F446186

General Info

Members Datasets Scaffolds Average Seq Length
448 242 896 149

Family's Representative Sequence

Representative Sequence 3300028017|Ga0265356_1009347|Ga0265356_10093471
Length 166
Sequence MVYLQHPKRGRWQRSNLMRAVVQRVSRAQVSVGNEIVGQIGLGFLVLLGVARDDSESDATYLAGKIAGLRIFEDDQGKMNRSPLEAGASVLAVSQFTLYGDVRRGKRPSFDAAAPPDKARLLYEFFVDQIRALGLPCETGRFQATMKVELVNEGPVTILLDSQKAF

Samples

Sample ID Description Type Environment
1 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
195 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
196 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 8.26
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 19.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265356_1009347 3300028017 Bacteria 1105
2 rootH2_10112388 3300003320 Bacteria 4503
3 JGI25407J50210_10151511 3300003373 Bacteria 571
4 Ga0065704_10290066 3300005289 Unclassified 905
5 Ga0065715_10147367 3300005293 Unclassified 1759
6 Ga0065715_10596453 3300005293 Bacteria 710
7 Ga0065707_10000637 3300005295 Bacteria 16411
8 Ga0070658_10055855 3300005327 Unclassified 3208
9 Ga0070658_10949354 3300005327 Unclassified 748
10 Ga0070658_11396316 3300005327 Unclassified 608
11 Ga0070683_100001992 3300005329 Bacteria 16016
12 Ga0070683_100031462 3300005329 Bacteria 4825
13 Ga0070683_100125515 3300005329 Unclassified 2426
14 Ga0070683_101142054 3300005329 Bacteria 748
15 Ga0070690_100006748 3300005330 Bacteria 6523
16 Ga0070690_100023037 3300005330 Unclassified 3815
17 Ga0070670_100084207 3300005331 Bacteria 2732
18 Ga0070670_100379276 3300005331 Bacteria 1246
19 Ga0068869_100009104 3300005334 Bacteria 6432
20 Ga0068869_100037785 3300005334 Bacteria 3435
21 Ga0070666_10101171 3300005335 Bacteria 1986
22 Ga0070666_10400733 3300005335 Unclassified 986
23 Ga0070680_100581984 3300005336 Bacteria 960
24 Ga0070682_100124771 3300005337 Bacteria 1734
25 Ga0070682_101431823 3300005337 Bacteria 592
26 Ga0068868_100006962 3300005338 Bacteria 8037
27 Ga0068868_100022883 3300005338 Bacteria 4724
28 Ga0068868_100545356 3300005338 Bacteria 1021
29 Ga0070660_100041640 3300005339 Bacteria 3501
30 Ga0070660_100084185 3300005339 Bacteria 2499
31 Ga0070660_100134629 3300005339 Bacteria 1979
32 Ga0070689_100121289 3300005340 Bacteria 2088
33 Ga0070689_100143098 3300005340 Bacteria 1924
34 Ga0070689_100299151 3300005340 Bacteria 1339
35 Ga0070691_10171328 3300005341 Bacteria 1125
36 Ga0070691_10511622 3300005341 Unclassified 696
37 Ga0070687_100822144 3300005343 Unclassified 660
38 Ga0070661_100027027 3300005344 Bacteria 4130
39 Ga0070661_100570084 3300005344 Bacteria 913
40 Ga0070692_10021479 3300005345 Bacteria 3141
41 Ga0070668_100023183 3300005347 Bacteria 4693
42 Ga0070669_100018022 3300005353 Bacteria 5044
43 Ga0070669_100085971 3300005353 Bacteria 2349
44 Ga0070669_100106955 3300005353 Unclassified 2118
45 Ga0070669_101005530 3300005353 Unclassified 715
46 Ga0070675_100014681 3300005354 Bacteria 6178
47 Ga0070675_100026692 3300005354 Unclassified 4634
48 Ga0070671_100083134 3300005355 Bacteria 2677
49 Ga0070671_101610779 3300005355 Unclassified 575
50 Ga0070673_100019083 3300005364 Unclassified 4919
51 Ga0070673_100121333 3300005364 Bacteria 2181
52 Ga0070688_100047369 3300005365 Bacteria 2666
53 Ga0070659_100052103 3300005366 Bacteria 3218
54 Ga0070659_100056466 3300005366 Bacteria 3095
