F446264

General Info

Members Datasets Scaffolds Average Seq Length
448 269 441 151

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0173598|Ga0530510_0173598_892_1419
Length 175
Sequence MLLRRRQLDGHPEADTNCSEHLMAKSRFVYVTYIRATPARLWQALIDPDFTRQYWAQTWQDCQWQPGASWKLMIPDGRVGDAGEVLEIEPRKRLVLSWRNEFKPELKAEGFSRLTYEFEEQGDMVKLSLAHEIDKPHSKLIEAVSTGWPLILASLKSLLETGESLEATRKWPEGM

Samples

Sample ID Description Type Environment
1 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
2 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
178 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
260 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 1.12
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0.45
Rhizoplane 4.02
Rhizosphere 81.92
Stem 0
Stem Tuber 0
Unclassified 6.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000001 3300002705 Bacteria 354557
2 JGI25154J39366_1000150 3300002738 Bacteria 54544
3 JGI25157J39369_1000044 3300002741 Bacteria 122466
4 JGI25406J46586_10002616 3300003203 Bacteria 8485
5 JGI25406J46586_10003312 3300003203 Bacteria 7583
6 JGI25406J46586_10006736 3300003203 Bacteria 5280
7 JGI25406J46586_10050535 3300003203 Bacteria 1396
8 JGI25165J46597_1001263 3300003214 Bacteria 14842
9 JGI25165J46597_1003016 3300003214 Bacteria 4616
10 rootH1_10083645 3300003316 Unclassified 2107
11 rootH1_10161079 3300003316 Bacteria 1519
12 rootH2_10050912 3300003320 Unclassified 4280
13 rootL2_10000624 3300003322 Bacteria 3503
14 rootH1_10038469 3300003323 Bacteria 3617
15 JGI25404J52841_10007233 3300003659 Bacteria 2344
16 Ga0055539_1000342 3300003752 Bacteria 20952
17 Ga0055533_1000061 3300003756 Bacteria 181542
18 Ga0055525_1001140 3300003759 Bacteria 6360
19 Ga0065704_10314728 3300005289 Bacteria 862
20 Ga0065707_10008421 3300005295 Bacteria 2356
21 Ga0065707_10199674 3300005295 Bacteria 1317
22 Ga0070658_10026701 3300005327 Bacteria 4634
23 Ga0070683_100277955 3300005329 Bacteria 1593
24 Ga0068869_100694320 3300005334 Bacteria 867
25 Ga0070666_10838733 3300005335 Bacteria 678
26 Ga0070680_100523686 3300005336 Bacteria 1015
27 Ga0068868_100414919 3300005338 Bacteria 1164
28 Ga0068868_101343604 3300005338 Bacteria 665
29 Ga0070660_100061696 3300005339 Bacteria 2911
30 Ga0070660_100242027 3300005339 Bacteria 1470
31 Ga0070661_100130758 3300005344 Bacteria 1885
32 Ga0070675_100309809 3300005354 Bacteria 1393
33 Ga0070673_101085863 3300005364 Bacteria 747
34 Ga0070659_100042877 3300005366 Bacteria 3538
35 Ga0070714_101178525 3300005435 Bacteria 747
36 Ga0070713_100015799 3300005436 Bacteria 5657
37 Ga0070713_100774191 3300005436 Bacteria 919
38 Ga0070710_10624889 3300005437 Unclassified 752
39 Ga0070700_100199152 3300005441 Bacteria 1406
40 Ga0070694_100202344 3300005444 Bacteria 1481
41 Ga0070663_100640517 3300005455 Bacteria 898
42 Ga0070681_10032125 3300005458 Bacteria 5268
43 Ga0070681_10108216 3300005458 Bacteria 2720
44 Ga0070681_10968745 3300005458 Bacteria 770
45 Ga0070707_100289675 3300005468 Bacteria 1591
46 Ga0070698_101523916 3300005471 Unclassified 620
47 Ga0070699_101077963 3300005518 Bacteria 737
48 Ga0070679_100098296 3300005530 Bacteria 2914
49 Ga0070679_100314439 3300005530 Bacteria 1516
50 Ga0070679_101310644 3300005530 Bacteria 670
51 Ga0070679_101433298 3300005530 Bacteria 637
52 Ga0070684_100603993 3300005535 Bacteria 1020
53 Ga0070684_101124600 3300005535 Bacteria 738
54 Ga0068853_100051615 3300005539 Bacteria 3540
55 Ga0070686_100310660 3300005544 Bacteria 1172
56 Ga0070696_100271192 3300005546 Bacteria 1290
57 Ga0070665_100003988 3300005548 Bacteria 15567
58 Ga0070665_101115132 3300005548 Bacteria 800
59 Ga0070665_101656952 3300005548 Bacteria 647
60 Ga0068855_100096948 3300005563 Bacteria 3397
61 Ga0068855_100373919 3300005563 Unclassified 1566
62 Ga0068855_101005581 3300005563 Bacteria 876
63 Ga0068854_100191454 3300005578 Bacteria 1603
64 Ga0068856_100013899 3300005614 Bacteria 7786
65 Ga0068852_100011029 3300005616 Bacteria 6782
66 Ga0068852_100031613 3300005616 Bacteria 4371
67 Ga0068852_100088607 3300005616 Bacteria 2764
68 Ga0068852_100329938 3300005616 Unclassified 1484
69 Ga0068852_100589231 3300005616 Unclassified 1115
70 Ga0068852_101233685 3300005616 Bacteria 769
71 Ga0068852_101251170 3300005616 Bacteria 764
72 Ga0068861_101395160 3300005719 Unclassified 684
73 Ga0068860_100039566 3300005843 Bacteria 4510
74 Ga0068862_100015837 3300005844 Bacteria 6264
75 Ga0068862_100651179 3300005844 Bacteria 1016
76 Ga0081540_1000734 3300005983 Bacteria 30203
77 Ga0081539_10000115 3300005985 Bacteria 188623
78 Ga0081539_10002346 3300005985 Bacteria 27215
79 Ga0081539_10063871 3300005985 Bacteria 2006
80 Ga0070717_10093619 3300006028 Bacteria 2540
81 Ga0070717_10221282 3300006028 Bacteria 1664
82 Ga0070717_10745852 3300006028 Bacteria 890
83 Ga0070717_11436583 3300006028 Bacteria 626
84 Ga0070712_100315878 3300006175 Bacteria 1269
85 Ga0075367_10492893 3300006178 Bacteria 777
86 Ga0075366_10028766 3300006195 Bacteria 3263
87 Ga0075366_10669653 3300006195 Bacteria 644
88 Ga0075428_100017957 3300006844 Bacteria 7817
89 Ga0075428_100291246 3300006844 Bacteria 1756
90 Ga0075428_100339626 3300006844 Bacteria 1613
91 Ga0075428_101084873 3300006844 Bacteria 846
92 Ga0075428_102613171 3300006844 Bacteria 516
93 Ga0075430_101338217 3300006846 Bacteria 589
94 Ga0075431_100050721 3300006847 Bacteria 4278
95 Ga0075431_101646254 3300006847 Bacteria 599
96 Ga0075433_11464999 3300006852 Unclassified 590
97 Ga0075429_101115069 3300006880 Bacteria 689
98 Ga0075429_101569007 3300006880 Bacteria 572
99 Ga0075436_101157645 3300006914 Bacteria 583
100 Ga0105240_10531553 3300009093 Bacteria 1303
101 Ga0105240_10740320 3300009093 Bacteria 1070
102 Ga0105240_11155407 3300009093 Bacteria 822
103 Ga0105240_11606658 3300009093 Unclassified 680
104 Ga0111539_10116600 3300009094 Bacteria 3131
105 Ga0111539_12607795 3300009094 Bacteria 586
106 Ga0105245_10848581 3300009098 Bacteria 953
107 Ga0105245_12305241 3300009098 Bacteria 592
108 Ga0105247_10240760 3300009101 Bacteria 1233
109 Ga0114129_10038387 3300009147 Bacteria 6756
110 Ga0114129_10844565 3300009147 Bacteria 1165
111 Ga0114129_10977506 3300009147 Bacteria 1067
112 Ga0105241_10032410 3300009174 Bacteria 3917
113 Ga0105241_11782941 3300009174 Bacteria 600
114 Ga0105242_11148040 3300009176 Unclassified 793
