 Ga0209974_100247833 337
176 3300028380 Ga0268265_10215296 Ga0268265_102152962 337
177 3300028381 Ga0268264_10000470 Ga0268264_100004701 337
178 3300036401 Ga0373937_0311412 Ga0373937_0311412_126_1163 337
179 3300037471 Ga0395905_0333676 Ga0395905_0333676_237_1271 337
180 3300038443 Ga0395901_0235417 Ga0395901_0235417_756_1790 337
181 3300041463 Ga0451804_0638018 Ga0451804_0638018_309_1346 337
182 3300041486 Ga0451807_1766355 Ga0451807_1766355_381_1418 337
183 3300041507 Ga0451851_1275000 Ga0451851_1275000_234_1271 337
184 3300046522 Ga0495643_0012238 Ga0495643_0012238_2915_3952 337
185 3300046522 Ga0495643_0080156 Ga0495643_0080156_361_1395 337
186 3300046542 Ga0495597_0062461 Ga0495597_0062461_159_1193 337
187 3300046694 Ga0495649_0102252 Ga0495649_0102252_295_1329 337
188 3300047443 Ga0495687_070419 Ga0495687_070419_261_1295 337
189 3300053732 Ga0500656_003003 Ga0500656_003003_232_1269 337
190 3300001979 JGI24740J21852_10034005 JGI24740J21852_100340051 338
191 3300003316 rootH1_10061898 rootH1_100618981 338
192 3300003322 rootL2_10006763 rootL2_100067631 338
193 3300003323 rootH1_10247472 rootH1_102474722 338
194 3300005293 Ga0065715_10146562 Ga0065715_101465621 338
195 3300005333 Ga0070677_10055732 Ga0070677_100557322 338
196 3300005337 Ga0070682_100059882 Ga0070682_1000598822 338
197 3300005345 Ga0070692_10052051 Ga0070692_100520512 338
198 3300005354 Ga0070675_100273728 Ga0070675_1002737282 338
199 3300005354 Ga0070675_100301835 Ga0070675_1003018351 338
200 3300005356 Ga0070674_100083829 Ga0070674_1000838292 338
201 3300005364 Ga0070673_100197355 Ga0070673_1001973551 338
202 3300005455 Ga0070663_100182790 Ga0070663_1001827902 338
203 3300005456 Ga0070678_100187777 Ga0070678_1001877771 338
204 3300005457 Ga0070662_100118508 Ga0070662_1001185082 338
205 3300005459 Ga0068867_100173418 Ga0068867_1001734181 338
206 3300005530 Ga0070679_100151820 Ga0070679_1001518202 338
207 3300005543 Ga0070672_100252287 Ga0070672_1002522871 338
208 3300005547 Ga0070693_100089204 Ga0070693_1000892041 338
209 3300005578 Ga0068854_100115174 Ga0068854_1001151742 338
210 3300005616 Ga0068852_100255584 Ga0068852_1002555841 338
211 3300005718 Ga0068866_10083225 Ga0068866_100832252 338
212 3300005719 Ga0068861_100184988 Ga0068861_1001849881 338
213 3300006237 Ga0097621_100245408 Ga0097621_1002454081 338
214 3300006881 Ga0068865_100166734 Ga0068865_1001667341 338
215 3300007076 Ga0075435_100210849 Ga0075435_1002108491 338
216 3300009011 Ga0105251_10022452 Ga0105251_100224522 338
217 3300009094 Ga0111539_10386284 Ga0111539_103862841 338
218 3300009174 Ga0105241_10074377 Ga0105241_100743772 338
219 3300009176 Ga0105242_10262289 Ga0105242_102622891 338
220 3300009176 Ga0105242_10287580 Ga0105242_102875801 338
221 3300009551 Ga0105238_10262427 Ga0105238_102624272 338
222 3300013104 Ga0157370_10378152 Ga0157370_103781521 338
223 3300013105 Ga0157369_10305576 Ga0157369_103055761 338
224 3300013105 Ga0157369_10331392 Ga0157369_103313921 338
225 3300013297 Ga0157378_10303451 Ga0157378_103034511 338
226 3300013306 Ga0163162_10294816 Ga0163162_102948161 338
227 3300013307 Ga0157372_10267203 Ga0157372_102672032 338
228 3300013308 Ga0157375_10212583 Ga0157375_102125832 338
229 3300014325 Ga0163163_10272294 Ga0163163_102722941 338
230 3300014326 Ga0157380_10147545 Ga0157380_101475451 338
