F446204

General Info

Members Datasets Scaffolds Average Seq Length
448 175 896 50

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0101384|Ga0395899_0101384_288_461
Length 57
Sequence MNVLLDLAVTVVSLAFLSILGVISGVALPGLFLAAAAPWLDWILPARDTRPTRDTRR

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
108 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
109 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
110 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
136 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
137 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 13.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0101384 3300037312 Unclassified 2078
2 Ga0070690_100725948 3300005330 Bacteria 765
3 Ga0070670_100943176 3300005331 Bacteria 783
4 Ga0070680_100018055 3300005336 Bacteria 5572
5 Ga0070680_101181299 3300005336 Bacteria 662
6 Ga0070689_100317480 3300005340 Bacteria 1300
7 Ga0070691_10348816 3300005341 Bacteria 821
8 Ga0070687_101055605 3300005343 Bacteria 592
9 Ga0070692_10522125 3300005345 Unclassified 773
10 Ga0070692_10969161 3300005345 Bacteria 593
11 Ga0070669_100249371 3300005353 Bacteria 1413
12 Ga0070669_100290665 3300005353 Unclassified 1312
13 Ga0070669_100507205 3300005353 Bacteria 1001
14 Ga0070669_100921952 3300005353 Bacteria 747
15 Ga0070673_101887408 3300005364 Bacteria 566
16 Ga0070688_100194165 3300005365 Bacteria 1416
17 Ga0070703_10376518 3300005406 Bacteria 612
18 Ga0070701_10113693 3300005438 Bacteria 1516
19 Ga0070705_100048634 3300005440 Bacteria 2458
20 Ga0070705_100199574 3300005440 Bacteria 1370
21 Ga0070705_100607465 3300005440 Unclassified 847
22 Ga0070705_101276512 3300005440 Bacteria 608
23 Ga0070694_100304290 3300005444 Bacteria 1222
24 Ga0070694_100358469 3300005444 Bacteria 1132
25 Ga0070694_100383857 3300005444 Bacteria 1096
26 Ga0070694_100708918 3300005444 Bacteria 819
27 Ga0070708_100003786 3300005445 Bacteria 11871
28 Ga0070708_100020484 3300005445 Bacteria 5576
29 Ga0070708_101164794 3300005445 Bacteria 721
30 Ga0070708_101282419 3300005445 Bacteria 684
31 Ga0070681_10552177 3300005458 Bacteria 1066
32 Ga0068867_100627011 3300005459 Bacteria 941
33 Ga0068867_100678075 3300005459 Bacteria 907
34 Ga0070706_100139697 3300005467 Bacteria 2261
35 Ga0070706_100183286 3300005467 Bacteria 1955
36 Ga0070706_100394959 3300005467 Bacteria 1287
37 Ga0070706_101040052 3300005467 Bacteria 755
38 Ga0070707_100009148 3300005468 Bacteria 9188
39 Ga0070707_100085657 3300005468 Bacteria 3046
40 Ga0070707_100091405 3300005468 Unclassified 2946
41 Ga0070707_101013307 3300005468 Unclassified 796
42 Ga0070707_101880995 3300005468 Bacteria 566
43 Ga0070698_100041363 3300005471 Bacteria 4731
44 Ga0070698_100923149 3300005471 Unclassified 819
45 Ga0070698_101115194 3300005471 Bacteria 737
46 Ga0070699_100004489 3300005518 Bacteria 12348
47 Ga0070699_100053460 3300005518 Bacteria 3495
48 Ga0070699_100079901 3300005518 Bacteria 2850
49 Ga0070699_101384994 3300005518 Bacteria 645
50 Ga0070679_100028469 3300005530 Bacteria 5509
51 Ga0070697_100009637 3300005536 Bacteria 7545
52 Ga0070697_100120122 3300005536 Bacteria 2198
53 Ga0070697_100596727 3300005536 Unclassified 970
54 Ga0070697_100738486 3300005536 Bacteria 869
55 Ga0070697_101351311 3300005536 Bacteria 636
56 Ga0070686_100566020 3300005544 Bacteria 891
57 Ga0070695_100011836 3300005545 Bacteria 5221
58 Ga0070695_100829379 3300005545 Bacteria 743
59 Ga0070696_100219119 3300005546 Bacteria 1427
60 Ga0070696_100884753 3300005546 Bacteria 740
61 Ga0070693_100143199 3300005547 Bacteria 1507
62 Ga0070704_100271211 3300005549 Bacteria 1402
63 Ga0070704_100679856 3300005549 Bacteria 911
64 Ga0070704_101991276 3300005549 Bacteria 539
65 Ga0070702_100749534 3300005615 Bacteria 750
66 Ga0068859_100063203 3300005617 Bacteria 3733
67 Ga0068859_100154234 3300005617 Bacteria 2373
68 Ga0068859_101280866 3300005617 Bacteria 808
69 Ga0068859_102009089 3300005617 Bacteria 638
70 Ga0068864_101203134 3300005618 Bacteria 756
71 Ga0068864_102065373 3300005618 Bacteria 576
72 Ga0068866_11437633 3300005718 Bacteria 505
73 Ga0068861_100507459 3300005719 Bacteria 1091
74 Ga0068870_10165915 3300005840 Bacteria 1314
