F446189

General Info

Members Datasets Scaffolds Average Seq Length
448 321 896 246

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10007541|Ga0265334_100075411
Length 240
Sequence VARTSWKYLDARVAAVDWDAVASALDADGAAIARSLLTPTECARLAAAYDDDALFRSTVVMSRHGYGRGEYRYFAYPLPEPIATLRTKLYPRLLTSANRWATALGAAEYPRSHARYLEQCHEAGQTRPTPLLLRYAEGDYNCLHQDVYGEHVFPLQVAILLSEPERDFTGGEFVMTEQRPRMQSRPLVVPLRQGDAVVFAVRHRPVHGTRGVYRVNLRHGVSRIRSGRRLTAGIIFHDGK

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
278 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
306 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
307 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
308 2841760612 Bosea sp. Tri-49 Isolate Nodule
309 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
310 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
311 2844104063 Bosea sp. Tri-39 Isolate Nodule
312 2851182111 Bosea sp. Tri-44 Isolate Nodule
313 2851246043 Bosea sp. Tri-54 Isolate Nodule
314 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
315 2854911287 Brucella lupini LUP21 Isolate Unclassified
316 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
317 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
318 641522639 Methylobacterium sp. 4-46 Isolate Nodule
319 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
320 8004592986 Serratia sp. S119 Isolate Unclassified
321 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0.22
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 2.23
Rhizoplane 8.48
Rhizosphere 79.69
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10007541 3300028573 Bacteria 4662
2 JGI24743J22301_10000894 3300001991 Bacteria 3816
3 JGI24750J21931_1012669 3300002070 Bacteria 1120
4 JGI24738J21930_10050423 3300002075 Bacteria 849
5 JGI24749J21850_1004779 3300002076 Bacteria 1898
6 JGI24742J22300_10000825 3300002244 Bacteria 4730
7 JGI24751J29686_10018343 3300002459 Bacteria 1447
8 JGI25156J39149_1009844 3300002705 Bacteria 2292
9 rootL2_10245552 3300003322 Bacteria 4708
10 Ga0006562J51391_1018615 3300003578 Bacteria 4620
11 Ga0055535_1000098 3300003761 Bacteria 94622
12 Ga0055535_1000116 3300003761 Bacteria 85902
13 Ga0055529_1000143 3300003763 Bacteria 101808
14 Ga0055536_1004717 3300003781 Bacteria 6862
15 Ga0065715_10001133 3300005293 Bacteria 9694
16 Ga0070683_100035669 3300005329 Bacteria 4546
17 Ga0070670_100020107 3300005331 Bacteria 5735
18 Ga0068869_100048153 3300005334 Bacteria 3081
19 Ga0070666_10052825 3300005335 Bacteria 2740
20 Ga0070682_100026298 3300005337 Bacteria 3482
21 Ga0070682_100376567 3300005337 Bacteria 1066
22 Ga0068868_100018781 3300005338 Bacteria 5171
23 Ga0070660_100248918 3300005339 Bacteria 1449
24 Ga0070689_100005543 3300005340 Bacteria 8632
25 Ga0070691_10043941 3300005341 Bacteria 2118
26 Ga0070687_100018708 3300005343 Bacteria 3209
27 Ga0070661_100003846 3300005344 Bacteria 10333
28 Ga0070669_100012095 3300005353 Bacteria 6126
29 Ga0070671_100006790 3300005355 Bacteria 9159
30 Ga0070674_100221047 3300005356 Bacteria 1473
31 Ga0070667_100015176 3300005367 Bacteria 6363
32 Ga0070709_10370875 3300005434 Bacteria 1062
33 Ga0070714_100031556 3300005435 Bacteria 4422
34 Ga0070713_100001830 3300005436 Bacteria 13722
35 Ga0070713_100765627 3300005436 Bacteria 924
36 Ga0070701_10015485 3300005438 Bacteria 3524
37 Ga0070711_100076949 3300005439 Bacteria 2367
38 Ga0070711_100122075 3300005439 Bacteria 1929
39 Ga0070700_100008830 3300005441 Bacteria 5507
40 Ga0070663_100756914 3300005455 Bacteria 830
41 Ga0070678_100022768 3300005456 Bacteria 4160
42 Ga0070662_100003682 3300005457 Bacteria 9580
43 Ga0070681_10009471 3300005458 Bacteria 9583
44 Ga0070681_10073465 3300005458 Bacteria 3381
45 Ga0070681_10119100 3300005458 Bacteria 2576
46 Ga0068867_100021476 3300005459 Bacteria 4606
47 Ga0068867_100064613 3300005459 Bacteria 2721
48 Ga0070685_10011879 3300005466 Bacteria 4565
49 Ga0070706_100012836 3300005467 Bacteria 7755
50 Ga0070706_100144594 3300005467 Bacteria 2221
51 Ga0070707_100098146 3300005468 Bacteria 2837
52 Ga0070698_100037392 3300005471 Bacteria 5005
53 Ga0070699_100062078 3300005518 Bacteria 3238
54 Ga0070699_100094911 3300005518 Bacteria 2611
55 Ga0070679_100025400 3300005530 Bacteria 5812
56 Ga0070679_100056296 3300005530 Bacteria 3918
57 Ga0070679_100242172 3300005530 Bacteria 1761
58 Ga0070697_100007809 3300005536 Bacteria 8327