231 3300014745 Ga0157377_10063188 Ga0157377_100631882 338
232 3300017792 Ga0163161_10095031 Ga0163161_100950311 338
233 3300025893 Ga0207682_10042967 Ga0207682_100429671 338
234 3300025899 Ga0207642_10096257 Ga0207642_100962571 338
235 3300025912 Ga0207707_10331228 Ga0207707_103312281 338
236 3300025919 Ga0207657_10125919 Ga0207657_101259191 338
237 3300025920 Ga0207649_10091949 Ga0207649_100919491 338
238 3300025921 Ga0207652_10152349 Ga0207652_101523492 338
239 3300025926 Ga0207659_10331763 Ga0207659_103317631 338
240 3300025932 Ga0207690_10212949 Ga0207690_102129492 338
241 3300025933 Ga0207706_10176162 Ga0207706_101761621 338
242 3300025934 Ga0207686_10109405 Ga0207686_101094052 338
243 3300025937 Ga0207669_10197690 Ga0207669_101976901 338
244 3300025938 Ga0207704_10120438 Ga0207704_101204381 338
245 3300025940 Ga0207691_10249003 Ga0207691_102490031 338
246 3300025942 Ga0207689_10168562 Ga0207689_101685621 338
247 3300025944 Ga0207661_10083285 Ga0207661_100832852 338
248 3300025945 Ga0207679_10000691 Ga0207679_1000069110 338
249 3300025960 Ga0207651_10219014 Ga0207651_102190141 338
250 3300026041 Ga0207639_10014998 Ga0207639_100149982 338
251 3300026041 Ga0207639_10249671 Ga0207639_102496712 338
252 3300026067 Ga0207678_10119707 Ga0207678_101197071 338
253 3300026067 Ga0207678_10189352 Ga0207678_101893522 338
254 3300026078 Ga0207702_10129713 Ga0207702_101297131 338
255 3300026089 Ga0207648_10205107 Ga0207648_102051071 338
256 3300026116 Ga0207674_10346547 Ga0207674_103465471 338
257 3300026118 Ga0207675_100326098 Ga0207675_1003260981 338
258 3300026121 Ga0207683_10143349 Ga0207683_101433492 338
259 3300028794 Ga0307515_10015185 Ga0307515_100151857 338
260 3300028794 Ga0307515_10238146 Ga0307515_102381461 338
261 3300031456 Ga0307513_10246121 Ga0307513_102461211 338
262 3300031456 Ga0307513_10289769 Ga0307513_102897691 338
263 3300031507 Ga0307509_10267780 Ga0307509_102677801 338
264 3300037471 Ga0395905_0306433 Ga0395905_0306433_384_1427 338
265 3300044901 Ga0466960_0172564 Ga0466960_0172564_22_1059 338
266 3300046474 Ga0495605_0048236 Ga0495605_0048236_757_1803 338
267 3300046512 Ga0495610_0064372 Ga0495610_0064372_82_1122 338
268 3300046512 Ga0495610_0090529 Ga0495610_0090529_246_1283 338
269 3300046519 Ga0495632_0076097 Ga0495632_0076097_424_1467 338
270 3300046520 Ga0495637_0017723 Ga0495637_0017723_1058_2098 338
271 3300046665 Ga0495661_0108288 Ga0495661_0108288_195_1241 338
272 3300046692 Ga0495671_0045052 Ga0495671_0045052_732_1772 338
273 3300049569 Ga0501032_0118820 Ga0501032_0118820_412_1476 338
274 3300049572 Ga0501036_0256018 Ga0501036_0256018_273_1337 338
275 3300049573 Ga0501037_0207844 Ga0501037_0207844_184_1248 338
276 3300049574 Ga0501038_0271420 Ga0501038_0271420_43_1107 338
277 3300049579 Ga0501043_0095580 Ga0501043_0095580_908_1972 338
278 3300049580 Ga0501046_0168427 Ga0501046_0168427_185_1249 338
279 3300049581 Ga0501047_0239203 Ga0501047_0239203_212_1276 338
280 3300049582 Ga0501048_0112295 Ga0501048_0112295_398_1462 338
281 3300049589 Ga0501073_0110086 Ga0501073_0110086_218_1282 338
282 3300049686 Ga0501257_027823 Ga0501257_027823_18_1061 338
283 3300049822 Ga0501035_0141980 Ga0501035_0141980_891_1955 338
284 3300049823 Ga0501044_0004181 Ga0501044_0004181_11178_12242 338
285 3300050511 nmdc:mga08y16_316842_c1 nmdc:mga08y16_316842_c1_345_1382 338