75 Ga0068858_100360957 3300005842 Bacteria 1392
76 Ga0068858_101526167 3300005842 Bacteria 659
77 Ga0068862_100052398 3300005844 Bacteria 3491
78 Ga0068862_100435062 3300005844 Bacteria 1234
79 Ga0068862_100564812 3300005844 Unclassified 1088
80 Ga0068862_101820009 3300005844 Bacteria 618
81 Ga0081455_10257688 3300005937 Bacteria 1272
82 Ga0081540_1113572 3300005983 Bacteria 1139
83 Ga0081539_10000005 3300005985 Bacteria 549026
84 Ga0075432_10038894 3300006058 Bacteria 1658
85 Ga0075432_10047149 3300006058 Bacteria 1514
86 Ga0075428_100001770 3300006844 Bacteria 23067
87 Ga0075428_100037964 3300006844 Bacteria 5301
88 Ga0075428_100202920 3300006844 Bacteria 2143
89 Ga0075428_100245037 3300006844 Bacteria 1933
90 Ga0075428_100395921 3300006844 Bacteria 1480
91 Ga0075428_101792949 3300006844 Bacteria 639
92 Ga0075428_102022280 3300006844 Bacteria 597
93 Ga0075428_102061233 3300006844 Bacteria 590
94 Ga0075430_100000643 3300006846 Bacteria 26613
95 Ga0075430_100031030 3300006846 Bacteria 4538
96 Ga0075430_100100957 3300006846 Bacteria 2409
97 Ga0075430_100172266 3300006846 Bacteria 1801
98 Ga0075430_100176456 3300006846 Bacteria 1778
99 Ga0075430_100433035 3300006846 Unclassified 1085
100 Ga0075431_100000566 3300006847 Bacteria 31210
101 Ga0075431_100001354 3300006847 Bacteria 22438
102 Ga0075431_100001913 3300006847 Bacteria 19786
103 Ga0075431_100009868 3300006847 Bacteria 9587
104 Ga0075431_100022911 3300006847 Bacteria 6383
105 Ga0075431_100048948 3300006847 Bacteria 4359
106 Ga0075431_100239307 3300006847 Bacteria 1847
107 Ga0075431_100525151 3300006847 Unclassified 1173
108 Ga0075431_101200190 3300006847 Unclassified 721
109 Ga0075431_101303648 3300006847 Bacteria 687
110 Ga0075431_101735775 3300006847 Bacteria 581
111 Ga0075433_10000659 3300006852 Bacteria 23294
112 Ga0075433_10002564 3300006852 Bacteria 13833
113 Ga0075433_10115834 3300006852 Bacteria 2378
114 Ga0075433_10166358 3300006852 Unclassified 1963
115 Ga0075433_10227932 3300006852 Bacteria 1655
116 Ga0075433_10342040 3300006852 Bacteria 1322
117 Ga0075433_10347862 3300006852 Bacteria 1310
118 Ga0075433_10663789 3300006852 Unclassified 914
119 Ga0075433_11047999 3300006852 Bacteria 710
120 Ga0075433_11632348 3300006852 Bacteria 556
121 Ga0075434_100001544 3300006871 Bacteria 19489
122 Ga0075434_100068788 3300006871 Bacteria 3528
123 Ga0075434_100073947 3300006871 Bacteria 3401
124 Ga0075434_100150577 3300006871 Bacteria 2347
125 Ga0075434_100212423 3300006871 Bacteria 1955
126 Ga0075434_100259397 3300006871 Bacteria 1757
127 Ga0075434_100687834 3300006871 Bacteria 1040
128 Ga0075434_100813275 3300006871 Bacteria 950
129 Ga0075434_101098329 3300006871 Bacteria 809
130 Ga0075429_100002287 3300006880 Bacteria 16068
131 Ga0075429_100012441 3300006880 Bacteria 7384
132 Ga0075429_100031342 3300006880 Bacteria 4620
133 Ga0075429_100070191 3300006880 Bacteria 3050
134 Ga0075429_100091878 3300006880 Bacteria 2648
135 Ga0075429_100207499 3300006880 Bacteria 1717
136 Ga0075429_100224345 3300006880 Bacteria 1646
137 Ga0075429_100282545 3300006880 Bacteria 1453
138 Ga0075429_100666293 3300006880 Bacteria 912
139 Ga0068865_100440148 3300006881 Bacteria 1076
140 Ga0068865_100561440 3300006881 Bacteria 960
141 Ga0075436_100003846 3300006914 Bacteria 10293
142 Ga0075436_100028969 3300006914 Bacteria 3809
143 Ga0075436_100135485 3300006914 Bacteria 1729
144 Ga0097620_100063203 3300006931 Bacteria 3733
145 Ga0097620_100154240 3300006931 Bacteria 2373
146 Ga0097620_101280944 3300006931 Bacteria 808
147 Ga0097620_102008691 3300006931 Bacteria 638
148 Ga0075435_100038551 3300007076 Bacteria 3810
149 Ga0075435_100042019 3300007076 Bacteria 3656
150 Ga0075435_100135009 3300007076 Bacteria 2066
151 Ga0075435_100255041 3300007076 Bacteria 1493
152 Ga0075435_100266812 3300007076 Bacteria 1459
153 Ga0075435_101197442 3300007076 Unclassified 665
154 Ga0075435_101603920 3300007076 Bacteria 571
155 Ga0075435_101985506 3300007076 Unclassified 511
156 Ga0099794_10008476 3300007265 Bacteria 4271
157 Ga0099794_10092736 3300007265 Bacteria 1500
158 Ga0099794_10232704 3300007265 Unclassified 948
159 Ga0111539_10011135 3300009094 Bacteria 11314