115 Ga0105237_10647996 3300009545 Bacteria 1063
116 Ga0105238_10248918 3300009551 Bacteria 1755
117 Ga0105238_10530649 3300009551 Bacteria 1180
118 Ga0105238_11011591 3300009551 Bacteria 852
119 Ga0105249_10822664 3300009553 Bacteria 993
120 Ga0105249_11059473 3300009553 Bacteria 880
121 Ga0105249_11330584 3300009553 Bacteria 790
122 Ga0105249_11851303 3300009553 Bacteria 676
123 Ga0105239_10002293 3300010375 Bacteria 24453
124 Ga0105239_11709670 3300010375 Bacteria 728
125 Ga0157316_1066636 3300012510 Unclassified 534
126 Ga0157373_10048527 3300013100 Bacteria 3027
127 Ga0157371_10014302 3300013102 Bacteria 5994
128 Ga0157370_10047239 3300013104 Bacteria 4127
129 Ga0157370_10307554 3300013104 Bacteria 1463
130 Ga0157370_10556983 3300013104 Bacteria 1051
131 Ga0157370_10621464 3300013104 Bacteria 988
132 Ga0157369_10116183 3300013105 Unclassified 2841
133 Ga0157369_10585047 3300013105 Bacteria 1153
134 Ga0157374_11418588 3300013296 Bacteria 717
135 Ga0157378_11301569 3300013297 Bacteria 768
136 Ga0163162_10776246 3300013306 Bacteria 1077
137 Ga0163162_10886431 3300013306 Bacteria 1006
138 Ga0163162_11025417 3300013306 Bacteria 933
139 Ga0163162_12226943 3300013306 Bacteria 629
140 Ga0157372_10658224 3300013307 Bacteria 1220
141 Ga0157372_12071792 3300013307 Bacteria 654
142 Ga0157375_10856663 3300013308 Bacteria 1055
143 Ga0182008_10065670 3300014497 Bacteria 1785
144 Ga0157379_10175257 3300014968 Bacteria 1936
145 Ga0157376_11593297 3300014969 Bacteria 687
146 Ga0213873_10050890 3300021358 Bacteria 1097
147 Ga0213872_10002925 3300021361 Bacteria 9699
148 Ga0213874_10412641 3300021377 Bacteria 527
149 Ga0213876_10000521 3300021384 Bacteria 29455
150 Ga0213876_10026589 3300021384 Bacteria 3052
151 Ga0224712_10429630 3300022467 Bacteria 632
152 Ga0209435_100012 3300025206 Bacteria 401621
153 Ga0209674_100003 3300025226 Bacteria 2196646
154 Ga0209672_102149 3300025228 Bacteria 5211
155 Ga0209563_100086 3300025230 Bacteria 182199
156 Ga0209437_100051 3300025233 Bacteria 392523
157 Ga0209646_1000026 3300025246 Bacteria 401621
158 Ga0209646_1005817 3300025246 Bacteria 2117
159 Ga0209026_1000014 3300025250 Bacteria 401621
160 Ga0209026_1019954 3300025250 Bacteria 1046
161 Ga0209677_100136 3300025253 Bacteria 68374
162 Ga0209759_1000012 3300025256 Bacteria 401621
163 Ga0209759_1010514 3300025256 Bacteria 2707
164 Ga0209233_1000069 3300025261 Bacteria 367639
165 Ga0209233_1000516 3300025261 Bacteria 22499
166 Ga0209455_1027766 3300025272 Bacteria 997
167 Ga0209758_1000548 3300025297 Bacteria 59657
168 Ga0207680_10697129 3300025903 Bacteria 728
169 Ga0207699_10761316 3300025906 Unclassified 711
170 Ga0207643_10131120 3300025908 Bacteria 1492
171 Ga0207705_10029791 3300025909 Bacteria 3890
172 Ga0207684_10451836 3300025910 Bacteria 1103
173 Ga0207707_10087119 3300025912 Bacteria 2729
174 Ga0207707_10130495 3300025912 Bacteria 2198
175 Ga0207707_10203789 3300025912 Bacteria 1724
176 Ga0207707_10206073 3300025912 Bacteria 1714
177 Ga0207695_10282434 3300025913 Bacteria 1554
178 Ga0207695_10447240 3300025913 Bacteria 1175
179 Ga0207695_10942558 3300025913 Bacteria 743
180 Ga0207695_11039425 3300025913 Unclassified 699
181 Ga0207693_10058462 3300025915 Bacteria 3020
182 Ga0207657_10294315 3300025919 Bacteria 1287
183 Ga0207649_10036964 3300025920 Bacteria 2946
184 Ga0207649_10075790 3300025920 Bacteria 2162
185 Ga0207652_10221168 3300025921 Bacteria 1706
186 Ga0207652_10584837 3300025921 Bacteria 1002
187 Ga0207652_10658075 3300025921 Bacteria 936
188 Ga0207652_11068969 3300025921 Bacteria 707
189 Ga0207681_10962224 3300025923 Unclassified 716
190 Ga0207694_10034791 3300025924 Bacteria 3863
191 Ga0207659_10279630 3300025926 Bacteria 1364
192 Ga0207700_10102823 3300025928 Bacteria 2283
193 Ga0207700_10135634 3300025928 Bacteria 2016
194 Ga0207700_10417903 3300025928 Bacteria 1177
195 Ga0207686_11129021 3300025934 Unclassified 640
196 Ga0207691_10416849 3300025940 Bacteria 1144
197 Ga0207711_10484702 3300025941 Bacteria 1152
198 Ga0207711_12010950 3300025941 Bacteria 521
199 Ga0207661_10733458 3300025944 Bacteria 909
200 Ga0207667_10003799 3300025949 Bacteria 18581
201 Ga0207667_10301734 3300025949 Bacteria 1636
202 Ga0207667_10585110 3300025949 Bacteria 1126
203 Ga0207651_10956797 3300025960 Bacteria 764
204 Ga0207712_10630782 3300025961 Unclassified 930
205 Ga0207640_11804855 3300025981 Unclassified 553
206 Ga0207678_10493465 3300026067 Bacteria 1067
207 Ga0207702_10040746 3300026078 Bacteria 3893
208 Ga0207702_11469325 3300026078 Bacteria 675
209 Ga0207641_10462862 3300026088 Bacteria 1227
210 Ga0207675_100569902 3300026118 Bacteria 1133
211 Ga0207698_10028267 3300026142 Bacteria 3996
212 Ga0207698_10034277 3300026142 Bacteria 3698
213 Ga0207698_10553510 3300026142 Unclassified 1128
214 Ga0209371_1000993 3300027312 Bacteria 21806
215 Ga0207428_10942354 3300027907 Bacteria 609
216 Ga0268266_10006425 3300028379 Bacteria 10766
217 Ga0268265_10005377 3300028380 Bacteria 8771
218 Ga0265334_10175472 3300028573 Bacteria 749
219 Ga0265338_10488290 3300028800 Bacteria 868
220 Ga0268256_1002635 3300030500 Bacteria 8896
221 Ga0307511_10248398 3300030521 Bacteria 858
222 Ga0265760_10020804 3300031090 Bacteria 1896
223 Ga0265760_10050593 3300031090 Bacteria 1251
224 Ga0265760_10151793 3300031090 Bacteria 760
225 Ga0265760_10206428 3300031090 Bacteria 665
226 Ga0265332_10309560 3300031238 Unclassified 652
227 Ga0265325_10068064 3300031241 Bacteria 1793
228 Ga0265325_10258743 3300031241 Bacteria 786
229 Ga0265325_10275015 3300031241 Bacteria 756
230 Ga0265340_10023434 3300031247 Bacteria 3148
231 Ga0265340_10087416 3300031247 Bacteria 1461
232 Ga0265340_10371106 3300031247 Bacteria 632
233 Ga0265340_10388687 3300031247 Bacteria 615
234 Ga0265339_10006936 3300031249 Bacteria 7371
235 Ga0265331_10000129 3300031250 Bacteria 99170
236 Ga0265331_10018059 3300031250 Bacteria 3665
237 Ga0265331_10057533 3300031250 Bacteria 1843
238 Ga0265331_10352842 3300031250 Unclassified 659
239 Ga0265327_10000105 3300031251 Bacteria 185022
240 Ga0265316_10007047 3300031344 Bacteria 10651
241 Ga0265316_10018379 3300031344 Bacteria 6008
242 Ga0265316_10145426 3300031344 Bacteria 1778
243 Ga0265316_10945593 3300031344 Unclassified 601
244 Ga0265313_10000522 3300031595 Bacteria 40272
245 Ga0265313_10026528 3300031595 Bacteria 3050