286 3300050513 nmdc:mga0rr50_311797_c1 nmdc:mga0rr50_311797_c1_151_1188 338
287 3300053088 Ga0500644_0024918 Ga0500644_0024918_529_1569 338
288 3300053125 Ga0500618_011971 Ga0500618_011971_403_1443 338
289 3300053129 Ga0500628_022469 Ga0500628_022469_219_1262 338
290 3300053150 Ga0500603_019242 Ga0500603_019242_301_1350 338
291 3300053159 Ga0500630_069854 Ga0500630_069854_386_1435 338
292 3300053178 Ga0500637_0120829 Ga0500637_0120829_154_1203 338
293 3300005328 Ga0070676_10113323 Ga0070676_101133231 339
294 3300005439 Ga0070711_100185048 Ga0070711_1001850482 339
295 3300005564 Ga0070664_100297501 Ga0070664_1002975011 339
296 3300005577 Ga0068857_100184680 Ga0068857_1001846801 339
297 3300006173 Ga0070716_100101971 Ga0070716_1001019712 339
298 3300025939 Ga0207665_10132368 Ga0207665_101323681 339
299 3300025945 Ga0207679_10185145 Ga0207679_101851452 339
300 3300026089 Ga0207648_10093805 Ga0207648_100938052 339
301 3300026116 Ga0207674_10205284 Ga0207674_102052841 339
302 3300031731 Ga0307405_10133352 Ga0307405_101333522 339
303 3300053160 Ga0500633_0000451 Ga0500633_0000451_3413_4468 339
304 3300053161 Ga0500634_0031836 Ga0500634_0031836_1020_2075 339
305 3300014969 Ga0157376_10462844 Ga0157376_104628441 340
306 3300025907 Ga0207645_10100326 Ga0207645_101003262 340
307 3300005539 Ga0068853_100186799 Ga0068853_1001867991 341
308 3300005578 Ga0068854_100228554 Ga0068854_1002285541 341
309 3300005616 Ga0068852_100139317 Ga0068852_1001393172 341
310 3300025981 Ga0207640_10213966 Ga0207640_102139662 341
311 3300026041 Ga0207639_10205080 Ga0207639_102050801 341
312 3300026142 Ga0207698_10225130 Ga0207698_102251301 341
313 3300031852 Ga0307410_10088558 Ga0307410_100885582 341
314 3300031911 Ga0307412_10291174 Ga0307412_102911741 341
315 3300002126 JGI24035J26624_1003358 JGI24035J26624_10033582 342
316 3300005367 Ga0070667_100174611 Ga0070667_1001746112 342
317 3300005617 Ga0068859_100067001 Ga0068859_1000670012 342
318 3300005843 Ga0068860_100009988 Ga0068860_1000099882 342
319 3300005844 Ga0068862_100267299 Ga0068862_1002672991 342
320 3300006931 Ga0097620_100067002 Ga0097620_1000670022 342
321 3300009553 Ga0105249_10021317 Ga0105249_100213174 342
322 3300009553 Ga0105249_10252442 Ga0105249_102524421 342
323 3300013306 Ga0163162_10369994 Ga0163162_103699941 342
324 3300025290 Ga0207673_1005216 Ga0207673_10052162 342
325 3300025315 Ga0207697_10032289 Ga0207697_100322892 342
326 3300025942 Ga0207689_10184530 Ga0207689_101845302 342
327 3300025961 Ga0207712_10010841 Ga0207712_100108413 342
328 3300025961 Ga0207712_10219719 Ga0207712_102197191 342
329 3300028380 Ga0268265_10082345 Ga0268265_100823453 342
330 3300028381 Ga0268264_10315090 Ga0268264_103150901 342
331 3300028794 Ga0307515_10200089 Ga0307515_102000892 342
332 3300053090 Ga0500646_0004398 Ga0500646_0004398_284_1336 342
333 3300053121 Ga0500607_068612 Ga0500607_068612_270_1322 342
334 3300053148 Ga0500590_088483 Ga0500590_088483_120_1172 342
335 3300046473 Ga0495582_0088768 Ga0495582_0088768_288_1340 343
336 3300046683 Ga0495658_0174922 Ga0495658_0174922_222_1274 343
337 3300047321 Ga0495676_0177466 Ga0495676_0177466_87_1139 343
338 3300048088 Ga0495602_0221277 Ga0495602_0221277_317_1369 343
339 3300049523 Ga0501300_006919 Ga0501300_006919_272_1333 343