160 Ga0111539_10787227 3300009094 Bacteria 1107
161 Ga0111539_11498604 3300009094 Bacteria 782
162 Ga0111539_12266193 3300009094 Unclassified 630
163 Ga0114129_10000018 3300009147 Bacteria 125757
164 Ga0114129_10000563 3300009147 Bacteria 45541
165 Ga0114129_10002375 3300009147 Bacteria 26134
166 Ga0114129_10017988 3300009147 Bacteria 10065
167 Ga0114129_10025346 3300009147 Bacteria 8403
168 Ga0114129_10025505 3300009147 Bacteria 8377
169 Ga0114129_10138232 3300009147 Bacteria 3342
170 Ga0114129_10188252 3300009147 Bacteria 2804
171 Ga0114129_10338838 3300009147 Bacteria 1995
172 Ga0114129_10534151 3300009147 Bacteria 1527
173 Ga0114129_10571443 3300009147 Unclassified 1468
174 Ga0114129_12203854 3300009147 Bacteria 663
175 Ga0105243_10740093 3300009148 Unclassified 963
176 Ga0105243_11718098 3300009148 Bacteria 657
177 Ga0105242_10481872 3300009176 Bacteria 1176
178 Ga0105249_10214909 3300009553 Bacteria 1889
179 Ga0105249_11443522 3300009553 Bacteria 760
180 Ga0105246_12381132 3300011119 Unclassified 519
181 Ga0157378_10105276 3300013297 Bacteria 2579
182 Ga0157378_10130384 3300013297 Bacteria 2327
183 Ga0157378_11697127 3300013297 Bacteria 679
184 Ga0157378_11985425 3300013297 Unclassified 631
185 Ga0163162_10644414 3300013306 Bacteria 1183
186 Ga0157375_12176051 3300013308 Unclassified 660
187 Ga0157380_10593728 3300014326 Bacteria 1094
188 Ga0157380_11987305 3300014326 Bacteria 643
189 Ga0207688_10965599 3300025901 Unclassified 539
190 Ga0207684_10003573 3300025910 Bacteria 15133
191 Ga0207684_10016060 3300025910 Bacteria 6429
192 Ga0207684_10023559 3300025910 Bacteria 5256
193 Ga0207684_10330608 3300025910 Bacteria 1313
194 Ga0207684_10881154 3300025910 Bacteria 753
195 Ga0207684_11608423 3300025910 Bacteria 526
196 Ga0207707_10536721 3300025912 Bacteria 995
197 Ga0207660_10014307 3300025917 Bacteria 5214
198 Ga0207662_10864839 3300025918 Bacteria 639
199 Ga0207652_10043739 3300025921 Bacteria 3814
200 Ga0207646_10001647 3300025922 Bacteria 27304
201 Ga0207646_10282323 3300025922 Bacteria 1500
202 Ga0207681_11560001 3300025923 Bacteria 553
203 Ga0207650_10787313 3300025925 Bacteria 806
204 Ga0207706_10444005 3300025933 Bacteria 1123
205 Ga0207686_10312575 3300025934 Bacteria 1171
206 Ga0207670_10540136 3300025936 Bacteria 951
207 Ga0207669_11630266 3300025937 Bacteria 551
208 Ga0207704_10634589 3300025938 Bacteria 878
209 Ga0207704_10660212 3300025938 Bacteria 862
210 Ga0207665_10750102 3300025939 Bacteria 769
211 Ga0207689_11270318 3300025942 Bacteria 619
212 Ga0207677_11462557 3300026023 Bacteria 630
213 Ga0207703_10653744 3300026035 Bacteria 997
214 Ga0207703_10907019 3300026035 Unclassified 844
215 Ga0207708_10985656 3300026075 Bacteria 732
216 Ga0207648_10070602 3300026089 Bacteria 3045
217 Ga0207676_11196520 3300026095 Bacteria 753
218 Ga0207675_100393363 3300026118 Bacteria 1365
219 Ga0207675_100636125 3300026118 Bacteria 1072
220 Ga0209996_1020619 3300027395 Unclassified 925
221 Ga0210000_1060172 3300027462 Unclassified 615
222 Ga0209983_1011414 3300027665 Bacteria 1818
223 Ga0209588_1021939 3300027671 Bacteria 2008
224 Ga0209588_1082899 3300027671 Bacteria 1035
225 Ga0209971_1184458 3300027682 Unclassified 514
226 Ga0209966_1030203 3300027695 Bacteria 1095
227 Ga0209998_10014523 3300027717 Bacteria 1644
228 Ga0209974_10338521 3300027876 Unclassified 582
229 Ga0207428_10137381 3300027907 Bacteria 1868
230 Ga0268265_10034781 3300028380 Bacteria 3676
231 Ga0268265_12136939 3300028380 Unclassified 567
232 Ga0268265_12420331 3300028380 Bacteria 531
233 Ga0268264_11185655 3300028381 Bacteria 773
234 Ga0268264_12216488 3300028381 Unclassified 557
235 Ga0307408_100013027 3300031548 Bacteria 5515
236 Ga0307408_100036656 3300031548 Bacteria 3449
237 Ga0307408_100155598 3300031548 Bacteria 1810
238 Ga0307408_100293360 3300031548 Bacteria 1359
239 Ga0307408_100329047 3300031548 Bacteria 1290
240 Ga0307408_100457222 3300031548 Bacteria 1109
241 Ga0307408_100457263 3300031548 Bacteria 1109
242 Ga0307405_11770003 3300031731 Bacteria 549
243 Ga0307410_10354007 3300031852 Bacteria 1174
244 Ga0307410_10387376 3300031852 Bacteria 1126