59 Ga0068853_100022378 3300005539 Bacteria 5279
60 Ga0068853_100120724 3300005539 Bacteria 2338
61 Ga0070672_100009899 3300005543 Bacteria 6591
62 Ga0070686_100122443 3300005544 Bacteria 1788
63 Ga0070695_100017993 3300005545 Bacteria 4289
64 Ga0070695_100041696 3300005545 Bacteria 2910
65 Ga0070696_100021482 3300005546 Bacteria 4376
66 Ga0070696_100594251 3300005546 Bacteria 892
67 Ga0070665_100093055 3300005548 Bacteria 3019
68 Ga0070704_100280711 3300005549 Bacteria 1380
69 Ga0068855_100026828 3300005563 Bacteria 6892
70 Ga0070664_100033837 3300005564 Bacteria 4284
71 Ga0068857_100025992 3300005577 Bacteria 5156
72 Ga0068857_100116680 3300005577 Unclassified 2402
73 Ga0068857_100147048 3300005577 Bacteria 2133
74 Ga0068854_100040959 3300005578 Bacteria 3270
75 Ga0068856_100071747 3300005614 Bacteria 3429
76 Ga0068856_100081093 3300005614 Bacteria 3219
77 Ga0070702_100003710 3300005615 Bacteria 6882
78 Ga0068852_100031611 3300005616 Bacteria 4371
79 Ga0068859_100013767 3300005617 Bacteria 8110
80 Ga0068859_100083950 3300005617 Bacteria 3229
81 Ga0068859_101245400 3300005617 Bacteria 820
82 Ga0068864_100024767 3300005618 Bacteria 5048
83 Ga0068861_100054099 3300005719 Bacteria 3057
84 Ga0068870_10000985 3300005840 Bacteria 11236
85 Ga0068863_100009177 3300005841 Bacteria 9648
86 Ga0068863_100099761 3300005841 Bacteria 2759
87 Ga0068858_100038472 3300005842 Bacteria 4437
88 Ga0068858_100137486 3300005842 Bacteria 2293
89 Ga0068858_100536749 3300005842 Bacteria 1132
90 Ga0068860_100014272 3300005843 Bacteria 7790
91 Ga0068860_100066071 3300005843 Bacteria 3435
92 Ga0068860_100074390 3300005843 Bacteria 3231
93 Ga0068862_100189779 3300005844 Bacteria 1848
94 Ga0081539_10034822 3300005985 Bacteria 3037
95 Ga0070717_10651981 3300006028 Bacteria 956
96 Ga0075365_10134230 3300006038 Bacteria 1714
97 Ga0075368_10002310 3300006042 Bacteria 6190
98 Ga0075368_10034993 3300006042 Bacteria 1959
99 Ga0075363_100010518 3300006048 Bacteria 4400
100 Ga0070715_10011721 3300006163 Bacteria 3165
101 Ga0075367_10021106 3300006178 Bacteria 3636
102 Ga0075367_10140030 3300006178 Bacteria 1498
103 Ga0075369_10035362 3300006186 Bacteria 2123
104 Ga0097621_100088027 3300006237 Bacteria 2594
105 Ga0068871_100000881 3300006358 Bacteria 20004
106 Ga0068871_100034671 3300006358 Bacteria 4006
107 Ga0068871_100139840 3300006358 Bacteria 2058
108 Ga0075428_100022573 3300006844 Bacteria 6967
109 Ga0075430_100109323 3300006846 Bacteria 2306
110 Ga0075433_10019588 3300006852 Bacteria 5641
111 Ga0075433_10111818 3300006852 Bacteria 2423
112 Ga0075434_100127646 3300006871 Bacteria 2560
113 Ga0075434_100485076 3300006871 Bacteria 1257
114 Ga0068865_100080844 3300006881 Bacteria 2332
115 Ga0097620_100013767 3300006931 Bacteria 8110
116 Ga0097620_100083952 3300006931 Bacteria 3229
117 Ga0097620_101245393 3300006931 Bacteria 820
118 Ga0099794_10288396 3300007265 Bacteria 849
119 Ga0105244_10064941 3300009036 Bacteria 1829
120 Ga0111539_10039619 3300009094 Bacteria 5677
121 Ga0111539_10108332 3300009094 Bacteria 3260
122 Ga0111539_10600205 3300009094 Bacteria 1282
123 Ga0105245_10040915 3300009098 Bacteria 4131
124 Ga0105245_10702006 3300009098 Bacteria 1045
125 Ga0114129_10024738 3300009147 Bacteria 8512
126 Ga0114129_10086232 3300009147 Unclassified 4355
127 Ga0105243_10012740 3300009148 Bacteria 6352
128 Ga0105243_10025948 3300009148 Bacteria 4482
129 Ga0105241_10192154 3300009174 Bacteria 1700
130 Ga0105242_10076822 3300009176 Bacteria 2785
131 Ga0105242_10087925 3300009176 Bacteria 2609
132 Ga0105248_10107874 3300009177 Bacteria 3140
133 Ga0105238_10028385 3300009551 Bacteria 5703
134 Ga0105249_10467350 3300009553 Bacteria 1302
135 Ga0105249_11135388 3300009553 Bacteria 852
136 Ga0105246_10061047 3300011119 Bacteria 2621
137 Ga0105246_10245643 3300011119 Bacteria 1417
138 Ga0157370_10073402 3300013104 Bacteria 3228
139 Ga0157369_10000886 3300013105 Bacteria 38170
140 Ga0157374_10030995 3300013296 Bacteria 4856
141 Ga0157378_10114353 3300013297 Bacteria 2479
142 Ga0157378_10499024 3300013297 Bacteria 1215
143 Ga0163162_10069911 3300013306 Bacteria 3562
144 Ga0157372_10275458 3300013307 Bacteria 1956
145 Ga0163163_10010358 3300014325 Bacteria 8376
146 Ga0163163_10057833 3300014325 Bacteria 3834
147 Ga0157380_10014877 3300014326 Bacteria 5703