340 3300005328 Ga0070676_10135399 Ga0070676_101353991 344
341 3300005331 Ga0070670_100211604 Ga0070670_1002116042 344
342 3300005354 Ga0070675_100204825 Ga0070675_1002048252 344
343 3300005355 Ga0070671_100202183 Ga0070671_1002021832 344
344 3300005456 Ga0070678_100254076 Ga0070678_1002540761 344
345 3300005564 Ga0070664_100188996 Ga0070664_1001889962 344
346 3300005577 Ga0068857_100288439 Ga0068857_1002884392 344
347 3300005617 Ga0068859_100205851 Ga0068859_1002058512 344
348 3300005617 Ga0068859_100472810 Ga0068859_1004728101 344
349 3300005841 Ga0068863_100367280 Ga0068863_1003672801 344
350 3300006237 Ga0097621_100346260 Ga0097621_1003462601 344
351 3300006358 Ga0068871_100301023 Ga0068871_1003010231 344
352 3300006931 Ga0097620_100205861 Ga0097620_1002058612 344
353 3300006931 Ga0097620_100472870 Ga0097620_1004728701 344
354 3300009094 Ga0111539_10538609 Ga0111539_105386091 344
355 3300009094 Ga0111539_10551560 Ga0111539_105515602 344
356 3300009101 Ga0105247_10183199 Ga0105247_101831992 344
357 3300009553 Ga0105249_10348019 Ga0105249_103480191 344
358 3300013100 Ga0157373_10074462 Ga0157373_100744621 344
359 3300013307 Ga0157372_10274196 Ga0157372_102741961 344
360 3300014326 Ga0157380_10180578 Ga0157380_101805781 344
361 3300014326 Ga0157380_10343686 Ga0157380_103436862 344
362 3300025926 Ga0207659_10272511 Ga0207659_102725111 344
363 3300025931 Ga0207644_10199329 Ga0207644_101993291 344
364 3300025933 Ga0207706_10189937 Ga0207706_101899372 344
365 3300026035 Ga0207703_10334216 Ga0207703_103342161 344
366 3300026041 Ga0207639_10265724 Ga0207639_102657241 344
367 3300026067 Ga0207678_10123703 Ga0207678_101237031 344
368 3300026088 Ga0207641_10121902 Ga0207641_101219021 344
369 3300028381 Ga0268264_10382134 Ga0268264_103821341 344
370 3300050511 nmdc:mga08y16_384013_c1 nmdc:mga08y16_384013_c1_73_1128 344
371 3300032004 Ga0307414_10115580 Ga0307414_101155801 345
372 3300046522 Ga0495643_0102549 Ga0495643_0102549_168_1235 346
373 3300047443 Ga0495687_066036 Ga0495687_066036_297_1364 346
374 3300053178 Ga0500637_0113607 Ga0500637_0113607_376_1443 346
375 3300005327 Ga0070658_10295445 Ga0070658_102954451 347
376 3300025909 Ga0207705_10304279 Ga0207705_103042791 347
377 3300046689 Ga0495613_0168970 Ga0495613_0168970_284_1348 347
378 3300048908 Ga0496105_0193700 Ga0496105_0193700_217_1371 347
379 3300001915 JGI24741J21665_1013513 JGI24741J21665_10135131 348
380 3300001979 JGI24740J21852_10044376 JGI24740J21852_100443761 348
381 3300005327 Ga0070658_10168301 Ga0070658_101683011 348
382 3300005329 Ga0070683_100101695 Ga0070683_1001016953 348
383 3300005329 Ga0070683_100282929 Ga0070683_1002829291 348
384 3300005330 Ga0070690_100189012 Ga0070690_1001890121 348
385 3300005331 Ga0070670_100150544 Ga0070670_1001505442 348
386 3300005335 Ga0070666_10128957 Ga0070666_101289572 348
387 3300005336 Ga0070680_100251750 Ga0070680_1002517502 348
388 3300005339 Ga0070660_100043127 Ga0070660_1000431271 348
389 3300005343 Ga0070687_100111837 Ga0070687_1001118371 348
390 3300005355 Ga0070671_100231331 Ga0070671_1002313312 348
391 3300005364 Ga0070673_100094184 Ga0070673_1000941841 348
392 3300005366 Ga0070659_100201027 Ga0070659_1002010272 348
393 3300005367 Ga0070667_100167599 Ga0070667_1001675991 348
394 3300005439 Ga0070711_100249959 Ga0070711_1002499592 348