245 Ga0307406_10168323 3300031901 Bacteria 1583
246 Ga0307406_10865596 3300031901 Bacteria 767
247 Ga0307406_12131773 3300031901 Unclassified 503
248 Ga0307407_10890112 3300031903 Bacteria 682
249 Ga0307412_10093064 3300031911 Bacteria 2114
250 Ga0307412_10423760 3300031911 Bacteria 1089
251 Ga0307409_100435799 3300031995 Bacteria 1261
252 Ga0307409_101136166 3300031995 Bacteria 803
253 Ga0307409_101184095 3300031995 Bacteria 787
254 Ga0307416_101186277 3300032002 Bacteria 869
255 Ga0307416_102132794 3300032002 Bacteria 662
256 Ga0307416_102844835 3300032002 Bacteria 579
257 Ga0307414_10290134 3300032004 Bacteria 1379
258 Ga0307414_11768153 3300032004 Bacteria 577
259 Ga0307411_10213622 3300032005 Bacteria 1491
260 Ga0307415_101636773 3300032126 Bacteria 619
261 Ga0307415_101657166 3300032126 Bacteria 616
262 Ga0373948_0049042 3300034817 Bacteria 903
263 Ga0373959_0130205 3300034820 Unclassified 622
264 Ga0373928_0024720 3300035084 Bacteria 1290
265 Ga0373929_0083876 3300035085 Bacteria 781
266 Ga0373951_0102837 3300035091 Unclassified 761
267 Ga0373951_0250120 3300035091 Bacteria 532
268 Ga0373932_0342563 3300035112 Bacteria 567
269 Ga0373942_0152544 3300035207 Bacteria 743
270 Ga0373961_0236758 3300035241 Bacteria 656
271 Ga0373931_0003124 3300035691 Bacteria 7398
272 Ga0395900_0182149 3300037418 Unclassified 2134
273 Ga0395900_0784320 3300037418 Bacteria 882
274 Ga0395905_0043593 3300037471 Unclassified 4209
275 Ga0395905_0469077 3300037471 Bacteria 1158
276 Ga0395901_1116584 3300038443 Bacteria 758
277 Ga0242420_011467 3300038996 Bacteria 1488
278 Ga0451577_0262371 3300042876 Bacteria 1564
279 Ga0451577_0550233 3300042876 Bacteria 1048
280 Ga0451577_1885763 3300042876 Unclassified 523
281 Ga0453683_0035653 3300044673 Bacteria 3134
282 Ga0453683_0842678 3300044673 Bacteria 605
283 Ga0453684_1743927 3300044712 Bacteria 635
284 Ga0451576_0049265 3300045051 Bacteria 4421
285 Ga0451576_0884917 3300045051 Unclassified 937
286 Ga0451576_1117290 3300045051 Bacteria 824
287 Ga0495584_0376364 3300046491 Bacteria 721
288 Ga0495642_0193517 3300046528 Bacteria 886
289 Ga0495611_0523460 3300046648 Unclassified 538
290 Ga0495659_0033320 3300046664 Bacteria 1808
291 Ga0495669_0152505 3300046684 Bacteria 1094
292 Ga0495636_0410095 3300047318 Bacteria 646
293 Ga0496102_0007507 3300048905 Bacteria 9325
294 Ga0496107_0436558 3300048910 Unclassified 973
295 Ga0496109_1750537 3300048912 Bacteria 555
296 Ga0496110_0850107 3300048913 Bacteria 818
297 Ga0496113_1192018 3300048916 Bacteria 595
298 Ga0501291_068858 3300049514 Bacteria 682
299 Ga0501298_173379 3300049521 Bacteria 538
300 Ga0501299_041218 3300049522 Bacteria 927
301 Ga0501031_0039630 3300049568 Bacteria 3075
302 Ga0501031_0540131 3300049568 Bacteria 751
303 Ga0501031_0582571 3300049568 Unclassified 720
304 Ga0501032_0856451 3300049569 Unclassified 573
305 Ga0501033_0288083 3300049570 Bacteria 1158
306 Ga0501033_1204310 3300049570 Bacteria 501
307 Ga0501036_0075459 3300049572 Bacteria 2851
308 Ga0501036_0611727 3300049572 Unclassified 903
309 Ga0501038_0059486 3300049574 Bacteria 3273
310 Ga0501038_0558432 3300049574 Bacteria 870
311 Ga0501039_0240619 3300049575 Bacteria 1423
312 Ga0501039_0354114 3300049575 Bacteria 1153
313 Ga0501040_0035562 3300049576 Bacteria 3378
314 Ga0501040_0078481 3300049576 Bacteria 2285
315 Ga0501040_0080302 3300049576 Bacteria 2259
316 Ga0501041_0287934 3300049577 Unclassified 1034
317 Ga0501041_0301638 3300049577 Unclassified 1009
318 Ga0501042_0016548 3300049578 Bacteria 5064
319 Ga0501042_0037355 3300049578 Bacteria 3448
320 Ga0501042_0315887 3300049578 Bacteria 1129
321 Ga0501042_1260030 3300049578 Unclassified 539
322 Ga0501046_0052211 3300049580 Bacteria 3222
323 Ga0501046_0658159 3300049580 Unclassified 740
324 Ga0501048_0029868 3300049582 Bacteria 3947
325 Ga0501067_0396830 3300049583 Bacteria 769
326 Ga0501068_0018421 3300049584 Bacteria 4044
327 Ga0501068_0331208 3300049584 Bacteria 977
328 Ga0501068_1070660 3300049584 Bacteria 533
329 Ga0501070_0906680 3300049586 Bacteria 687
330 Ga0501071_0023865 3300049587 Bacteria 4274
331 Ga0501071_0076780 3300049587 Bacteria 2440
332 Ga0501072_0085264 3300049588 Bacteria 2505