246 Ga0265313_10076839 3300031595 Bacteria 1525
247 Ga0265314_10001205 3300031711 Bacteria 29703
248 Ga0265314_10013382 3300031711 Bacteria 6629
249 Ga0265342_10034761 3300031712 Bacteria 3089
250 Ga0265342_10379123 3300031712 Bacteria 733
251 Ga0373934_0022708 3300035086 Bacteria 2420
252 Ga0373934_0040993 3300035086 Unclassified 1827
253 Ga0373944_0114733 3300035089 Bacteria 923
254 Ga0373923_0164569 3300035111 Bacteria 1013
255 Ga0373936_0337260 3300035113 Bacteria 685
256 Ga0373954_0003532 3300035118 Bacteria 6645
257 Ga0373956_0022445 3300035119 Unclassified 2701
258 Ga0373943_0109451 3300035170 Bacteria 1455
259 Ga0373955_0016767 3300035172 Unclassified 3611
260 Ga0373935_0591712 3300035692 Bacteria 811
261 Ga0373927_0685742 3300035695 Bacteria 677
262 Ga0373933_1113471 3300035724 Bacteria 520
263 Ga0373947_0002007 3300035725 Bacteria 12416
264 Ga0373937_0027764 3300036401 Bacteria 5120
265 Ga0373937_0286519 3300036401 Unclassified 1556
266 Ga0373937_0561261 3300036401 Bacteria 1084
267 Ga0373937_2155971 3300036401 Bacteria 503
268 Ga0373925_0002920 3300037068 Bacteria 13481
269 Ga0395899_0183702 3300037312 Bacteria 1466
270 Ga0395900_0873108 3300037418 Bacteria 824
271 Ga0395900_1243366 3300037418 Bacteria 659
272 Ga0395898_0191751 3300037466 Bacteria 1952
273 Ga0395905_0000697 3300037471 Bacteria 44516
274 Ga0436364_0271444 3300037853 Bacteria 1088
275 Ga0436364_0451868 3300037853 Bacteria 1113
276 Ga0395901_0274970 3300038443 Bacteria 1751
277 Ga0395901_0342782 3300038443 Bacteria 1543
278 Ga0395901_0911512 3300038443 Bacteria 860
279 Ga0395901_1428968 3300038443 Bacteria 649
280 Ga0395901_1785897 3300038443 Bacteria 564
281 Ga0436365_0229718 3300039437 Bacteria 2717
282 Ga0436365_1770052 3300039437 Bacteria 1249
283 Ga0436365_1935268 3300039437 Bacteria 135877
284 Ga0436360_0800111 3300039438 Bacteria 1478
285 Ga0436361_0471915 3300039447 Bacteria 5171
286 Ga0436363_1018978 3300039450 Bacteria 940
287 Ga0436363_1160420 3300039450 Unclassified 906
288 Ga0436362_0453478 3300039453 Bacteria 1222
289 Ga0451849_0058813 3300041505 Bacteria 635
290 Ga0439443_044882 3300042003 Bacteria 762
291 Ga0439435_0001130 3300042436 Bacteria 4761
292 Ga0439460_0156089 3300042461 Bacteria 763
293 Ga0451577_0371468 3300042876 Bacteria 1297
294 Ga0466969_0001050 3300044656 Bacteria 14907
295 Ga0453683_0091711 3300044673 Bacteria 1904
296 Ga0466965_0581749 3300044683 Bacteria 635
297 Ga0466966_0000221 3300044684 Bacteria 38296
298 Ga0466966_0045375 3300044684 Bacteria 2810
299 Ga0466963_0006519 3300044694 Bacteria 6913
300 Ga0466963_0546754 3300044694 Bacteria 818
301 Ga0466964_0192562 3300044706 Bacteria 974
302 Ga0466970_0000440 3300044765 Bacteria 20322
303 Ga0466957_0002771 3300044842 Bacteria 9481
304 Ga0466959_0000451 3300045049 Bacteria 23920
305 Ga0466959_0217992 3300045049 Bacteria 1324
306 Ga0451576_0766592 3300045051 Bacteria 1013
307 Ga0466958_0001687 3300045836 Bacteria 10648
308 Ga0466958_0037792 3300045836 Bacteria 2894
309 Ga0466967_0469726 3300045976 Bacteria 1231
310 Ga0466967_0964666 3300045976 Bacteria 849
311 Ga0466967_1343383 3300045976 Bacteria 712
312 Ga0495627_198912 3300046453 Bacteria 552
313 Ga0495651_0073769 3300046462 Unclassified 2590
314 Ga0495651_0163096 3300046462 Bacteria 1595
315 Ga0495580_0717129 3300046472 Bacteria 653
316 Ga0495583_0000073 3300046506 Bacteria 178177
317 Ga0495606_0001890 3300046507 Bacteria 26204
318 Ga0495628_0589505 3300046516 Bacteria 795
319 Ga0495645_0083043 3300046543 Bacteria 2297
320 Ga0495625_0027642 3300046660 Bacteria 4265
321 Ga0495671_0079847 3300046692 Bacteria 1603
322 Ga0495649_0000063 3300046694 Bacteria 96509
323 Ga0495589_0010399 3300046794 Bacteria 4834
324 Ga0495604_0000275 3300047317 Bacteria 45903
325 Ga0495672_0433868 3300047320 Bacteria 595
326 Ga0495681_0123070 3300047470 Bacteria 1111
327 Ga0495684_0022314 3300047471 Bacteria 4873
328 Ga0495602_0022181 3300048088 Bacteria 6223
329 Ga0496100_0322635 3300048903 Bacteria 1160
330 Ga0496101_0162537 3300048904 Bacteria 1713
331 Ga0496104_0015585 3300048907 Bacteria 6889
332 Ga0496105_0048570 3300048908 Bacteria 3503
333 Ga0496105_0569626 3300048908 Unclassified 882
334 Ga0496106_0496836 3300048909 Bacteria 980
335 Ga0496107_0352991 3300048910 Bacteria 1094
336 Ga0496107_0358960 3300048910 Bacteria 1084
337 Ga0496108_0256371 3300048911 Bacteria 1522
338 Ga0496108_0258246 3300048911 Unclassified 1516
339 Ga0496108_0321607 3300048911 Bacteria 1349
340 Ga0496109_0907680 3300048912 Bacteria 819
341 Ga0496110_0371036 3300048913 Bacteria 1304
342 Ga0496110_0652221 3300048913 Bacteria 952
343 Ga0496112_0423752 3300048915 Bacteria 1269
344 Ga0496112_1699089 3300048915 Bacteria 544
345 Ga0496114_0624393 3300048917 Unclassified 949
346 Ga0496115_0129310 3300048918 Bacteria 2081
347 Ga0496118_0348116 3300048921 Bacteria 791
348 Ga0496121_0077004 3300048924 Bacteria 2658
349 Ga0496126_0006117 3300048929 Bacteria 13496
350 Ga0496126_0858064 3300048929 Unclassified 692
351 Ga0501032_0076059 3300049569 Bacteria 2236
352 Ga0501032_0304861 3300049569 Bacteria 1029
353 Ga0501033_0045743 3300049570 Bacteria 3256
354 Ga0501034_0011139 3300049571 Bacteria 9331
355 Ga0501034_0125777 3300049571 Bacteria 2549
356 Ga0501036_0448403 3300049572 Bacteria 1075
357 Ga0501037_0225510 3300049573 Bacteria 1317
358 Ga0501038_0000593 3300049574 Bacteria 32116
359 Ga0501038_0087890 3300049574 Bacteria 2610
360 Ga0501038_0120412 3300049574 Bacteria 2165
361 Ga0501038_1048267 3300049574 Bacteria 597
362 Ga0501042_1016712 3300049578 Unclassified 604
363 Ga0501043_0040879 3300049579 Bacteria 3644
364 Ga0501043_0074236 3300049579 Bacteria 2671
365 Ga0501043_0079869 3300049579 Bacteria 2570
366 Ga0501043_0343713 3300049579 Bacteria 1135
367 Ga0501043_0771507 3300049579 Bacteria 697
368 Ga0501046_0059250 3300049580 Bacteria 3000
369 Ga0501046_0189340 3300049580 Bacteria 1535
370 Ga0501047_0043434 3300049581 Bacteria 4342
371 Ga0501047_0059027 3300049581 Bacteria 3705
372 Ga0501047_0099687 3300049581 Bacteria 2784
373 Ga0501047_0165540 3300049581 Bacteria 2081
374 Ga0501047_0647827 3300049581 Bacteria 876
375 Ga0501047_1154838 3300049581 Bacteria 588
376 Ga0501067_0004188 3300049583 Bacteria 7960
377 Ga0501068_0619467 3300049584 Bacteria 706
378 Ga0501069_0640391 3300049585 Bacteria 639