395 3300005457 Ga0070662_100260205 Ga0070662_1002602051 348
396 3300005458 Ga0070681_10185413 Ga0070681_101854132 348
397 3300005530 Ga0070679_100328867 Ga0070679_1003288671 348
398 3300005535 Ga0070684_100125509 Ga0070684_1001255092 348
399 3300005539 Ga0068853_100046778 Ga0068853_1000467784 348
400 3300005544 Ga0070686_100125165 Ga0070686_1001251651 348
401 3300005546 Ga0070696_100132006 Ga0070696_1001320062 348
402 3300005547 Ga0070693_100171650 Ga0070693_1001716501 348
403 3300005563 Ga0068855_100296721 Ga0068855_1002967212 348
404 3300005577 Ga0068857_100059773 Ga0068857_1000597731 348
405 3300005578 Ga0068854_100207205 Ga0068854_1002072051 348
406 3300005834 Ga0068851_10048298 Ga0068851_100482982 348
407 3300005842 Ga0068858_100231490 Ga0068858_1002314902 348
408 3300006237 Ga0097621_100243282 Ga0097621_1002432822 348
409 3300013102 Ga0157371_10086630 Ga0157371_100866302 348
410 3300013104 Ga0157370_10014130 Ga0157370_100141301 348
411 3300013105 Ga0157369_10180532 Ga0157369_101805322 348
412 3300013296 Ga0157374_10250621 Ga0157374_102506211 348
413 3300013307 Ga0157372_10421692 Ga0157372_104216921 348
414 3300014745 Ga0157377_10140814 Ga0157377_101408141 348
415 3300014968 Ga0157379_10309764 Ga0157379_103097642 348
416 3300025321 Ga0207656_10036032 Ga0207656_100360321 348
417 3300025893 Ga0207682_10095912 Ga0207682_100959121 348
418 3300025903 Ga0207680_10167585 Ga0207680_101675851 348
419 3300025904 Ga0207647_10076447 Ga0207647_100764472 348
420 3300025912 Ga0207707_10319754 Ga0207707_103197541 348
421 3300025916 Ga0207663_10196856 Ga0207663_101968562 348
422 3300025917 Ga0207660_10255172 Ga0207660_102551721 348
423 3300025919 Ga0207657_10195095 Ga0207657_101950951 348
424 3300025920 Ga0207649_10213208 Ga0207649_102132081 348
425 3300025921 Ga0207652_10314669 Ga0207652_103146691 348
426 3300025925 Ga0207650_10305341 Ga0207650_103053411 348
427 3300025931 Ga0207644_10169237 Ga0207644_101692371 348
428 3300025932 Ga0207690_10240761 Ga0207690_102407611 348
429 3300025944 Ga0207661_10205727 Ga0207661_102057271 348
430 3300025945 Ga0207679_10303915 Ga0207679_103039151 348
431 3300025949 Ga0207667_10180942 Ga0207667_101809422 348
432 3300025981 Ga0207640_10277397 Ga0207640_102773971 348
433 3300025986 Ga0207658_10190312 Ga0207658_101903122 348
434 3300026023 Ga0207677_10266824 Ga0207677_102668241 348
435 3300026041 Ga0207639_10340891 Ga0207639_103408911 348
436 3300026078 Ga0207702_10378712 Ga0207702_103787121 348
437 3300026089 Ga0207648_10148710 Ga0207648_101487102 348
438 3300026095 Ga0207676_10369161 Ga0207676_103691611 348
439 3300026116 Ga0207674_10186004 Ga0207674_101860041 348
440 3300026142 Ga0207698_10255213 Ga0207698_102552131 348
441 3300026142 Ga0207698_10362371 Ga0207698_103623711 348
442 3300034817 Ga0373948_0019740 Ga0373948_0019740_84_1145 348
443 3300035088 Ga0373940_0038318 Ga0373940_0038318_201_1262 348
444 3300035092 Ga0373952_0023630 Ga0373952_0023630_231_1292 348
445 3300035114 Ga0373939_0063332 Ga0373939_0063332_107_1168 348
446 3300035121 Ga0373960_0016199 Ga0373960_0016199_350_1411 348
447 3300035691 Ga0373931_0066159 Ga0373931_0066159_742_1803 348
448 3300042876 Ga0451577_0152439 Ga0451577_0152439_878_1975 348
449 3300044712 Ga0453684_0292441 Ga0453684_0292441_691_1788 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