148 Ga0157377_10106024 3300014745 Bacteria 1682
149 Ga0157379_10028513 3300014968 Bacteria 4965
150 Ga0157376_10037071 3300014969 Bacteria 3954
151 Ga0163161_10649345 3300017792 Bacteria 874
152 Ga0213872_10040265 3300021361 Bacteria 2134
153 Ga0209672_104905 3300025228 Bacteria 2385
154 Ga0209258_100202 3300025242 Bacteria 121896
155 Ga0209759_1000540 3300025256 Bacteria 39757
156 Ga0209455_1000181 3300025272 Bacteria 101875
157 Ga0209676_1000146 3300025292 Bacteria 174095
158 Ga0209050_1007871 3300025298 Bacteria 5848
159 Ga0209257_1000646 3300025304 Bacteria 55576
160 Ga0207642_10010040 3300025899 Bacteria 3319
161 Ga0207710_10032348 3300025900 Bacteria 2291
162 Ga0207688_10000303 3300025901 Bacteria 22604
163 Ga0207680_10052622 3300025903 Bacteria 2441
164 Ga0207647_10003927 3300025904 Bacteria 11107
165 Ga0207685_10008577 3300025905 Bacteria 2920
166 Ga0207699_10283184 3300025906 Bacteria 1152
167 Ga0207643_10001489 3300025908 Bacteria 13420
168 Ga0207684_10047741 3300025910 Bacteria 3631
169 Ga0207684_10112844 3300025910 Bacteria 2326
170 Ga0207654_10058798 3300025911 Bacteria 2240
171 Ga0207707_10003951 3300025912 Bacteria 13171
172 Ga0207671_10024062 3300025914 Bacteria 4584
173 Ga0207663_10065609 3300025916 Bacteria 2321
174 Ga0207663_10096707 3300025916 Bacteria 1973
175 Ga0207660_10155022 3300025917 Bacteria 1763
176 Ga0207649_10000078 3300025920 Bacteria 82996
177 Ga0207652_10032023 3300025921 Bacteria 4417
178 Ga0207652_10040930 3300025921 Bacteria 3937
179 Ga0207681_10048719 3300025923 Bacteria 2861
180 Ga0207650_10004475 3300025925 Bacteria 9552
181 Ga0207650_10045238 3300025925 Bacteria 3238
182 Ga0207659_10136167 3300025926 Bacteria 1901
183 Ga0207700_10000159 3300025928 Bacteria 40558
184 Ga0207664_10009340 3300025929 Bacteria 6876
185 Ga0207644_10066520 3300025931 Bacteria 2624
186 Ga0207690_10052566 3300025932 Bacteria 2729
187 Ga0207706_10002752 3300025933 Bacteria 17102
188 Ga0207686_10052606 3300025934 Bacteria 2542
189 Ga0207686_10100658 3300025934 Bacteria 1929
190 Ga0207709_10001846 3300025935 Bacteria 14107
191 Ga0207709_10061308 3300025935 Bacteria 2350
192 Ga0207670_10007621 3300025936 Bacteria 6055
193 Ga0207669_10028203 3300025937 Bacteria 3085
194 Ga0207704_10013529 3300025938 Bacteria 4086
195 Ga0207665_10054639 3300025939 Bacteria 2693
196 Ga0207691_10003130 3300025940 Bacteria 16166
197 Ga0207711_10019260 3300025941 Bacteria 5683
198 Ga0207711_10225526 3300025941 Bacteria 1715
199 Ga0207689_10058972 3300025942 Bacteria 3157
200 Ga0207689_10347403 3300025942 Bacteria 1233
201 Ga0207679_10024990 3300025945 Bacteria 4103
202 Ga0207667_10000012 3300025949 Bacteria 445492
203 Ga0207667_10737135 3300025949 Bacteria 985
204 Ga0207651_10107775 3300025960 Bacteria 2083
205 Ga0207651_10408276 3300025960 Bacteria 1157
206 Ga0207712_10040737 3300025961 Bacteria 3190
207 Ga0207640_10031808 3300025981 Bacteria 3265
208 Ga0207658_10006728 3300025986 Bacteria 7824
209 Ga0207658_10017886 3300025986 Bacteria 4886
210 Ga0207677_10016712 3300026023 Bacteria 4354
211 Ga0207677_10250301 3300026023 Bacteria 1439
212 Ga0207703_10013541 3300026035 Bacteria 6353
213 Ga0207703_10114971 3300026035 Bacteria 2302
214 Ga0207639_10070675 3300026041 Bacteria 2727
215 Ga0207678_10004746 3300026067 Bacteria 12210
216 Ga0207678_10012232 3300026067 Bacteria 7535
217 Ga0207678_10511825 3300026067 Bacteria 1047
218 Ga0207708_10008657 3300026075 Bacteria 7533
219 Ga0207641_10003939 3300026088 Bacteria 12976
220 Ga0207641_10020291 3300026088 Bacteria 5458
221 Ga0207648_10007865 3300026089 Bacteria 10401
222 Ga0207648_10024877 3300026089 Bacteria 5340
223 Ga0207648_10117666 3300026089 Bacteria 2335
224 Ga0207676_10005245 3300026095 Bacteria 9173
225 Ga0207676_10277187 3300026095 Bacteria 1521
226 Ga0207676_10841044 3300026095 Bacteria 897
227 Ga0207674_10050028 3300026116 Bacteria 4272
228 Ga0207674_10115378 3300026116 Bacteria 2657
229 Ga0207674_10218747 3300026116 Unclassified 1853
230 Ga0207674_10334060 3300026116 Bacteria 1465
231 Ga0207675_100095041 3300026118 Bacteria 2804
232 Ga0207675_100097991 3300026118 Bacteria 2761
233 Ga0207683_10003263 3300026121 Bacteria 14146
234 Ga0209813_10006275 3300027866 Bacteria 2932
235 Ga0207428_10030681 3300027907 Bacteria 4442
236 Ga0268266_10085346 3300028379 Bacteria 2758
237 Ga0268266_10099409 3300028379 Bacteria 2561