379 Ga0501070_0053797 3300049586 Bacteria 3338
380 Ga0501070_0104323 3300049586 Bacteria 2344
381 Ga0501070_0138171 3300049586 Bacteria 2012
382 Ga0501070_0361862 3300049586 Bacteria 1177
383 Ga0501070_0747856 3300049586 Unclassified 771
384 Ga0501073_0007220 3300049589 Bacteria 8272
385 Ga0501073_0056187 3300049589 Bacteria 2754
386 Ga0501073_0540011 3300049589 Bacteria 806
387 Ga0501073_0689765 3300049589 Bacteria 705
388 Ga0501073_1066002 3300049589 Bacteria 556
389 Ga0501074_0032160 3300049590 Bacteria 3801
390 Ga0501074_0217238 3300049590 Bacteria 1362
391 Ga0501075_0425226 3300049591 Bacteria 1013
392 Ga0501076_0132379 3300049592 Bacteria 2023
393 Ga0501079_0185521 3300049741 Unclassified 1624
394 Ga0501079_0569757 3300049741 Bacteria 891
395 Ga0501080_0038637 3300049742 Bacteria 4456
396 Ga0501080_0183692 3300049742 Bacteria 1923
397 Ga0501080_0199474 3300049742 Bacteria 1837
398 Ga0501080_0997984 3300049742 Bacteria 726
399 Ga0501083_0008696 3300049744 Bacteria 7161
400 Ga0501083_0183360 3300049744 Bacteria 1366
401 Ga0501083_0423041 3300049744 Bacteria 867
402 Ga0501083_0521363 3300049744 Bacteria 773
403 Ga0501035_1135744 3300049822 Bacteria 609
404 Ga0501044_0049325 3300049823 Bacteria 4346
405 Ga0501044_0090629 3300049823 Bacteria 3084
406 Ga0501044_0117739 3300049823 Bacteria 2660
407 Ga0501044_0223223 3300049823 Bacteria 1834
408 nmdc:mga0k408_347335_c1 3300050493 Bacteria 884
409 nmdc:mga06z11_321899_c1 3300050494 Bacteria 922
410 nmdc:mga05p37_1429291_c1 3300050507 Bacteria 694
411 nmdc:mga05p37_21381_c1 3300050507 Bacteria 7835
412 nmdc:mga05p37_707229_c1 3300050507 Bacteria 1118
413 nmdc:mga09592_1300527_c1 3300050508 Bacteria 598
414 nmdc:mga06r32_1247811_c1 3300050510 Bacteria 688
415 nmdc:mga06r32_17281_c1 3300050510 Bacteria 6585
416 nmdc:mga06r32_393831_c1 3300050510 Unclassified 1367
417 nmdc:mga08y16_1164165_c1 3300050511 Bacteria 743
418 nmdc:mga08y16_737502_c1 3300050511 Bacteria 982
419 nmdc:mga08x19_939083_c1 3300050514 Unclassified 614
420 Ga0495601_0001001 3300053077 Bacteria 15464
421 Ga0495601_0204532 3300053077 Archaea 1290
422 Ga0495619_0047222 3300053085 Bacteria 2834
423 Ga0495619_1050932 3300053085 Unclassified 543
424 Ga0500643_025816 3300053087 Bacteria 1848
425 Ga0500651_0244932 3300053093 Bacteria 1044
426 Ga0500566_0526373 3300053094 Bacteria 505
427 Ga0500608_118935 3300053122 Bacteria 1201
428 Ga0500559_0006228 3300053136 Bacteria 5401
429 Ga0500616_0039854 3300053153 Bacteria 2530
430 Ga0500638_178409 3300053162 Bacteria 919
431 Ga0500636_0006158 3300053177 Bacteria 6888
432 Ga0500636_0047230 3300053177 Bacteria 2536
433 Ga0500636_0098435 3300053177 Bacteria 1666
434 Ga0501084_0632262 3300054114 Bacteria 904
435 Ga0500661_018277 3300055283 Bacteria 1250
436 Ga0501082_0023045 3300060353 Bacteria 5367
437 Ga0501082_0024951 3300060353 Bacteria 5150
438 Ga0501082_0621593 3300060353 Bacteria 945
439 Ga0466962_0001807 3300061719 Bacteria 10069
440 Ga0466962_0111733 3300061719 Bacteria 1316
441 Ga0530510_0173598 3300061734 Unclassified 1597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100373919 Ga0068855_1003739191 130
2 3300005616 Ga0068852_100329938 Ga0068852_1003299383 130
3 3300013104 Ga0157370_10621464 Ga0157370_106214643 130
4 3300013105 Ga0157369_10116183 Ga0157369_101161834 130
5 3300025981 Ga0207640_11804855 Ga0207640_118048551 130
6 3300005441 Ga0070700_100199152 Ga0070700_1001991522 137
7 3300005844 Ga0068862_100015837 Ga0068862_1000158378 139
8 3300028380 Ga0268265_10005377 Ga0268265_100053778 139
9 3300049579 Ga0501043_0771507 Ga0501043_0771507_20_457 139
10 3300035089 Ga0373944_0114733 Ga0373944_0114733_474_911 140
11 3300005548 Ga0070665_101115132 Ga0070665_1011151321 141
12 3300025906 Ga0207699_10761316 Ga0207699_107613162 141
13 3300049591 Ga0501075_0425226 Ga0501075_0425226_300_743 141
14 3300053094 Ga0500566_0526373 Ga0500566_0526373_15_458 141
15 3300005563 Ga0068855_101005581 Ga0068855_1010055811 142
16 3300009093 Ga0105240_11155407 Ga0105240_111554072 142
17 3300025949 Ga0207667_10585110 Ga0207667_105851102 142
18 3300005336 Ga0070680_100523686 Ga0070680_1005236861 143
19 3300031250 Ga0265331_10000129 Ga0265331_1000012933 143
20 3300031344 Ga0265316_10007047 Ga0265316_100070476 143
21 3300031711 Ga0265314_10013382 Ga0265314_100133824 143
22 iso_pu_bacteria 2617270742 2617384740 143
23 iso_pu_bacteria 2775507266 2778175393 143
24 3300003214 JGI25165J46597_1003016 JGI25165J46597_10030163 144
25 3300005327 Ga0070658_10026701 Ga0070658_100267012 144
26 3300005339 Ga0070660_100061696 Ga0070660_1000616963 144
27 3300005344 Ga0070661_100130758 Ga0070661_1001307582 144
28 3300005366 Ga0070659_100042877 Ga0070659_1000428774 144
29 3300005455 Ga0070663_100640517 Ga0070663_1006405172 144
30 3300005458 Ga0070681_10968745 Ga0070681_109687451 144
31 3300005530 Ga0070679_101433298 Ga0070679_1014332981 144
32 3300005535 Ga0070684_100603993 Ga0070684_1006039931 144
33 3300005539 Ga0068853_100051615 Ga0068853_1000516154 144
34 3300005563 Ga0068855_100096948 Ga0068855_1000969482 144
35 3300005578 Ga0068854_100191454 Ga0068854_1001914542 144
36 3300005614 Ga0068856_100013899 Ga0068856_1000138992 144
37 3300005616 Ga0068852_100011029 Ga0068852_1000110295 144
38 3300005616 Ga0068852_100031613 Ga0068852_1000316134 144
39 3300006852 Ga0075433_11464999 Ga0075433_114649992 144
40 3300009093 Ga0105240_10531553 Ga0105240_105315531 144
41 3300009147 Ga0114129_10977506 Ga0114129_109775062 144
42 3300009174 Ga0105241_10032410 Ga0105241_100324105 144
43 3300009553 Ga0105249_10822664 Ga0105249_108226641 144
44 3300013100 Ga0157373_10048527 Ga0157373_100485273 144
45 3300013102 Ga0157371_10014302 Ga0157371_100143022 144
46 3300013104 Ga0157370_10307554 Ga0157370_103075541 144
47 3300013104 Ga0157370_10556983 Ga0157370_105569832 144
48 3300013307 Ga0157372_10658224 Ga0157372_106582242 144
49 3300025261 Ga0209233_1000516 Ga0209233_100051613 144
50 3300025909 Ga0207705_10029791 Ga0207705_100297911 144
51 3300025913 Ga0207695_10282434 Ga0207695_102824342 144
52 3300025920 Ga0207649_10036964 Ga0207649_100369642 144
53 3300025920 Ga0207649_10075790 Ga0207649_100757901 144
54 3300025949 Ga0207667_10003799 Ga0207667_1000379911 144
55 3300025949 Ga0207667_10301734 Ga0207667_103017342 144
56 3300025961 Ga0207712_10630782 Ga0207712_106307822 144