55 Ga0070659_100085383 3300005366 Bacteria 2524
56 Ga0070667_100232141 3300005367 Bacteria 1645
57 Ga0070667_101241536 3300005367 Bacteria 698
58 Ga0070709_10343686 3300005434 Unclassified 1101
59 Ga0070714_100000105 3300005435 Bacteria 70871
60 Ga0070714_100396136 3300005435 Unclassified 1304
61 Ga0070714_100479324 3300005435 Bacteria 1184
62 Ga0070713_100170070 3300005436 Bacteria 1952
63 Ga0070701_10117854 3300005438 Bacteria 1492
64 Ga0070705_100407168 3300005440 Bacteria 1009
65 Ga0070700_100041698 3300005441 Unclassified 2815
66 Ga0070700_100146286 3300005441 Bacteria 1611
67 Ga0070694_100113868 3300005444 Bacteria 1931
68 Ga0070694_100500314 3300005444 Unclassified 967
69 Ga0070663_100014043 3300005455 Bacteria 5130
70 Ga0070663_100474624 3300005455 Bacteria 1034
71 Ga0070678_100070320 3300005456 Bacteria 2616
72 Ga0070678_100397522 3300005456 Unclassified 1196
73 Ga0070662_100000369 3300005457 Bacteria 26852
74 Ga0070662_100045832 3300005457 Bacteria 3139
75 Ga0070681_10020665 3300005458 Bacteria 6596
76 Ga0070681_10056739 3300005458 Bacteria 3897
77 Ga0068867_100010269 3300005459 Bacteria 6606
78 Ga0068867_100025533 3300005459 Bacteria 4239
79 Ga0070685_10002867 3300005466 Bacteria 8816
80 Ga0070685_10203632 3300005466 Bacteria 1288
81 Ga0070707_100195013 3300005468 Bacteria 1975
82 Ga0070698_102096620 3300005471 Unclassified 519
83 Ga0070679_100002860 3300005530 Bacteria 15689
84 Ga0070684_100024040 3300005535 Bacteria 5107
85 Ga0070684_100040538 3300005535 Unclassified 4011
86 Ga0068853_100042908 3300005539 Bacteria 3869
87 Ga0068853_100894289 3300005539 Unclassified 853
88 Ga0070672_100008845 3300005543 Bacteria 6916
89 Ga0070672_100139260 3300005543 Bacteria 2000
90 Ga0070686_100032265 3300005544 Bacteria 3209
91 Ga0070686_101197534 3300005544 Bacteria 631
92 Ga0070695_100098489 3300005545 Bacteria 1965
93 Ga0070695_100150809 3300005545 Bacteria 1622
94 Ga0070696_100315516 3300005546 Bacteria 1201
95 Ga0070696_100341606 3300005546 Bacteria 1157
96 Ga0070693_100018522 3300005547 Bacteria 3639
97 Ga0070665_100013657 3300005548 Bacteria 8169
98 Ga0070704_100231189 3300005549 Bacteria 1509
99 Ga0068855_100003203 3300005563 Bacteria 20029
100 Ga0068855_100011531 3300005563 Bacteria 10679
101 Ga0068855_100147975 3300005563 Bacteria 2672
102 Ga0068855_100907290 3300005563 Bacteria 930
103 Ga0070664_100056563 3300005564 Bacteria 3333
104 Ga0070664_100083403 3300005564 Bacteria 2757
105 Ga0068857_100048426 3300005577 Unclassified 3773
106 Ga0068857_100268568 3300005577 Unclassified 1567
107 Ga0068857_100420068 3300005577 Bacteria 1247
108 Ga0068854_100002631 3300005578 Bacteria 11132
109 Ga0068854_100124761 3300005578 Bacteria 1959
110 Ga0068856_100382690 3300005614 Bacteria 1426
111 Ga0068856_101794227 3300005614 Bacteria 625
112 Ga0070702_100073842 3300005615 Bacteria 2022
113 Ga0070702_100223745 3300005615 Bacteria 1260
114 Ga0068852_100000157 3300005616 Bacteria 45299
115 Ga0068852_100046072 3300005616 Bacteria 3713
116 Ga0068852_102666505 3300005616 Bacteria 519
117 Ga0068859_100027502 3300005617 Bacteria 5704
118 Ga0068864_100369607 3300005618 Bacteria 1357
119 Ga0068866_10001973 3300005718 Bacteria 8549
120 Ga0068866_10088759 3300005718 Bacteria 1678
121 Ga0068861_100033807 3300005719 Bacteria 3775
122 Ga0068861_100257145 3300005719 Bacteria 1493