333 Ga0501072_0819509 3300049588 Unclassified 728
334 Ga0501074_0087945 3300049590 Bacteria 2225
335 Ga0501074_0193853 3300049590 Bacteria 1448
336 Ga0501074_0431187 3300049590 Bacteria 935
337 Ga0501075_0027969 3300049591 Bacteria 4158
338 Ga0501075_0029635 3300049591 Bacteria 4048
339 Ga0501075_0323091 3300049591 Bacteria 1176
340 Ga0501075_0440730 3300049591 Bacteria 993
341 Ga0501076_0033654 3300049592 Bacteria 4002
342 Ga0501076_0035452 3300049592 Bacteria 3903
343 Ga0501076_0149775 3300049592 Bacteria 1898
344 Ga0501077_0079068 3300049593 Bacteria 2083
345 Ga0501077_0611430 3300049593 Unclassified 700
346 Ga0501079_0030659 3300049741 Bacteria 4133
347 Ga0501079_0069713 3300049741 Bacteria 2714
348 Ga0501079_0081869 3300049741 Bacteria 2496
349 Ga0501079_0926759 3300049741 Unclassified 686
350 Ga0501079_1019910 3300049741 Unclassified 652
351 Ga0501080_0054897 3300049742 Bacteria 3710
352 Ga0501080_0447052 3300049742 Bacteria 1159
353 Ga0501081_0001313 3300049743 Bacteria 15163
354 Ga0501081_0056765 3300049743 Bacteria 2706
355 Ga0501081_0081450 3300049743 Bacteria 2267
356 Ga0501081_0146508 3300049743 Bacteria 1695
357 Ga0501081_0561561 3300049743 Bacteria 853
358 Ga0501083_0124138 3300049744 Bacteria 1693
359 Ga0501083_0365488 3300049744 Unclassified 938
360 Ga0501083_0860612 3300049744 Bacteria 590
361 Ga0501035_0113315 3300049822 Bacteria 2376
362 Ga0501035_0998804 3300049822 Bacteria 658
363 Ga0501045_0027588 3300049824 Bacteria 4093
364 Ga0501045_0033520 3300049824 Bacteria 3724
365 Ga0501045_0144858 3300049824 Bacteria 1767
366 Ga0501045_0146956 3300049824 Bacteria 1754
367 nmdc:mga05p37_116532_c1 3300050507 Bacteria 3283
368 nmdc:mga05p37_1251982_c1 3300050507 Bacteria 761
369 nmdc:mga05p37_1327371_c1 3300050507 Bacteria 731
370 nmdc:mga05p37_1393909_c1 3300050507 Bacteria 706
371 nmdc:mga05p37_205_c1 3300050507 Bacteria 59326
372 nmdc:mga05p37_212845_c1 3300050507 Bacteria 2336
373 nmdc:mga05p37_260261_c1 3300050507 Bacteria 2077
374 nmdc:mga05p37_272789_c1 3300050507 Bacteria 2020
375 nmdc:mga05p37_4284_c1 3300050507 Bacteria 16663
376 nmdc:mga05p37_486_c1 3300050507 Bacteria 43514
377 nmdc:mga05p37_59214_c1 3300050507 Bacteria 4717
378 nmdc:mga05p37_84842_c1 3300050507 Bacteria 3902
379 nmdc:mga05p37_88967_c1 3300050507 Bacteria 3806
380 nmdc:mga09592_10626_c1 3300050508 Bacteria 7497
381 nmdc:mga09592_11106_c1 3300050508 Bacteria 7326
382 nmdc:mga09592_138251_c1 3300050508 Bacteria 2099
383 nmdc:mga09592_14556_c1 3300050508 Bacteria 6420
384 nmdc:mga09592_1671545_c1 3300050508 Unclassified 514
385 nmdc:mga09592_17309_c1 3300050508 Bacteria 5904
386 nmdc:mga09592_23342_c1 3300050508 Bacteria 5109
387 nmdc:mga09592_32995_c2 3300050508 Bacteria 2939
388 nmdc:mga09592_654729_c1 3300050508 Bacteria 897
389 nmdc:mga0qj67_1243435_c1 3300050509 Unclassified 578
390 nmdc:mga0qj67_209829_c1 3300050509 Bacteria 1582
391 nmdc:mga0qj67_27168_c1 3300050509 Bacteria 4432
392 nmdc:mga0qj67_28254_c1 3300050509 Bacteria 4353
393 nmdc:mga0qj67_29195_c1 3300050509 Bacteria 4283
394 nmdc:mga0qj67_50200_c1 3300050509 Bacteria 3298
395 nmdc:mga0qj67_81673_c1 3300050509 Bacteria 2592
396 nmdc:mga06r32_1048917_c1 3300050510 Bacteria 766
397 nmdc:mga06r32_1225009_c1 3300050510 Bacteria 696
398 nmdc:mga06r32_1636715_c1 3300050510 Bacteria 582
399 nmdc:mga06r32_16814_c1 3300050510 Bacteria 6670
400 nmdc:mga06r32_2084637_c1 3300050510 Bacteria 500
401 nmdc:mga06r32_259197_c1 3300050510 Bacteria 1727
402 nmdc:mga06r32_26079_c1 3300050510 Bacteria 5445
403 nmdc:mga06r32_295791_c1 3300050510 Bacteria 1605
404 nmdc:mga06r32_314860_c1 3300050510 Bacteria 1551
405 nmdc:mga06r32_421781_c1 3300050510 Bacteria 1315
406 nmdc:mga06r32_4515_c1 3300050510 Bacteria 12470
407 nmdc:mga06r32_515592_c1 3300050510 Bacteria 1172
408 nmdc:mga06r32_53435_c1 3300050510 Bacteria 3870
409 nmdc:mga06r32_600015_c1 3300050510 Unclassified 1072
410 nmdc:mga08y16_1058583_c1 3300050511 Bacteria 788
411 nmdc:mga08y16_240969_c1 3300050511 Bacteria 1869
412 nmdc:mga08y16_53100_c1 3300050511 Bacteria 4239
413 nmdc:mga0n895_171095_c1 3300050512 Bacteria 2204
414 nmdc:mga0n895_19373_c1 3300050512 Bacteria 6324