57 3300026067 Ga0207678_10493465 Ga0207678_104934651 144
58 3300026078 Ga0207702_10040746 Ga0207702_100407463 144
59 3300026078 Ga0207702_11469325 Ga0207702_114693251 144
60 3300026142 Ga0207698_10028267 Ga0207698_100282673 144
61 3300037312 Ga0395899_0183702 Ga0395899_0183702_57_491 144
62 3300037466 Ga0395898_0191751 Ga0395898_0191751_169_603 144
63 3300037471 Ga0395905_0000697 Ga0395905_0000697_10893_11327 144
64 3300038443 Ga0395901_0342782 Ga0395901_0342782_300_734 144
65 3300038443 Ga0395901_1428968 Ga0395901_1428968_83_517 144
66 3300044656 Ga0466969_0001050 Ga0466969_0001050_12087_12521 144
67 3300044673 Ga0453683_0091711 Ga0453683_0091711_1281_1724 144
68 3300044684 Ga0466966_0000221 Ga0466966_0000221_8686_9120 144
69 3300044706 Ga0466964_0192562 Ga0466964_0192562_333_767 144
70 3300044842 Ga0466957_0002771 Ga0466957_0002771_1796_2230 144
71 3300045049 Ga0466959_0000451 Ga0466959_0000451_21609_22043 144
72 3300045051 Ga0451576_0766592 Ga0451576_0766592_426_869 144
73 3300045836 Ga0466958_0001687 Ga0466958_0001687_9435_9869 144
74 3300048913 Ga0496110_0652221 Ga0496110_0652221_40_495 144
75 3300049569 Ga0501032_0076059 Ga0501032_0076059_1075_1509 144
76 3300049570 Ga0501033_0045743 Ga0501033_0045743_1535_1969 144
77 3300049571 Ga0501034_0125777 Ga0501034_0125777_976_1410 144
78 3300049573 Ga0501037_0225510 Ga0501037_0225510_589_1023 144
79 3300049574 Ga0501038_1048267 Ga0501038_1048267_34_468 144
80 3300049579 Ga0501043_0040879 Ga0501043_0040879_802_1236 144
81 3300049581 Ga0501047_0059027 Ga0501047_0059027_1784_2218 144
82 3300049583 Ga0501067_0004188 Ga0501067_0004188_5354_5788 144
83 3300049584 Ga0501068_0619467 Ga0501068_0619467_214_648 144
84 3300049586 Ga0501070_0104323 Ga0501070_0104323_1864_2298 144
85 3300049589 Ga0501073_0056187 Ga0501073_0056187_2110_2544 144
86 3300049589 Ga0501073_1066002 Ga0501073_1066002_102_536 144
87 3300049592 Ga0501076_0132379 Ga0501076_0132379_1484_1918 144
88 3300049741 Ga0501079_0569757 Ga0501079_0569757_388_822 144
89 3300049742 Ga0501080_0038637 Ga0501080_0038637_811_1245 144
90 3300049744 Ga0501083_0183360 Ga0501083_0183360_700_1134 144
91 3300049744 Ga0501083_0423041 Ga0501083_0423041_373_807 144
92 3300049744 Ga0501083_0521363 Ga0501083_0521363_321_755 144
93 3300049823 Ga0501044_0090629 Ga0501044_0090629_1514_1948 144
94 3300050507 nmdc:mga05p37_707229_c1 nmdc:mga05p37_707229_c1_521_964 144
95 3300060353 Ga0501082_0023045 Ga0501082_0023045_1452_1886 144
96 3300061719 Ga0466962_0001807 Ga0466962_0001807_412_846 144
97 3300061719 Ga0466962_0111733 Ga0466962_0111733_98_532 144
98 3300003316 rootH1_10083645 rootH1_100836451 145
99 3300009093 Ga0105240_11606658 Ga0105240_116066582 145
100 3300025913 Ga0207695_11039425 Ga0207695_110394251 145
101 3300031247 Ga0265340_10023434 Ga0265340_100234342 145
102 3300031247 Ga0265340_10388687 Ga0265340_103886871 145
103 3300031249 Ga0265339_10006936 Ga0265339_100069363 145
104 3300031344 Ga0265316_10018379 Ga0265316_100183796 145
105 3300031595 Ga0265313_10000522 Ga0265313_1000052231 145
106 3300031595 Ga0265313_10026528 Ga0265313_100265283 145
107 3300031712 Ga0265342_10034761 Ga0265342_100347611 145
108 3300037853 Ga0436364_0451868 Ga0436364_0451868_461_916 145
109 3300039437 Ga0436365_0229718 Ga0436365_0229718_1594_2049 145
110 3300039450 Ga0436363_1160420 Ga0436363_1160420_294_743 145
111 3300049569 Ga0501032_0304861 Ga0501032_0304861_512_952 145
112 3300049572 Ga0501036_0448403 Ga0501036_0448403_582_1022 145
113 3300049574 Ga0501038_0087890 Ga0501038_0087890_250_690 145
114 3300049574 Ga0501038_0120412 Ga0501038_0120412_171_611 145
115 3300049579 Ga0501043_0079869 Ga0501043_0079869_1495_1935 145
116 3300049579 Ga0501043_0343713 Ga0501043_0343713_274_714 145
117 3300049581 Ga0501047_0099687 Ga0501047_0099687_770_1210 145
118 3300049581 Ga0501047_0165540 Ga0501047_0165540_386_826 145
119 3300049586 Ga0501070_0747856 Ga0501070_0747856_184_624 145
120 3300049589 Ga0501073_0540011 Ga0501073_0540011_154_594 145
121 3300049590 Ga0501074_0217238 Ga0501074_0217238_844_1284 145
122 3300049742 Ga0501080_0997984 Ga0501080_0997984_141_581 145
123 3300049822 Ga0501035_1135744 Ga0501035_1135744_25_465 145
124 3300049823 Ga0501044_0117739 Ga0501044_0117739_2206_2646 145
125 3300049823 Ga0501044_0223223 Ga0501044_0223223_142_582 145
126 3300060353 Ga0501082_0621593 Ga0501082_0621593_358_798 145
127 3300003203 JGI25406J46586_10002616 JGI25406J46586_100026168 146
128 3300003203 JGI25406J46586_10006736 JGI25406J46586_100067364 146
129 3300005289 Ga0065704_10314728 Ga0065704_103147282 146
130 3300005295 Ga0065707_10008421 Ga0065707_100084211 146
131 3300005295 Ga0065707_10199674 Ga0065707_101996742 146
132 3300005338 Ga0068868_100414919 Ga0068868_1004149191 146
133 3300005435 Ga0070714_101178525 Ga0070714_1011785251 146
134 3300005437 Ga0070710_10624889 Ga0070710_106248891 146
135 3300005471 Ga0070698_101523916 Ga0070698_1015239161 146
136 3300005719 Ga0068861_101395160 Ga0068861_1013951601 146
137 3300005843 Ga0068860_100039566 Ga0068860_1000395666 146
138 3300005985 Ga0081539_10063871 Ga0081539_100638713 146
139 3300006028 Ga0070717_10745852 Ga0070717_107458522 146
140 3300006028 Ga0070717_11436583 Ga0070717_114365831 146
141 3300006175 Ga0070712_100315878 Ga0070712_1003158782 146
142 3300006846 Ga0075430_101338217 Ga0075430_1013382171 146
143 3300009098 Ga0105245_10848581 Ga0105245_108485812 146
144 3300009147 Ga0114129_10038387 Ga0114129_100383872 146
145 3300009176 Ga0105242_11148040 Ga0105242_111480402 146
146 3300009553 Ga0105249_11059473 Ga0105249_110594732 146
147 3300012510 Ga0157316_1066636 Ga0157316_10666361 146
148 3300013306 Ga0163162_10776246 Ga0163162_107762463 146
149 3300013306 Ga0163162_10886431 Ga0163162_108864311 146
150 3300021358 Ga0213873_10050890 Ga0213873_100508902 146
151 3300021361 Ga0213872_10002925 Ga0213872_100029258 146
152 3300021384 Ga0213876_10000521 Ga0213876_1000052117 146
153 3300025908 Ga0207643_10131120 Ga0207643_101311201 146
154 3300025923 Ga0207681_10962224 Ga0207681_109622241 146
155 3300025934 Ga0207686_11129021 Ga0207686_111290212 146
156 3300031247 Ga0265340_10023434 Ga0265340_100234343 146
157 3300031249 Ga0265339_10006936 Ga0265339_100069364 146
158 3300031250 Ga0265331_10018059 Ga0265331_100180594 146
159 3300031250 Ga0265331_10057533 Ga0265331_100575332 146