269

356

0.97

PF01548

DEDD_Tnp_IS110

Transposase

69

229

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j0k-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9756 135 201
8cwy-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9745 135 201
8cwy-assembly1.cif.gz_F accurate computational design of genetically encoded 3d protein crystals 0.9743 135 201
5j0k-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9628 135 201
6dkm-assembly3.cif.gz_F dhd131 0.9286 138 202
ID Description Score Start End Superfamily
1qsdA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9139 135 201 1.20.58.90
2q0oC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.9094 135 200 1.10.287.160
2q0oD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.9024 135 200 1.10.287.160
1x4tA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9016 139 197 1.10.287.660
4abmB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9007 135 198 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A7K1T204-F1-model_v4 Transposase 0.9774 137 243 GO:0003677
GO:0004803
GO:0006313
AF-A0A5J4PXR1-F1-model_v4 Transposase IS110-like N-terminal domain-containing protein 0.9624 7 95 GO:0003677
GO:0004803
GO:0006313
AF-A0A1I0UB53-F1-model_v4 Transposase 0.9606 1 154 GO:0003677
GO:0004803
GO:0006313
AF-A0A2M7PN33-F1-model_v4 IS110 family transposase 0.9587 150 329 GO:0003677
GO:0004803
GO:0006313
AF-A0A841EPN4-F1-model_v4 Transposase 0.9534 3 125 GO:0003677
GO:0004803
GO:0006313

Feature Viewer

pLDDT pTM Quality
87.43 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map