415 nmdc:mga0n895_247143_c1 3300050512 Unclassified 1811
416 nmdc:mga0n895_25965_c1 3300050512 Bacteria 5540
417 nmdc:mga0n895_48183_c1 3300050512 Bacteria 4170
418 nmdc:mga0n895_59080_c1 3300050512 Bacteria 3784
419 nmdc:mga0n895_69815_c1 3300050512 Bacteria 3481
420 nmdc:mga0n895_903147_c1 3300050512 Bacteria 869
421 nmdc:mga0rr50_113776_c1 3300050513 Bacteria 2145
422 nmdc:mga0rr50_12795_c1 3300050513 Bacteria 5437
423 nmdc:mga0rr50_482394_c1 3300050513 Bacteria 1053
424 nmdc:mga0rr50_57564_c1 3300050513 Bacteria 2908
425 nmdc:mga0rr50_59390_c1 3300050513 Bacteria 2871
426 nmdc:mga0rr50_644778_c1 3300050513 Bacteria 904
427 nmdc:mga0rr50_787019_c1 3300050513 Bacteria 812
428 nmdc:mga08x19_165836_c1 3300050514 Bacteria 1502
429 nmdc:mga08x19_31059_c1 3300050514 Bacteria 3359
430 nmdc:mga08x19_383074_c1 3300050514 Bacteria 985
431 nmdc:mga08x19_520633_c1 3300050514 Bacteria 840
432 nmdc:mga0a205_186225_c1 3300050515 Bacteria 1969
433 nmdc:mga0a205_1983_c1 3300050515 Bacteria 17834
434 nmdc:mga0a205_249901_c1 3300050515 Bacteria 1653
435 nmdc:mga0a205_30748_c1 3300050515 Bacteria 5143
436 nmdc:mga0a205_36865_c1 3300050515 Bacteria 4701
437 nmdc:mga0a205_52779_c1 3300050515 Bacteria 3924
438 nmdc:mga0a205_66255_c2 3300050515 Bacteria 2754
439 Ga0501084_0017891 3300054114 Bacteria 5900
440 Ga0501084_0047132 3300054114 Bacteria 3610
441 Ga0501084_0711296 3300054114 Bacteria 847
442 Ga0501084_1039865 3300054114 Unclassified 688
443 Ga0501082_0002670 3300060353 Bacteria 15585
444 Ga0501082_0155090 3300060353 Bacteria 1989
445 Ga0501082_1904694 3300060353 Bacteria 518
446 Ga0530510_0614160 3300061734 Unclassified 827
447 Ga0530510_0912480 3300061734 Unclassified 671
448 Ga0530510_1112407 3300061734 Unclassified 605
449 Ga0395899_0101384
450 Ga0070690_100725948
451 Ga0070670_100943176
452 Ga0070680_100018055
453 Ga0070680_101181299
454 Ga0070689_100317480
455 Ga0070691_10348816
456 Ga0070687_101055605
457 Ga0070692_10522125
458 Ga0070692_10969161
459 Ga0070669_100249371
460 Ga0070669_100290665
461 Ga0070669_100507205
462 Ga0070669_100921952
463 Ga0070673_101887408
464 Ga0070688_100194165
465 Ga0070703_10376518
466 Ga0070701_10113693
467 Ga0070705_100048634
468 Ga0070705_100199574
469 Ga0070705_100607465
470 Ga0070705_101276512
471 Ga0070694_100304290
472 Ga0070694_100358469
473 Ga0070694_100383857
474 Ga0070694_100708918
475 Ga0070708_100003786
476 Ga0070708_100020484
477 Ga0070708_101164794
478 Ga0070708_101282419
479 Ga0070681_10552177
480 Ga0068867_100627011
481 Ga0068867_100678075
482 Ga0070706_100139697
483 Ga0070706_100183286
484 Ga0070706_100394959
485 Ga0070706_101040052
486 Ga0070707_100009148
487 Ga0070707_100085657
488 Ga0070707_100091405
489 Ga0070707_101013307
490 Ga0070707_101880995
491 Ga0070698_100041363
492 Ga0070698_100923149
493 Ga0070698_101115194
494 Ga0070699_100004489
495 Ga0070699_100053460
496 Ga0070699_100079901
497 Ga0070699_101384994
498 Ga0070679_100028469
499 Ga0070697_100009637
500 Ga0070697_100120122
501 Ga0070697_100596727
502 Ga0070697_100738486
503 Ga0070697_101351311
504 Ga0070686_100566020
505 Ga0070695_100011836
506 Ga0070695_100829379
507 Ga0070696_100219119
508 Ga0070696_100884753
509 Ga0070693_100143199
510 Ga0070704_100271211
511 Ga0070704_100679856
512 Ga0070704_101991276
513 Ga0070702_100749534
514 Ga0068859_100063203
515 Ga0068859_100154234
516 Ga0068859_101280866
517 Ga0068859_102009089
518 Ga0068864_101203134
519 Ga0068864_102065373
520 Ga0068866_11437633
521 Ga0068861_100507459
522 Ga0068870_10165915
523 Ga0068858_100360957
524 Ga0068858_101526167
525 Ga0068862_100052398
526 Ga0068862_100435062
527 Ga0068862_100564812
528 Ga0068862_101820009
529 Ga0081455_10257688
530 Ga0081540_1113572
531 Ga0081539_10000005
532 Ga0075432_10038894
533 Ga0075432_10047149
534 Ga0075428_100001770
535 Ga0075428_100037964
536 Ga0075428_100202920
537 Ga0075428_100245037
538 Ga0075428_100395921
539 Ga0075428_101792949
540 Ga0075428_102022280
541 Ga0075428_102061233
542 Ga0075430_100000643
543 Ga0075430_100031030
544 Ga0075430_100100957
545 Ga0075430_100172266
546 Ga0075430_100176456
547 Ga0075430_100433035
548 Ga0075431_100000566
549 Ga0075431_100001354