160 3300031251 Ga0265327_10000105 Ga0265327_100001054 146
161 3300031344 Ga0265316_10018379 Ga0265316_100183795 146
162 3300031595 Ga0265313_10000522 Ga0265313_1000052230 146
163 3300031595 Ga0265313_10076839 Ga0265313_100768392 146
164 3300031712 Ga0265342_10034761 Ga0265342_100347612 146
165 3300035111 Ga0373923_0164569 Ga0373923_0164569_336_791 146
166 3300035113 Ga0373936_0337260 Ga0373936_0337260_159_614 146
167 3300035170 Ga0373943_0109451 Ga0373943_0109451_811_1266 146
168 3300035692 Ga0373935_0591712 Ga0373935_0591712_77_532 146
169 3300035725 Ga0373947_0002007 Ga0373947_0002007_11242_11697 146
170 3300036401 Ga0373937_0286519 Ga0373937_0286519_1037_1492 146
171 3300036401 Ga0373937_0561261 Ga0373937_0561261_452_907 146
172 3300036401 Ga0373937_2155971 Ga0373937_2155971_34_489 146
173 3300037068 Ga0373925_0002920 Ga0373925_0002920_514_969 146
174 3300038443 Ga0395901_0274970 Ga0395901_0274970_475_954 146
175 3300039437 Ga0436365_1935268 Ga0436365_1935268_51640_52086 146
176 3300039438 Ga0436360_0800111 Ga0436360_0800111_921_1376 146
177 3300039447 Ga0436361_0471915 Ga0436361_0471915_4081_4536 146
178 3300039453 Ga0436362_0453478 Ga0436362_0453478_295_750 146
179 3300041505 Ga0451849_0058813 Ga0451849_0058813_87_545 146
180 3300044683 Ga0466965_0581749 Ga0466965_0581749_145_603 146
181 3300044694 Ga0466963_0546754 Ga0466963_0546754_240_698 146
182 3300045976 Ga0466967_0964666 Ga0466967_0964666_263_724 146
183 3300046462 Ga0495651_0163096 Ga0495651_0163096_421_876 146
184 3300046472 Ga0495580_0717129 Ga0495580_0717129_59_514 146
185 3300046516 Ga0495628_0589505 Ga0495628_0589505_269_739 146
186 3300046543 Ga0495645_0083043 Ga0495645_0083043_1078_1530 146
187 3300048924 Ga0496121_0077004 Ga0496121_0077004_1968_2414 146
188 3300049581 Ga0501047_1154838 Ga0501047_1154838_90_554 146
189 3300049589 Ga0501073_0007220 Ga0501073_0007220_3479_3943 146
190 3300049742 Ga0501080_0199474 Ga0501080_0199474_1085_1549 146
191 3300050507 nmdc:mga05p37_21381_c1 nmdc:mga05p37_21381_c1_338_787 146
192 3300053077 Ga0495601_0001001 Ga0495601_0001001_8102_8572 146
193 3300053085 Ga0495619_0047222 Ga0495619_0047222_294_764 146
194 3300053136 Ga0500559_0006228 Ga0500559_0006228_2839_3297 146
195 3300002705 JGI25156J39149_1000001 JGI25156J39149_100000163 147
196 3300002738 JGI25154J39366_1000150 JGI25154J39366_100015035 147
197 3300002741 JGI25157J39369_1000044 JGI25157J39369_100004463 147
198 3300003203 JGI25406J46586_10003312 JGI25406J46586_100033122 147
199 3300003203 JGI25406J46586_10050535 JGI25406J46586_100505353 147
200 3300003214 JGI25165J46597_1001263 JGI25165J46597_10012638 147
201 3300003316 rootH1_10161079 rootH1_101610794 147
202 3300003320 rootH2_10050912 rootH2_100509125 147
203 3300003322 rootL2_10000624 rootL2_100006244 147
204 3300003323 rootH1_10038469 rootH1_100384693 147
205 3300003659 JGI25404J52841_10007233 JGI25404J52841_100072332 147
206 3300003752 Ga0055539_1000342 Ga0055539_100034218 147
207 3300003756 Ga0055533_1000061 Ga0055533_100006192 147
208 3300003759 Ga0055525_1001140 Ga0055525_10011408 147
209 3300005329 Ga0070683_100277955 Ga0070683_1002779552 147
210 3300005334 Ga0068869_100694320 Ga0068869_1006943202 147
211 3300005335 Ga0070666_10838733 Ga0070666_108387331 147
212 3300005338 Ga0068868_101343604 Ga0068868_1013436041 147
213 3300005339 Ga0070660_100242027 Ga0070660_1002420272 147
214 3300005354 Ga0070675_100309809 Ga0070675_1003098092 147
215 3300005364 Ga0070673_101085863 Ga0070673_1010858632 147
216 3300005436 Ga0070713_100015799 Ga0070713_1000157997 147
217 3300005436 Ga0070713_100774191 Ga0070713_1007741912 147
218 3300005444 Ga0070694_100202344 Ga0070694_1002023441 147
219 3300005458 Ga0070681_10032125 Ga0070681_100321257 147
220 3300005458 Ga0070681_10108216 Ga0070681_101082162 147
221 3300005468 Ga0070707_100289675 Ga0070707_1002896752 147
222 3300005518 Ga0070699_101077963 Ga0070699_1010779632 147
223 3300005530 Ga0070679_100098296 Ga0070679_1000982961 147
224 3300005530 Ga0070679_100314439 Ga0070679_1003144393 147
225 3300005530 Ga0070679_101310644 Ga0070679_1013106441 147
226 3300005535 Ga0070684_101124600 Ga0070684_1011246001 147
227 3300005544 Ga0070686_100310660 Ga0070686_1003106602 147
228 3300005546 Ga0070696_100271192 Ga0070696_1002711921 147
229 3300005548 Ga0070665_100003988 Ga0070665_1000039884 147
230 3300005548 Ga0070665_101656952 Ga0070665_1016569521 147
231 3300005616 Ga0068852_100088607 Ga0068852_1000886073 147
232 3300005616 Ga0068852_100589231 Ga0068852_1005892312 147
233 3300005616 Ga0068852_101233685 Ga0068852_1012336852 147
234 3300005616 Ga0068852_101251170 Ga0068852_1012511702 147
235 3300005844 Ga0068862_100651179 Ga0068862_1006511792 147
236 3300005983 Ga0081540_1000734 Ga0081540_100073420 147
237 3300005985 Ga0081539_10000115 Ga0081539_10000115122 147
238 3300005985 Ga0081539_10002346 Ga0081539_1000234621 147
239 3300006028 Ga0070717_10093619 Ga0070717_100936195 147
240 3300006028 Ga0070717_10221282 Ga0070717_102212821 147
241 3300006178 Ga0075367_10492893 Ga0075367_104928931 147
242 3300006195 Ga0075366_10028766 Ga0075366_100287662 147
243 3300006195 Ga0075366_10669653 Ga0075366_106696531 147
244 3300006844 Ga0075428_100017957 Ga0075428_1000179579 147
245 3300006844 Ga0075428_100291246 Ga0075428_1002912465 147
246 3300006844 Ga0075428_100339626 Ga0075428_1003396263 147
247 3300006844 Ga0075428_101084873 Ga0075428_1010848732 147
248 3300006844 Ga0075428_102613171 Ga0075428_1026131711 147
249 3300006847 Ga0075431_100050721 Ga0075431_1000507214 147
250 3300006847 Ga0075431_101646254 Ga0075431_1016462541 147
251 3300006880 Ga0075429_101115069 Ga0075429_1011150691 147
252 3300006880 Ga0075429_101569007 Ga0075429_1015690072 147
253 3300006914 Ga0075436_101157645 Ga0075436_1011576451 147
254 3300009093 Ga0105240_10740320 Ga0105240_107403202 147
255 3300009094 Ga0111539_10116600 Ga0111539_101166002 147
256 3300009094 Ga0111539_12607795 Ga0111539_126077951 147
257 3300009098 Ga0105245_12305241 Ga0105245_123052411 147
258 3300009101 Ga0105247_10240760 Ga0105247_102407601 147
259 3300009147 Ga0114129_10844565 Ga0114129_108445653 147
260 3300009174 Ga0105241_11782941 Ga0105241_117829411 147
261 3300009545 Ga0105237_10647996 Ga0105237_106479962 147
262 3300009551 Ga0105238_10248918 Ga0105238_102489183 147
263 3300009551 Ga0105238_10530649 Ga0105238_105306493 147