238 Ga0268266_10199025 3300028379 Bacteria 1833
239 Ga0268264_10010074 3300028381 Bacteria 7824
240 Ga0268264_10025336 3300028381 Bacteria 4846
241 Ga0268264_10055624 3300028381 Bacteria 3307
242 Ga0268264_10080796 3300028381 Bacteria 2777
243 Ga0268264_10751892 3300028381 Bacteria 971
244 Ga0265330_10061730 3300031235 Bacteria 1630
245 Ga0265332_10000862 3300031238 Bacteria 18389
246 Ga0265325_10001844 3300031241 Bacteria 14630
247 Ga0265329_10012413 3300031242 Bacteria 3062
248 Ga0265340_10002878 3300031247 Bacteria 9797
249 Ga0265340_10013718 3300031247 Bacteria 4250
250 Ga0265339_10003663 3300031249 Bacteria 10720
251 Ga0265339_10063580 3300031249 Bacteria 1982
252 Ga0307513_10070846 3300031456 Bacteria 3641
253 Ga0307513_10228170 3300031456 Bacteria 1677
254 Ga0307408_100006884 3300031548 Archaea 7533
255 Ga0265342_10000026 3300031712 Bacteria 166610
256 Ga0307405_10031277 3300031731 Bacteria 3131
257 Ga0307413_10001435 3300031824 Archaea 9027
258 Ga0307413_10316856 3300031824 Bacteria 1190
259 Ga0307410_10002546 3300031852 Archaea 8829
260 Ga0307406_10033196 3300031901 Archaea 3157
261 Ga0307407_10002287 3300031903 Archaea 7430
262 Ga0307412_10101389 3300031911 Bacteria 2037
263 Ga0307416_100093208 3300032002 Bacteria 2593
264 Ga0307414_10004431 3300032004 Archaea 7624
265 Ga0307414_10009034 3300032004 Bacteria 5702
266 Ga0307415_100240355 3300032126 Bacteria 1464
267 Ga0373934_0055583 3300035086 Bacteria 1573
268 Ga0373944_0081375 3300035089 Bacteria 1070
269 Ga0373923_0084095 3300035111 Bacteria 1384
270 Ga0373954_0183815 3300035118 Bacteria 1025
271 Ga0373946_0051913 3300035171 Bacteria 1717
272 Ga0373955_0009392 3300035172 Bacteria 4575
273 Ga0373931_0056698 3300035691 Bacteria 2100
274 Ga0373935_0096292 3300035692 Bacteria 1945
275 Ga0373935_0189357 3300035692 Bacteria 1416
276 Ga0373927_0142239 3300035695 Bacteria 1569
277 Ga0373937_0001755 3300036401 Bacteria 18242
278 Ga0395899_0188321 3300037312 Bacteria 1445
279 Ga0395900_0000628 3300037418 Bacteria 47493
280 Ga0395900_0019431 3300037418 Bacteria 6927
281 Ga0395900_0497347 3300037418 Bacteria 1170
282 Ga0395898_0000344 3300037466 Bacteria 104925
283 Ga0395901_0000090 3300038443 Bacteria 123748
284 Ga0395901_1054813 3300038443 Bacteria 785
285 Ga0436365_0429551 3300039437 Bacteria 1446
286 Ga0436361_0472237 3300039447 Bacteria 29034
287 Ga0436362_1270913 3300039453 Bacteria 943
288 Ga0451793_0788817 3300041452 Bacteria 2249
289 Ga0451800_1442347 3300041459 Bacteria 1092
290 Ga0451802_1757643 3300041460 Bacteria 2264
291 Ga0451807_2227500 3300041486 Bacteria 2332
292 Ga0466969_0023732 3300044656 Bacteria 3160
293 Ga0466966_0008308 3300044684 Bacteria 6881
294 Ga0466966_0011699 3300044684 Bacteria 5817
295 Ga0466963_0073605 3300044694 Bacteria 2303
296 Ga0466971_0000418 3300044719 Bacteria 16601
297 Ga0466957_0015680 3300044842 Bacteria 4427
298 Ga0466960_0059723 3300044901 Bacteria 1867
299 Ga0466960_0149853 3300044901 Bacteria 1245
300 Ga0495603_0164009 3300046455 Bacteria 1288
301 Ga0495590_0126637 3300046457 Bacteria 917
302 Ga0495580_0096849 3300046472 Bacteria 2052
303 Ga0495605_0132147 3300046474 Bacteria 1125
304 Ga0495662_0014946 3300046476 Bacteria 3771
305 Ga0495584_0146372 3300046491 Bacteria 1200
306 Ga0495585_0025880 3300046492 Bacteria 3356
307 Ga0495607_0025673 3300046501 Bacteria 3662
308 Ga0495630_0057621 3300046517 Bacteria 2912
309 Ga0495644_0037924 3300046523 Bacteria 1818
310 Ga0495666_0118566 3300046526 Bacteria 1240
311 Ga0495598_0002463 3300046537 Bacteria 3825
312 Ga0495633_0029797 3300046558 Bacteria 2654
313 Ga0495656_0002141 3300046615 Bacteria 6525
314 Ga0495668_0098724 3300046616 Bacteria 1598
315 Ga0495634_0021067 3300046642 Bacteria 4616
316 Ga0495659_0019917 3300046664 Bacteria 2249
317 Ga0495647_0119323 3300046681 Bacteria 1108
318 Ga0495669_0032836 3300046684 Bacteria 2283
319 Ga0495670_0015435 3300046691 Bacteria 3753
320 Ga0495670_0233259 3300046691 Bacteria 979
321 Ga0495581_0103107 3300047315 Bacteria 1658
322 Ga0495604_0283197 3300047317 Bacteria 1119
323 Ga0495681_0117040 3300047470 Bacteria 1148
324 Ga0495684_0141067 3300047471 Bacteria 1807
325 Ga0495686_0170352 3300047472 Bacteria 1267
326 Ga0496100_0019742 3300048903 Bacteria 4027
327 Ga0496100_0073267 3300048903 Bacteria 2291
328 Ga0496101_0007611 3300048904 Bacteria 7034