550 Ga0075431_100001913
551 Ga0075431_100009868
552 Ga0075431_100022911
553 Ga0075431_100048948
554 Ga0075431_100239307
555 Ga0075431_100525151
556 Ga0075431_101200190
557 Ga0075431_101303648
558 Ga0075431_101735775
559 Ga0075433_10000659
560 Ga0075433_10002564
561 Ga0075433_10115834
562 Ga0075433_10166358
563 Ga0075433_10227932
564 Ga0075433_10342040
565 Ga0075433_10347862
566 Ga0075433_10663789
567 Ga0075433_11047999
568 Ga0075433_11632348
569 Ga0075434_100001544
570 Ga0075434_100068788
571 Ga0075434_100073947
572 Ga0075434_100150577
573 Ga0075434_100212423
574 Ga0075434_100259397
575 Ga0075434_100687834
576 Ga0075434_100813275
577 Ga0075434_101098329
578 Ga0075429_100002287
579 Ga0075429_100012441
580 Ga0075429_100031342
581 Ga0075429_100070191
582 Ga0075429_100091878
583 Ga0075429_100207499
584 Ga0075429_100224345
585 Ga0075429_100282545
586 Ga0075429_100666293
587 Ga0068865_100440148
588 Ga0068865_100561440
589 Ga0075436_100003846
590 Ga0075436_100028969
591 Ga0075436_100135485
592 Ga0097620_100063203
593 Ga0097620_100154240
594 Ga0097620_101280944
595 Ga0097620_102008691
596 Ga0075435_100038551
597 Ga0075435_100042019
598 Ga0075435_100135009
599 Ga0075435_100255041
600 Ga0075435_100266812
601 Ga0075435_101197442
602 Ga0075435_101603920
603 Ga0075435_101985506
604 Ga0099794_10008476
605 Ga0099794_10092736
606 Ga0099794_10232704
607 Ga0111539_10011135
608 Ga0111539_10787227
609 Ga0111539_11498604
610 Ga0111539_12266193
611 Ga0114129_10000018
612 Ga0114129_10000563
613 Ga0114129_10002375
614 Ga0114129_10017988
615 Ga0114129_10025346
616 Ga0114129_10025505
617 Ga0114129_10138232
618 Ga0114129_10188252
619 Ga0114129_10338838
620 Ga0114129_10534151
621 Ga0114129_10571443
622 Ga0114129_12203854
623 Ga0105243_10740093
624 Ga0105243_11718098
625 Ga0105242_10481872
626 Ga0105249_10214909
627 Ga0105249_11443522
628 Ga0105246_12381132
629 Ga0157378_10105276
630 Ga0157378_10130384
631 Ga0157378_11697127
632 Ga0157378_11985425
633 Ga0163162_10644414
634 Ga0157375_12176051
635 Ga0157380_10593728
636 Ga0157380_11987305
637 Ga0207688_10965599
638 Ga0207684_10003573
639 Ga0207684_10016060
640 Ga0207684_10023559
641 Ga0207684_10330608
642 Ga0207684_10881154
643 Ga0207684_11608423
644 Ga0207707_10536721
645 Ga0207660_10014307
646 Ga0207662_10864839
647 Ga0207652_10043739
648 Ga0207646_10001647
649 Ga0207646_10282323
650 Ga0207681_11560001
651 Ga0207650_10787313
652 Ga0207706_10444005
653 Ga0207686_10312575
654 Ga0207670_10540136
655 Ga0207669_11630266
656 Ga0207704_10634589
657 Ga0207704_10660212
658 Ga0207665_10750102
659 Ga0207689_11270318
660 Ga0207677_11462557
661 Ga0207703_10653744
662 Ga0207703_10907019
663 Ga0207708_10985656
664 Ga0207648_10070602
665 Ga0207676_11196520
666 Ga0207675_100393363
667 Ga0207675_100636125
668 Ga0209996_1020619
669 Ga0210000_1060172
670 Ga0209983_1011414
671 Ga0209588_1021939
672 Ga0209588_1082899
673 Ga0209971_1184458
674 Ga0209966_1030203
675 Ga0209998_10014523
676 Ga0209974_10338521
677 Ga0207428_10137381
678 Ga0268265_10034781
679 Ga0268265_12136939
680 Ga0268265_12420331
681 Ga0268264_11185655
682 Ga0268264_12216488
683 Ga0307408_100013027
684 Ga0307408_100036656
685 Ga0307408_100155598
686 Ga0307408_100293360
687 Ga0307408_100329047
688 Ga0307408_100457222
689 Ga0307408_100457263
690 Ga0307405_11770003
691 Ga0307410_10354007
692 Ga0307410_10387376
693 Ga0307406_10168323
694 Ga0307406_10865596
695 Ga0307406_12131773
696 Ga0307407_10890112
697 Ga0307412_10093064
698 Ga0307412_10423760
699 Ga0307409_100435799
700 Ga0307409_101136166
701 Ga0307409_101184095
702 Ga0307416_101186277
703 Ga0307416_102132794
704 Ga0307416_102844835
705 Ga0307414_10290134
706 Ga0307414_11768153
707 Ga0307411_10213622
708 Ga0307415_101636773
709 Ga0307415_101657166
710 Ga0373948_0049042
711 Ga0373959_0130205
712 Ga0373928_0024720
713 Ga0373929_0083876
714 Ga0373951_0102837
715 Ga0373951_0250120
716 Ga0373932_0342563
717 Ga0373942_0152544
718 Ga0373961_0236758
719 Ga0373931_0003124
720 Ga0395900_0182149
721 Ga0395900_0784320
722 Ga0395905_0043593
723 Ga0395905_0469077
724 Ga0395901_1116584
725 Ga0242420_011467
726 Ga0451577_0262371
727 Ga0451577_0550233
728 Ga0451577_1885763