264 3300009551 Ga0105238_11011591 Ga0105238_110115912 147
265 3300009553 Ga0105249_11330584 Ga0105249_113305842 147
266 3300009553 Ga0105249_11851303 Ga0105249_118513031 147
267 3300010375 Ga0105239_10002293 Ga0105239_1000229310 147
268 3300010375 Ga0105239_11709670 Ga0105239_117096702 147
269 3300013104 Ga0157370_10047239 Ga0157370_100472395 147
270 3300013105 Ga0157369_10585047 Ga0157369_105850471 147
271 3300013296 Ga0157374_11418588 Ga0157374_114185881 147
272 3300013297 Ga0157378_11301569 Ga0157378_113015692 147
273 3300013306 Ga0163162_11025417 Ga0163162_110254172 147
274 3300013306 Ga0163162_12226943 Ga0163162_122269431 147
275 3300013307 Ga0157372_12071792 Ga0157372_120717921 147
276 3300013308 Ga0157375_10856663 Ga0157375_108566632 147
277 3300014497 Ga0182008_10065670 Ga0182008_100656701 147
278 3300014968 Ga0157379_10175257 Ga0157379_101752572 147
279 3300014969 Ga0157376_11593297 Ga0157376_115932971 147
280 3300021377 Ga0213874_10412641 Ga0213874_104126411 147
281 3300021384 Ga0213876_10026589 Ga0213876_100265895 147
282 3300022467 Ga0224712_10429630 Ga0224712_104296302 147
283 3300025206 Ga0209435_100012 Ga0209435_100012321 147
284 3300025226 Ga0209674_100003 Ga0209674_100003146 147
285 3300025228 Ga0209672_102149 Ga0209672_1021494 147
286 3300025230 Ga0209563_100086 Ga0209563_10008693 147
287 3300025233 Ga0209437_100051 Ga0209437_100051349 147
288 3300025246 Ga0209646_1000026 Ga0209646_1000026321 147
289 3300025246 Ga0209646_1005817 Ga0209646_10058173 147
290 3300025250 Ga0209026_1000014 Ga0209026_1000014321 147
291 3300025250 Ga0209026_1019954 Ga0209026_10199541 147
292 3300025253 Ga0209677_100136 Ga0209677_10013633 147
293 3300025256 Ga0209759_1000012 Ga0209759_1000012321 147
294 3300025256 Ga0209759_1010514 Ga0209759_10105144 147
295 3300025261 Ga0209233_1000069 Ga0209233_10000698 147
296 3300025272 Ga0209455_1027766 Ga0209455_10277662 147
297 3300025297 Ga0209758_1000548 Ga0209758_100054822 147
298 3300025903 Ga0207680_10697129 Ga0207680_106971291 147
299 3300025910 Ga0207684_10451836 Ga0207684_104518362 147
300 3300025912 Ga0207707_10087119 Ga0207707_100871192 147
301 3300025912 Ga0207707_10130495 Ga0207707_101304952 147
302 3300025912 Ga0207707_10203789 Ga0207707_102037893 147
303 3300025912 Ga0207707_10206073 Ga0207707_102060732 147
304 3300025913 Ga0207695_10447240 Ga0207695_104472402 147
305 3300025913 Ga0207695_10942558 Ga0207695_109425582 147
306 3300025915 Ga0207693_10058462 Ga0207693_100584623 147
307 3300025919 Ga0207657_10294315 Ga0207657_102943152 147
308 3300025921 Ga0207652_10221168 Ga0207652_102211681 147
309 3300025921 Ga0207652_10584837 Ga0207652_105848372 147
310 3300025921 Ga0207652_10658075 Ga0207652_106580752 147
311 3300025921 Ga0207652_11068969 Ga0207652_110689691 147
312 3300025924 Ga0207694_10034791 Ga0207694_100347914 147
313 3300025926 Ga0207659_10279630 Ga0207659_102796303 147
314 3300025928 Ga0207700_10102823 Ga0207700_101028231 147
315 3300025928 Ga0207700_10135634 Ga0207700_101356341 147
316 3300025928 Ga0207700_10417903 Ga0207700_104179032 147
317 3300025940 Ga0207691_10416849 Ga0207691_104168492 147
318 3300025941 Ga0207711_10484702 Ga0207711_104847022 147
319 3300025941 Ga0207711_12010950 Ga0207711_120109501 147
320 3300025944 Ga0207661_10733458 Ga0207661_107334582 147
321 3300025960 Ga0207651_10956797 Ga0207651_109567972 147
322 3300026088 Ga0207641_10462862 Ga0207641_104628621 147
323 3300026118 Ga0207675_100569902 Ga0207675_1005699022 147
324 3300026142 Ga0207698_10034277 Ga0207698_100342772 147
325 3300026142 Ga0207698_10553510 Ga0207698_105535103 147
326 3300027312 Ga0209371_1000993 Ga0209371_100099314 147
327 3300027907 Ga0207428_10942354 Ga0207428_109423541 147
328 3300028379 Ga0268266_10006425 Ga0268266_100064255 147
329 3300028573 Ga0265334_10175472 Ga0265334_101754722 147
330 3300028800 Ga0265338_10488290 Ga0265338_104882902 147
331 3300030500 Ga0268256_1002635 Ga0268256_10026354 147
332 3300030521 Ga0307511_10248398 Ga0307511_102483981 147
333 3300031090 Ga0265760_10020804 Ga0265760_100208043 147
334 3300031090 Ga0265760_10050593 Ga0265760_100505932 147
335 3300031090 Ga0265760_10151793 Ga0265760_101517931 147
336 3300031090 Ga0265760_10206428 Ga0265760_102064282 147
337 3300031238 Ga0265332_10309560 Ga0265332_103095602 147
338 3300031241 Ga0265325_10068064 Ga0265325_100680642 147
339 3300031241 Ga0265325_10258743 Ga0265325_102587431 147
340 3300031241 Ga0265325_10275015 Ga0265325_102750152 147
341 3300031247 Ga0265340_10087416 Ga0265340_100874161 147
342 3300031247 Ga0265340_10371106 Ga0265340_103711062 147
343 3300031250 Ga0265331_10352842 Ga0265331_103528422 147
344 3300031344 Ga0265316_10145426 Ga0265316_101454263 147
345 3300031344 Ga0265316_10945593 Ga0265316_109455931 147
346 3300031711 Ga0265314_10001205 Ga0265314_1000120511 147
347 3300031712 Ga0265342_10379123 Ga0265342_103791232 147
348 3300035086 Ga0373934_0022708 Ga0373934_0022708_369_836 147
349 3300035086 Ga0373934_0040993 Ga0373934_0040993_938_1399 147
350 3300035118 Ga0373954_0003532 Ga0373954_0003532_4734_5195 147
351 3300035119 Ga0373956_0022445 Ga0373956_0022445_2211_2672 147
352 3300035172 Ga0373955_0016767 Ga0373955_0016767_1234_1695 147
353 3300035695 Ga0373927_0685742 Ga0373927_0685742_35_502 147
354 3300035724 Ga0373933_1113471 Ga0373933_1113471_29_472 147
355 3300036401 Ga0373937_0027764 Ga0373937_0027764_60_521 147
356 3300037418 Ga0395900_0873108 Ga0395900_0873108_219_686 147
357 3300037418 Ga0395900_1243366 Ga0395900_1243366_132_590 147
358 3300037853 Ga0436364_0271444 Ga0436364_0271444_31_492 147
359 3300038443 Ga0395901_0911512 Ga0395901_0911512_256_723 147
360 3300038443 Ga0395901_1785897 Ga0395901_1785897_79_540 147
361 3300039437 Ga0436365_1770052 Ga0436365_1770052_262_738 147
362 3300039450 Ga0436363_1018978 Ga0436363_1018978_370_870 147
363 3300042003 Ga0439443_044882 Ga0439443_044882_255_728 147
364 3300042436 Ga0439435_0001130 Ga0439435_0001130_626_1099 147
365 3300042461 Ga0439460_0156089 Ga0439460_0156089_212_685 147
366 3300042876 Ga0451577_0371468 Ga0451577_0371468_688_1161 147
367 3300044684 Ga0466966_0045375 Ga0466966_0045375_1550_1993 147
368 3300044694 Ga0466963_0006519 Ga0466963_0006519_4289_4732 147
369 3300044765 Ga0466970_0000440 Ga0466970_0000440_17170_17613 147
370 3300045049 Ga0466959_0217992 Ga0466959_0217992_258_701 147