329 Ga0496102_0039596 3300048905 Bacteria 4259
330 Ga0496102_0156194 3300048905 Bacteria 2144
331 Ga0496102_0341054 3300048905 Bacteria 1411
332 Ga0496103_0004579 3300048906 Bacteria 8373
333 Ga0496103_0073733 3300048906 Bacteria 2138
334 Ga0496104_0022809 3300048907 Bacteria 5750
335 Ga0496104_0024666 3300048907 Bacteria 5533
336 Ga0496105_0006961 3300048908 Bacteria 8711
337 Ga0496105_0032767 3300048908 Bacteria 4265
338 Ga0496106_0067499 3300048909 Bacteria 2726
339 Ga0496106_0301488 3300048909 Bacteria 1285
340 Ga0496106_0534167 3300048909 Bacteria 941
341 Ga0496107_0012293 3300048910 Bacteria 5975
342 Ga0496108_0028935 3300048911 Bacteria 4584
343 Ga0496108_0078471 3300048911 Bacteria 2794
344 Ga0496109_0007580 3300048912 Bacteria 9201
345 Ga0496110_0016118 3300048913 Bacteria 6233
346 Ga0496110_0261903 3300048913 Bacteria 1574
347 Ga0496111_0012152 3300048914 Bacteria 5823
348 Ga0496111_0015182 3300048914 Bacteria 5280
349 Ga0496111_0438777 3300048914 Bacteria 964
350 Ga0496112_0021123 3300048915 Bacteria 6185
351 Ga0496112_0074035 3300048915 Bacteria 3367
352 Ga0496112_0075542 3300048915 Bacteria 3332
353 Ga0496112_0550111 3300048915 Bacteria 1088
354 Ga0496113_0000285 3300048916 Bacteria 23890
355 Ga0496113_0006001 3300048916 Bacteria 7646
356 Ga0496114_0041384 3300048917 Bacteria 3818
357 Ga0496114_0506743 3300048917 Bacteria 1067
358 Ga0496115_0044509 3300048918 Bacteria 3540
359 Ga0496115_0086717 3300048918 Bacteria 2554
360 Ga0496116_0213829 3300048919 Bacteria 996
361 Ga0496118_0026107 3300048921 Bacteria 4986
362 Ga0496126_0337856 3300048929 Bacteria 1234
363 Ga0501299_000287 3300049522 Archaea 5792
364 Ga0501031_0003284 3300049568 Bacteria 10391
365 Ga0501032_0042196 3300049569 Bacteria 3095
366 Ga0501032_0068395 3300049569 Bacteria 2371
367 Ga0501032_0202649 3300049569 Bacteria 1295
368 Ga0501034_0025883 3300049571 Bacteria 5975
369 Ga0501034_0134059 3300049571 Bacteria 2459
370 Ga0501036_0355027 3300049572 Bacteria 1224
371 Ga0501037_0353710 3300049573 Bacteria 1013
372 Ga0501040_0000016 3300049576 Bacteria 75260
373 Ga0501042_0000046 3300049578 Bacteria 41284
374 Ga0501047_0007850 3300049581 Bacteria 10054
375 Ga0501047_0052686 3300049581 Bacteria 3934
376 Ga0501047_0103264 3300049581 Bacteria 2730
377 Ga0501047_0205317 3300049581 Bacteria 1830
378 Ga0501068_0002896 3300049584 Bacteria 9133
379 Ga0501070_0006543 3300049586 Bacteria 9908
380 Ga0501070_0038509 3300049586 Bacteria 3989
381 Ga0501072_0003361 3300049588 Bacteria 12029
382 Ga0501072_0466953 3300049588 Bacteria 999
383 Ga0501073_0008018 3300049589 Bacteria 7841
384 Ga0501073_0035316 3300049589 Bacteria 3554
385 Ga0501074_0218932 3300049590 Bacteria 1356
386 Ga0501076_0267180 3300049592 Bacteria 1401
387 Ga0501243_038944 3300049675 Bacteria 830
388 Ga0501248_003813 3300049678 Bacteria 1107
389 Ga0501225_0028722 3300049705 Bacteria 1528
390 Ga0501079_0079582 3300049741 Bacteria 2534
391 Ga0501080_0022991 3300049742 Bacteria 5781
392 Ga0501080_0068285 3300049742 Bacteria 3306
393 Ga0501080_0195329 3300049742 Bacteria 1859
394 Ga0501083_0030599 3300049744 Bacteria 3697
395 Ga0501083_0276534 3300049744 Bacteria 1092
396 Ga0501035_0006933 3300049822 Bacteria 10583
397 Ga0501035_0067367 3300049822 Bacteria 3177
398 Ga0501035_0104954 3300049822 Bacteria 2478
399 Ga0501035_0344212 3300049822 Bacteria 1249
400 Ga0501044_0001583 3300049823 Bacteria 26651
401 Ga0501044_0012377 3300049823 Bacteria 9235
402 Ga0501044_0023884 3300049823 Bacteria 6498
403 Ga0501044_0181661 3300049823 Bacteria 2070
404 Ga0501045_0027528 3300049824 Bacteria 4097
405 Ga0501212_012728 3300049851 Bacteria 1227
406 nmdc:mga03n38_6071_c1 3300050490 Bacteria 4169
407 nmdc:mga06z11_1859_c1 3300050494 Bacteria 7959
408 nmdc:mga06z11_326784_c1 3300050494 Bacteria 915
409 nmdc:mga04h51_7163_c1 3300050495 Bacteria 2932
410 nmdc:mga07m45_68551_c1 3300050496 Bacteria 2017
411 nmdc:mga05p37_128129_c1 3300050507 Bacteria 3116
412 nmdc:mga05p37_192613_c1 3300050507 Unclassified 2474
413 nmdc:mga05p37_608779_c1 3300050507 Bacteria 1232
414 nmdc:mga09592_147252_c1 3300050508 Bacteria 2030
415 nmdc:mga08y16_18900_c1 3300050511 Bacteria 7257
416 nmdc:mga0n895_27362_c1 3300050512 Bacteria 5417
417 nmdc:mga0a205_10686_c1 3300050515 Bacteria 8439
418 nmdc:mga0a205_285311_c1 3300050515 Bacteria 1526
419 nmdc:mga0a205_57638_c1 3300050515 Bacteria 3750