729 Ga0453683_0035653
730 Ga0453683_0842678
731 Ga0453684_1743927
732 Ga0451576_0049265
733 Ga0451576_0884917
734 Ga0451576_1117290
735 Ga0495584_0376364
736 Ga0495642_0193517
737 Ga0495611_0523460
738 Ga0495659_0033320
739 Ga0495669_0152505
740 Ga0495636_0410095
741 Ga0496102_0007507
742 Ga0496107_0436558
743 Ga0496109_1750537
744 Ga0496110_0850107
745 Ga0496113_1192018
746 Ga0501291_068858
747 Ga0501298_173379
748 Ga0501299_041218
749 Ga0501031_0039630
750 Ga0501031_0540131
751 Ga0501031_0582571
752 Ga0501032_0856451
753 Ga0501033_0288083
754 Ga0501033_1204310
755 Ga0501036_0075459
756 Ga0501036_0611727
757 Ga0501038_0059486
758 Ga0501038_0558432
759 Ga0501039_0240619
760 Ga0501039_0354114
761 Ga0501040_0035562
762 Ga0501040_0078481
763 Ga0501040_0080302
764 Ga0501041_0287934
765 Ga0501041_0301638
766 Ga0501042_0016548
767 Ga0501042_0037355
768 Ga0501042_0315887
769 Ga0501042_1260030
770 Ga0501046_0052211
771 Ga0501046_0658159
772 Ga0501048_0029868
773 Ga0501067_0396830
774 Ga0501068_0018421
775 Ga0501068_0331208
776 Ga0501068_1070660
777 Ga0501070_0906680
778 Ga0501071_0023865
779 Ga0501071_0076780
780 Ga0501072_0085264
781 Ga0501072_0819509
782 Ga0501074_0087945
783 Ga0501074_0193853
784 Ga0501074_0431187
785 Ga0501075_0027969
786 Ga0501075_0029635
787 Ga0501075_0323091
788 Ga0501075_0440730
789 Ga0501076_0033654
790 Ga0501076_0035452
791 Ga0501076_0149775
792 Ga0501077_0079068
793 Ga0501077_0611430
794 Ga0501079_0030659
795 Ga0501079_0069713
796 Ga0501079_0081869
797 Ga0501079_0926759
798 Ga0501079_1019910
799 Ga0501080_0054897
800 Ga0501080_0447052
801 Ga0501081_0001313
802 Ga0501081_0056765
803 Ga0501081_0081450
804 Ga0501081_0146508
805 Ga0501081_0561561
806 Ga0501083_0124138
807 Ga0501083_0365488
808 Ga0501083_0860612
809 Ga0501035_0113315
810 Ga0501035_0998804
811 Ga0501045_0027588
812 Ga0501045_0033520
813 Ga0501045_0144858
814 Ga0501045_0146956
815 nmdc:mga05p37_116532_c1
816 nmdc:mga05p37_1251982_c1
817 nmdc:mga05p37_1327371_c1
818 nmdc:mga05p37_1393909_c1
819 nmdc:mga05p37_205_c1
820 nmdc:mga05p37_212845_c1
821 nmdc:mga05p37_260261_c1
822 nmdc:mga05p37_272789_c1
823 nmdc:mga05p37_4284_c1
824 nmdc:mga05p37_486_c1
825 nmdc:mga05p37_59214_c1
826 nmdc:mga05p37_84842_c1
827 nmdc:mga05p37_88967_c1
828 nmdc:mga09592_10626_c1
829 nmdc:mga09592_11106_c1
830 nmdc:mga09592_138251_c1
831 nmdc:mga09592_14556_c1
832 nmdc:mga09592_1671545_c1
833 nmdc:mga09592_17309_c1
834 nmdc:mga09592_23342_c1
835 nmdc:mga09592_32995_c2
836 nmdc:mga09592_654729_c1
837 nmdc:mga0qj67_1243435_c1
838 nmdc:mga0qj67_209829_c1
839 nmdc:mga0qj67_27168_c1
840 nmdc:mga0qj67_28254_c1
841 nmdc:mga0qj67_29195_c1
842 nmdc:mga0qj67_50200_c1
843 nmdc:mga0qj67_81673_c1
844 nmdc:mga06r32_1048917_c1
845 nmdc:mga06r32_1225009_c1
846 nmdc:mga06r32_1636715_c1
847 nmdc:mga06r32_16814_c1
848 nmdc:mga06r32_2084637_c1
849 nmdc:mga06r32_259197_c1
850 nmdc:mga06r32_26079_c1
851 nmdc:mga06r32_295791_c1
852 nmdc:mga06r32_314860_c1
853 nmdc:mga06r32_421781_c1
854 nmdc:mga06r32_4515_c1
855 nmdc:mga06r32_515592_c1
856 nmdc:mga06r32_53435_c1
857 nmdc:mga06r32_600015_c1
858 nmdc:mga08y16_1058583_c1
859 nmdc:mga08y16_240969_c1
860 nmdc:mga08y16_53100_c1
861 nmdc:mga0n895_171095_c1
862 nmdc:mga0n895_19373_c1
863 nmdc:mga0n895_247143_c1
864 nmdc:mga0n895_25965_c1
865 nmdc:mga0n895_48183_c1
866 nmdc:mga0n895_59080_c1
867 nmdc:mga0n895_69815_c1
868 nmdc:mga0n895_903147_c1
869 nmdc:mga0rr50_113776_c1
870 nmdc:mga0rr50_12795_c1
871 nmdc:mga0rr50_482394_c1
872 nmdc:mga0rr50_57564_c1
873 nmdc:mga0rr50_59390_c1
874 nmdc:mga0rr50_644778_c1
875 nmdc:mga0rr50_787019_c1
876 nmdc:mga08x19_165836_c1
877 nmdc:mga08x19_31059_c1
878 nmdc:mga08x19_383074_c1
879 nmdc:mga08x19_520633_c1
880 nmdc:mga0a205_186225_c1
881 nmdc:mga0a205_1983_c1
882 nmdc:mga0a205_249901_c1
883 nmdc:mga0a205_30748_c1
884 nmdc:mga0a205_36865_c1
885 nmdc:mga0a205_52779_c1
886 nmdc:mga0a205_66255_c2
887 Ga0501084_0017891
888 Ga0501084_0047132
889 Ga0501084_0711296
890 Ga0501084_1039865
891 Ga0501082_0002670
892 Ga0501082_0155090
893 Ga0501082_1904694
894 Ga0530510_0614160
895 Ga0530510_0912480
896 Ga0530510_1112407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map