371 3300045836 Ga0466958_0037792 Ga0466958_0037792_2426_2869 147
372 3300045976 Ga0466967_0469726 Ga0466967_0469726_643_1086 147
373 3300045976 Ga0466967_1343383 Ga0466967_1343383_217_693 147
374 3300046453 Ga0495627_198912 Ga0495627_198912_64_507 147
375 3300046462 Ga0495651_0073769 Ga0495651_0073769_597_1058 147
376 3300046506 Ga0495583_0000073 Ga0495583_0000073_54241_54708 147
377 3300046507 Ga0495606_0001890 Ga0495606_0001890_6934_7401 147
378 3300046660 Ga0495625_0027642 Ga0495625_0027642_3122_3589 147
379 3300046692 Ga0495671_0079847 Ga0495671_0079847_1072_1539 147
380 3300046694 Ga0495649_0000063 Ga0495649_0000063_26982_27449 147
381 3300046794 Ga0495589_0010399 Ga0495589_0010399_366_833 147
382 3300047317 Ga0495604_0000275 Ga0495604_0000275_43042_43503 147
383 3300047320 Ga0495672_0433868 Ga0495672_0433868_28_489 147
384 3300047470 Ga0495681_0123070 Ga0495681_0123070_404_847 147
385 3300047471 Ga0495684_0022314 Ga0495684_0022314_2066_2527 147
386 3300048088 Ga0495602_0022181 Ga0495602_0022181_893_1354 147
387 3300048903 Ga0496100_0322635 Ga0496100_0322635_192_704 147
388 3300048904 Ga0496101_0162537 Ga0496101_0162537_804_1316 147
389 3300048907 Ga0496104_0015585 Ga0496104_0015585_4629_5141 147
390 3300048908 Ga0496105_0048570 Ga0496105_0048570_1480_1941 147
391 3300048908 Ga0496105_0569626 Ga0496105_0569626_67_543 147
392 3300048909 Ga0496106_0496836 Ga0496106_0496836_214_726 147
393 3300048910 Ga0496107_0352991 Ga0496107_0352991_542_1003 147
394 3300048910 Ga0496107_0358960 Ga0496107_0358960_406_918 147
395 3300048911 Ga0496108_0256371 Ga0496108_0256371_270_782 147
396 3300048911 Ga0496108_0258246 Ga0496108_0258246_854_1330 147
397 3300048911 Ga0496108_0321607 Ga0496108_0321607_381_842 147
398 3300048912 Ga0496109_0907680 Ga0496109_0907680_26_487 147
399 3300048913 Ga0496110_0371036 Ga0496110_0371036_519_980 147
400 3300048915 Ga0496112_0423752 Ga0496112_0423752_553_1014 147
401 3300048915 Ga0496112_1699089 Ga0496112_1699089_20_481 147
402 3300048917 Ga0496114_0624393 Ga0496114_0624393_386_847 147
403 3300048918 Ga0496115_0129310 Ga0496115_0129310_1077_1589 147
404 3300048921 Ga0496118_0348116 Ga0496118_0348116_133_585 147
405 3300048929 Ga0496126_0006117 Ga0496126_0006117_10500_10952 147
406 3300048929 Ga0496126_0858064 Ga0496126_0858064_47_508 147
407 3300049571 Ga0501034_0011139 Ga0501034_0011139_6155_6616 147
408 3300049574 Ga0501038_0000593 Ga0501038_0000593_30878_31342 147
409 3300049578 Ga0501042_1016712 Ga0501042_1016712_88_594 147
410 3300049579 Ga0501043_0074236 Ga0501043_0074236_579_1043 147
411 3300049580 Ga0501046_0059250 Ga0501046_0059250_1683_2147 147
412 3300049580 Ga0501046_0189340 Ga0501046_0189340_357_818 147
413 3300049581 Ga0501047_0043434 Ga0501047_0043434_1442_1903 147
414 3300049581 Ga0501047_0647827 Ga0501047_0647827_99_560 147
415 3300049585 Ga0501069_0640391 Ga0501069_0640391_110_592 147
416 3300049586 Ga0501070_0053797 Ga0501070_0053797_1131_1595 147
417 3300049586 Ga0501070_0138171 Ga0501070_0138171_543_995 147
418 3300049586 Ga0501070_0361862 Ga0501070_0361862_86_556 147
419 3300049589 Ga0501073_0689765 Ga0501073_0689765_40_492 147
420 3300049590 Ga0501074_0032160 Ga0501074_0032160_2908_3372 147
421 3300049741 Ga0501079_0185521 Ga0501079_0185521_489_953 147
422 3300049742 Ga0501080_0183692 Ga0501080_0183692_614_1078 147
423 3300049744 Ga0501083_0008696 Ga0501083_0008696_4910_5374 147
424 3300049823 Ga0501044_0049325 Ga0501044_0049325_2834_3295 147
425 3300050493 nmdc:mga0k408_347335_c1 nmdc:mga0k408_347335_c1_373_846 147
426 3300050494 nmdc:mga06z11_321899_c1 nmdc:mga06z11_321899_c1_115_579 147
427 3300050507 nmdc:mga05p37_1429291_c1 nmdc:mga05p37_1429291_c1_219_683 147
428 3300050508 nmdc:mga09592_1300527_c1 nmdc:mga09592_1300527_c1_41_502 147
429 3300050510 nmdc:mga06r32_1247811_c1 nmdc:mga06r32_1247811_c1_166_627 147
430 3300050510 nmdc:mga06r32_17281_c1 nmdc:mga06r32_17281_c1_3295_3756 147
431 3300050510 nmdc:mga06r32_393831_c1 nmdc:mga06r32_393831_c1_26_487 147
432 3300050511 nmdc:mga08y16_1164165_c1 nmdc:mga08y16_1164165_c1_245_718 147
433 3300050511 nmdc:mga08y16_737502_c1 nmdc:mga08y16_737502_c1_88_561 147
434 3300050514 nmdc:mga08x19_939083_c1 nmdc:mga08x19_939083_c1_142_603 147
435 3300053077 Ga0495601_0204532 Ga0495601_0204532_493_996 147
436 3300053085 Ga0495619_1050932 Ga0495619_1050932_57_518 147
437 3300053087 Ga0500643_025816 Ga0500643_025816_24_485 147
438 3300053093 Ga0500651_0244932 Ga0500651_0244932_338_805 147
439 3300053122 Ga0500608_118935 Ga0500608_118935_331_798 147
440 3300053153 Ga0500616_0039854 Ga0500616_0039854_670_1131 147
441 3300053162 Ga0500638_178409 Ga0500638_178409_13_456 147
442 3300053177 Ga0500636_0006158 Ga0500636_0006158_4064_4531 147
443 3300053177 Ga0500636_0047230 Ga0500636_0047230_1521_2003 147
444 3300053177 Ga0500636_0098435 Ga0500636_0098435_1030_1473 147
445 3300054114 Ga0501084_0632262 Ga0501084_0632262_97_603 147
446 3300055283 Ga0500661_018277 Ga0500661_018277_634_1101 147
447 3300060353 Ga0501082_0024951 Ga0501082_0024951_295_759 147
448 3300061734 Ga0530510_0173598 Ga0530510_0173598_892_1419 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

35

160

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.9019 3 138
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.8967 5 138
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8942 3 140
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.847 3 143
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8439 4 138
ID Description Score Start End Superfamily
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8967 5 138 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8896 3 139 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8727 1 138 3.30.530.20
af_Q9P782_203_333_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8543 1 137 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8534 3 137 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A522M899-F1-model_v4 ATPase 1.001 2 145
AF-A0A5M8SN26-F1-model_v4 ATPase 0.9996 2 144
AF-A0A328XLI8-F1-model_v4 deleted 0.996 3 147
AF-A0A2U0ZTS4-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9947 2 147
AF-A0A829YGK2-F1-model_v4 ATPase 0.9932 3 143

Feature Viewer

pLDDT pTM Quality
95.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map