420 nmdc:mga0sz30_19482_c1 3300050516 Bacteria 2729
421 Ga0500644_0046736 3300053088 Bacteria 1465
422 Ga0500583_0111165 3300053092 Bacteria 1349
423 Ga0500555_000634 3300053103 Bacteria 13585
424 Ga0500616_0000874 3300053153 Bacteria 33330
425 Ga0500622_0005759 3300053156 Bacteria 7355
426 Ga0500645_000044 3300053730 Bacteria 109705
427 Ga0501084_0005623 3300054114 Bacteria 10294
428 Ga0501084_0212804 3300054114 Bacteria 1631
429 Ga0501082_0303925 3300060353 Bacteria 1389
430 Ga0466962_0036059 3300061719 Bacteria 2366
431 Ga0466962_0111275 3300061719 Bacteria 1318
432 2545676479 2545555834 Bacteria 8130841
433 2723878869 2721755763 Bacteria 4464185
434 2758640953 2758568016 Bacteria 5645291
435 2841764432 2841760612 Bacteria 6454112
436 2841916282 2841911363 Bacteria 6173697
437 2841921049 2841917233 Bacteria 6173500
438 2844108120 2844104063 Bacteria 6440972
439 2851188050 2851182111 Bacteria 6047226
440 2851250226 2851246043 Bacteria 6439203
441 2852654197 2852653556 Bacteria 4050083
442 2854914292 2854911287 Bacteria 5582813
443 2857580681 2857576091 Bacteria 5465855
444 2888367502 2888366609 Bacteria 5155009
445 641641336 641522639 Bacteria 7737025
446 643664280 643348564 Bacteria 8839022
447 8004594187 8004592986 Bacteria 5122074
448 8057533498 8057529695 Bacteria 6306553
449 Ga0265334_10007541
450 JGI24743J22301_10000894
451 JGI24750J21931_1012669
452 JGI24738J21930_10050423
453 JGI24749J21850_1004779
454 JGI24742J22300_10000825
455 JGI24751J29686_10018343
456 JGI25156J39149_1009844
457 rootL2_10245552
458 Ga0006562J51391_1018615
459 Ga0055535_1000098
460 Ga0055535_1000116
461 Ga0055529_1000143
462 Ga0055536_1004717
463 Ga0065715_10001133
464 Ga0070683_100035669
465 Ga0070670_100020107
466 Ga0068869_100048153
467 Ga0070666_10052825
468 Ga0070682_100026298
469 Ga0070682_100376567
470 Ga0068868_100018781
471 Ga0070660_100248918
472 Ga0070689_100005543
473 Ga0070691_10043941
474 Ga0070687_100018708
475 Ga0070661_100003846
476 Ga0070669_100012095
477 Ga0070671_100006790
478 Ga0070674_100221047
479 Ga0070667_100015176
480 Ga0070709_10370875
481 Ga0070714_100031556
482 Ga0070713_100001830
483 Ga0070713_100765627
484 Ga0070701_10015485
485 Ga0070711_100076949
486 Ga0070711_100122075
487 Ga0070700_100008830
488 Ga0070663_100756914
489 Ga0070678_100022768
490 Ga0070662_100003682
491 Ga0070681_10009471
492 Ga0070681_10073465
493 Ga0070681_10119100
494 Ga0068867_100021476
495 Ga0068867_100064613
496 Ga0070685_10011879
497 Ga0070706_100012836
498 Ga0070706_100144594
499 Ga0070707_100098146
500 Ga0070698_100037392
501 Ga0070699_100062078
502 Ga0070699_100094911
503 Ga0070679_100025400
504 Ga0070679_100056296
505 Ga0070679_100242172
506 Ga0070697_100007809
507 Ga0068853_100022378
508 Ga0068853_100120724
509 Ga0070672_100009899
510 Ga0070686_100122443
511 Ga0070695_100017993
512 Ga0070695_100041696
513 Ga0070696_100021482
514 Ga0070696_100594251
515 Ga0070665_100093055
516 Ga0070704_100280711
517 Ga0068855_100026828
518 Ga0070664_100033837
519 Ga0068857_100025992
520 Ga0068857_100116680
521 Ga0068857_100147048
522 Ga0068854_100040959
523 Ga0068856_100071747
524 Ga0068856_100081093
525 Ga0070702_100003710
526 Ga0068852_100031611
527 Ga0068859_100013767
528 Ga0068859_100083950
529 Ga0068859_101245400
530 Ga0068864_100024767
531 Ga0068861_100054099
532 Ga0068870_10000985
533 Ga0068863_100009177
534 Ga0068863_100099761
535 Ga0068858_100038472
536 Ga0068858_100137486
537 Ga0068858_100536749
538 Ga0068860_100014272
539 Ga0068860_100066071
540 Ga0068860_100074390
541 Ga0068862_100189779
542 Ga0081539_10034822
543 Ga0070717_10651981
544 Ga0075365_10134230
545 Ga0075368_10002310
546 Ga0075368_10034993
547 Ga0075363_100010518
548 Ga0070715_10011721
549 Ga0075367_10021106
550 Ga0075367_10140030
551 Ga0075369_10035362
552 Ga0097621_100088027
553 Ga0068871_100000881
554 Ga0068871_100034671
555 Ga0068871_100139840
556 Ga0075428_100022573
557 Ga0075430_100109323
558 Ga0075433_10019588
559 Ga0075433_10111818
560 Ga0075434_100127646
561 Ga0075434_100485076
562 Ga0068865_100080844
563 Ga0097620_100013767
564 Ga0097620_100083952
565 Ga0097620_101245393
566 Ga0099794_10288396
567 Ga0105244_10064941
568 Ga0111539_10039619
569 Ga0111539_10108332
570 Ga0111539_10600205
571 Ga0105245_10040915
572 Ga0105245_10702006
573 Ga0114129_10024738
574 Ga0114129_10086232
575 Ga0105243_10012740
576 Ga0105243_10025948
577 Ga0105241_10192154
578 Ga0105242_10076822
579 Ga0105242_10087925
580 Ga0105248_10107874
581 Ga0105238_10028385
582 Ga0105249_10467350
583 Ga0105249_11135388
584 Ga0105246_10061047
585 Ga0105246_10245643
586 Ga0157370_10073402
587 Ga0157369_10000886
588 Ga0157374_10030995
589 Ga0157378_10114353
590 Ga0157378_10499024
591 Ga0163162_10069911
592 Ga0157372_10275458
593 Ga0163163_10010358
594 Ga0163163_10057833
595 Ga0157380_10014877
596 Ga0157377_10106024
597 Ga0157379_10028513
598 Ga0157376_10037071
599 Ga0163161_10649345
600 Ga0213872_10040265
601 Ga0209672_104905
602 Ga0209258_100202
603 Ga0209759_1000540
604 Ga0209455_1000181
605 Ga0209676_1000146
606 Ga0209050_1007871
607 Ga0209257_1000646
608 Ga0207642_10010040
609 Ga0207710_10032348
610 Ga0207688_10000303
611 Ga0207680_10052622
612 Ga0207647_10003927
613 Ga0207685_10008577
614 Ga0207699_10283184
615 Ga0207643_10001489
616 Ga0207684_10047741
617 Ga0207684_10112844
618 Ga0207654_10058798
619 Ga0207707_10003951
620 Ga0207671_10024062
621 Ga0207663_10065609
622 Ga0207663_10096707
623 Ga0207660_10155022
624 Ga0207649_10000078
625 Ga0207652_10032023
626 Ga0207652_10040930
627 Ga0207681_10048719
628 Ga0207650_10004475
629 Ga0207650_10045238
630 Ga0207659_10136167
631 Ga0207700_10000159
632 Ga0207664_10009340
633 Ga0207644_10066520
634 Ga0207690_10052566
635 Ga0207706_10002752
636 Ga0207686_10052606
637 Ga0207686_10100658
638 Ga0207709_10001846
639 Ga0207709_10061308
640 Ga0207670_10007621
641 Ga0207669_10028203
642 Ga0207704_10013529
643 Ga0207665_10054639
644 Ga0207691_10003130
645 Ga0207711_10019260
646 Ga0207711_10225526
647 Ga0207689_10058972
648 Ga0207689_10347403
649 Ga0207679_10024990
650 Ga0207667_10000012
651 Ga0207667_10737135
652 Ga0207651_10107775
653 Ga0207651_10408276
654 Ga0207712_10040737
655 Ga0207640_10031808
656 Ga0207658_10006728
657 Ga0207658_10017886
658 Ga0207677_10016712
659 Ga0207677_10250301
660 Ga0207703_10013541
661 Ga0207703_10114971
662 Ga0207639_10070675
663 Ga0207678_10004746
664 Ga0207678_10012232
665 Ga0207678_10511825
666 Ga0207708_10008657
667 Ga0207641_10003939
668 Ga0207641_10020291
669 Ga0207648_10007865
670 Ga0207648_10024877
671 Ga0207648_10117666
672 Ga0207676_10005245
673 Ga0207676_10277187
674 Ga0207676_10841044
675 Ga0207674_10050028
676 Ga0207674_10115378
677 Ga0207674_10218747
678 Ga0207674_10334060
679 Ga0207675_100095041
680 Ga0207675_100097991
681 Ga0207683_10003263
682 Ga0209813_10006275
683 Ga0207428_10030681
684 Ga0268266_10085346
685 Ga0268266_10099409
686 Ga0268266_10199025
687 Ga0268264_10010074
688 Ga0268264_10025336
689 Ga0268264_10055624
690 Ga0268264_10080796
691 Ga0268264_10751892
692 Ga0265330_10061730
693 Ga0265332_10000862
694 Ga0265325_10001844
695 Ga0265329_10012413
696 Ga0265340_10002878
697 Ga0265340_10013718
698 Ga0265339_10003663
699 Ga0265339_10063580
700 Ga0307513_10070846
701 Ga0307513_10228170
702 Ga0307408_100006884
703 Ga0265342_10000026
704 Ga0307405_10031277
705 Ga0307413_10001435
706 Ga0307413_10316856
707 Ga0307410_10002546
708 Ga0307406_10033196
709 Ga0307407_10002287
710 Ga0307412_10101389
711 Ga0307416_100093208
712 Ga0307414_10004431
713 Ga0307414_10009034
714 Ga0307415_100240355
715 Ga0373934_0055583
716 Ga0373944_0081375
717 Ga0373923_0084095
718 Ga0373954_0183815
719 Ga0373946_0051913
720 Ga0373955_0009392
721 Ga0373931_0056698
722 Ga0373935_0096292
723 Ga0373935_0189357
724 Ga0373927_0142239
725 Ga0373937_0001755
726 Ga0395899_0188321
727 Ga0395900_0000628
728 Ga0395900_0019431
729 Ga0395900_0497347
730 Ga0395898_0000344
731 Ga0395901_0000090
732 Ga0395901_1054813
733 Ga0436365_0429551
734 Ga0436361_0472237
735 Ga0436362_1270913
736 Ga0451793_0788817
737 Ga0451800_1442347
738 Ga0451802_1757643
739 Ga0451807_2227500
740 Ga0466969_0023732
741 Ga0466966_0008308
742 Ga0466966_0011699
743 Ga0466963_0073605
744 Ga0466971_0000418
745 Ga0466957_0015680
746 Ga0466960_0059723
747 Ga0466960_0149853
748 Ga0495603_0164009
749 Ga0495590_0126637
750 Ga0495580_0096849
751 Ga0495605_0132147
752 Ga0495662_0014946
753 Ga0495584_0146372
754 Ga0495585_0025880
755 Ga0495607_0025673
756 Ga0495630_0057621
757 Ga0495644_0037924
758 Ga0495666_0118566
759 Ga0495598_0002463
760 Ga0495633_0029797
761 Ga0495656_0002141
762 Ga0495668_0098724
763 Ga0495634_0021067
764 Ga0495659_0019917
765 Ga0495647_0119323
766 Ga0495669_0032836
767 Ga0495670_0015435
768 Ga0495670_0233259
769 Ga0495581_0103107
770 Ga0495604_0283197
771 Ga0495681_0117040
772 Ga0495684_0141067
773 Ga0495686_0170352
774 Ga0496100_0019742
775 Ga0496100_0073267
776 Ga0496101_0007611
777 Ga0496102_0039596
778 Ga0496102_0156194
779 Ga0496102_0341054
780 Ga0496103_0004579
781 Ga0496103_0073733
782 Ga0496104_0022809
783 Ga0496104_0024666
784 Ga0496105_0006961
785 Ga0496105_0032767
786 Ga0496106_0067499
787 Ga0496106_0301488
788 Ga0496106_0534167
789 Ga0496107_0012293
790 Ga0496108_0028935
791 Ga0496108_0078471
792 Ga0496109_0007580
793 Ga0496110_0016118
794 Ga0496110_0261903
795 Ga0496111_0012152
796 Ga0496111_0015182
797 Ga0496111_0438777
798 Ga0496112_0021123
799 Ga0496112_0074035
800 Ga0496112_0075542
801 Ga0496112_0550111
802 Ga0496113_0000285
803 Ga0496113_0006001
804 Ga0496114_0041384
805 Ga0496114_0506743
806 Ga0496115_0044509
807 Ga0496115_0086717
808 Ga0496116_0213829
809 Ga0496118_0026107
810 Ga0496126_0337856
811 Ga0501299_000287
812 Ga0501031_0003284
813 Ga0501032_0042196
814 Ga0501032_0068395
815 Ga0501032_0202649
816 Ga0501034_0025883
817 Ga0501034_0134059
818 Ga0501036_0355027
819 Ga0501037_0353710
820 Ga0501040_0000016
821 Ga0501042_0000046
822 Ga0501047_0007850
823 Ga0501047_0052686
824 Ga0501047_0103264
825 Ga0501047_0205317
826 Ga0501068_0002896
827 Ga0501070_0006543
828 Ga0501070_0038509
829 Ga0501072_0003361
830 Ga0501072_0466953
831 Ga0501073_0008018
832 Ga0501073_0035316
833 Ga0501074_0218932
834 Ga0501076_0267180
835 Ga0501243_038944
836 Ga0501248_003813
837 Ga0501225_0028722
838 Ga0501079_0079582
839 Ga0501080_0022991
840 Ga0501080_0068285
841 Ga0501080_0195329
842 Ga0501083_0030599
843 Ga0501083_0276534
844 Ga0501035_0006933
845 Ga0501035_0067367
846 Ga0501035_0104954
847 Ga0501035_0344212
848 Ga0501044_0001583
849 Ga0501044_0012377
850 Ga0501044_0023884
851 Ga0501044_0181661
852 Ga0501045_0027528
853 Ga0501212_012728
854 nmdc:mga03n38_6071_c1
855 nmdc:mga06z11_1859_c1
856 nmdc:mga06z11_326784_c1
857 nmdc:mga04h51_7163_c1
858 nmdc:mga07m45_68551_c1
859 nmdc:mga05p37_128129_c1
860 nmdc:mga05p37_192613_c1
861 nmdc:mga05p37_608779_c1
862 nmdc:mga09592_147252_c1
863 nmdc:mga08y16_18900_c1
864 nmdc:mga0n895_27362_c1
865 nmdc:mga0a205_10686_c1
866 nmdc:mga0a205_285311_c1
867 nmdc:mga0a205_57638_c1
868 nmdc:mga0sz30_19482_c1
869 Ga0500644_0046736
870 Ga0500583_0111165
871 Ga0500555_000634
872 Ga0500616_0000874
873 Ga0500622_0005759
874 Ga0500645_000044
875 Ga0501084_0005623
876 Ga0501084_0212804
877 Ga0501082_0303925
878 Ga0466962_0036059
879 Ga0466962_0111275
880 2545676479
881 2723878869
882 2758640953
883 2841764432
884 2841916282
885 2841921049
886 2844108120
887 2851188050
888 2851250226
889 2852654197
890 2854914292
891 2857580681
892 2888367502
893 641641336
894 643664280
895 8004594187
896 8057533498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

69

239

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e1r-assembly2.cif.gz_E crystal structure of pecan (carya illinoinensis) vicilin, a new food allergen 0.7525 141 244
3smh-assembly2.cif.gz_F crystal structure of major peanut allergen ara h 1 0.7351 141 244
6yw4-assembly1.cif.gz_A hif prolyl hydroxylase 2 (phd2/ egln1) in complex with n-oxalylglycine (nog) and a rapid-derived silent allosteric cyclic peptide 3c (14-mer) 0.7336 31 244
5la9-assembly2.cif.gz_B hif prolyl hydroxylase 2 (phd2-r281c/v314c) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-2) 0.7318 21 249
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.7299 140 247
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9598 84 250 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9273 84 250 2.60.120.590
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7268 140 246 2.60.120.10
af_Q9FLT3_18_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6969 140 244 2.60.120.10
af_Q54PP0_7_193_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6926 40 244 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A6L3SU19-F1-model_v4 2OG-Fe(II) oxygenase 0.9992 44 251 GO:0016491
GO:0046872
AF-A0A017TEZ0-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9991 23 251
AF-A0A1W9IQ22-F1-model_v4 Proline hydroxylase 0.9983 23 251
AF-A0A7Y4KH36-F1-model_v4 2OG-Fe(II) oxygenase 0.9983 28 251
AF-A0A125LA53-F1-model_v4 deleted 0.9977 23 251

Map