123 Ga0068851_10012545 3300005834 Bacteria 3997
124 Ga0068851_10051231 3300005834 Bacteria 2097
125 Ga0068863_100299335 3300005841 Bacteria 1560
126 Ga0068858_100169309 3300005842 Unclassified 2059
127 Ga0068858_100283266 3300005842 Bacteria 1578
128 Ga0068860_100013965 3300005843 Bacteria 7874
129 Ga0068860_100428794 3300005843 Bacteria 1312
130 Ga0068862_100034135 3300005844 Bacteria 4303
131 Ga0068862_100049843 3300005844 Bacteria 3577
132 Ga0070717_11199606 3300006028 Unclassified 691
133 Ga0075365_10593932 3300006038 Bacteria 783
134 Ga0070716_100021051 3300006173 Bacteria 3432
135 Ga0070716_100052177 3300006173 Bacteria 2328
136 Ga0097621_100047384 3300006237 Bacteria 3483
137 Ga0068871_100013727 3300006358 Bacteria 6022
138 Ga0068871_100172709 3300006358 Bacteria 1854
139 Ga0068871_100199978 3300006358 Bacteria 1725
140 Ga0075429_101444705 3300006880 Unclassified 599
141 Ga0068865_100134094 3300006881 Bacteria 1858
142 Ga0097620_100027502 3300006931 Bacteria 5704
143 Ga0075435_100677565 3300007076 Bacteria 896
144 Ga0099795_10105549 3300007788 Unclassified 1110
145 Ga0105251_10184745 3300009011 Unclassified 939
146 Ga0105240_10000110 3300009093 Bacteria 171018
147 Ga0105240_10066640 3300009093 Bacteria 4465
148 Ga0105240_10080601 3300009093 Bacteria 4003
149 Ga0105240_10500690 3300009093 Unclassified 1351
150 Ga0105240_11409585 3300009093 Unclassified 732
151 Ga0111539_10013394 3300009094 Bacteria 10253
152 Ga0105245_10001481 3300009098 Bacteria 21209
153 Ga0105245_10077138 3300009098 Bacteria 3037
154 Ga0105247_10010167 3300009101 Bacteria 5699
155 Ga0105247_10026217 3300009101 Unclassified 3518
156 Ga0105247_10148371 3300009101 Bacteria 1543
157 Ga0114129_10927899 3300009147 Bacteria 1101
158 Ga0114129_11364305 3300009147 Bacteria 876
159 Ga0105243_10022276 3300009148 Bacteria 4813
160 Ga0105241_10017249 3300009174 Bacteria 5305
161 Ga0105241_10025585 3300009174 Unclassified 4387
162 Ga0105241_10238849 3300009174 Bacteria 1535
163 Ga0105241_10270551 3300009174 Bacteria 1447
164 Ga0105242_10003190 3300009176 Bacteria 12783
165 Ga0105242_10034770 3300009176 Bacteria 4040
166 Ga0105248_10054795 3300009177 Bacteria 4473
167 Ga0105248_10151365 3300009177 Bacteria 2617
168 Ga0105237_10132334 3300009545 Unclassified 2488
169 Ga0105237_10299337 3300009545 Bacteria 1612
170 Ga0105238_10056881 3300009551 Bacteria 3923
171 Ga0105249_10039402 3300009553 Bacteria 4290
172 Ga0105249_12864326 3300009553 Bacteria 553
173 Ga0105239_10028233 3300010375 Bacteria 6172
174 Ga0105239_10049083 3300010375 Bacteria 4627
175 Ga0105239_10728443 3300010375 Bacteria 1135
176 Ga0105239_10781064 3300010375 Unclassified 1094
177 Ga0105246_10039129 3300011119 Unclassified 3192
178 Ga0105246_10039292 3300011119 Bacteria 3186
179 Ga0157373_10467845 3300013100 Bacteria 909
180 Ga0157371_10012223 3300013102 Bacteria 6573
181 Ga0157371_10012705 3300013102 Bacteria 6424
182 Ga0157371_10141049 3300013102 Bacteria 1716
183 Ga0157370_10000001 3300013104 Bacteria 529517
184 Ga0157369_10000017 3300013105 Bacteria 246520
185 Ga0157369_10023279 3300013105 Bacteria 6901
186 Ga0157369_10066695 3300013105 Bacteria 3871
187 Ga0157369_10068012 3300013105 Bacteria 3827
188 Ga0157374_10009922 3300013296 Bacteria 8176
189 Ga0157374_10083487 3300013296 Unclassified 3035
190 Ga0157374_11266545 3300013296 Unclassified 759
191 Ga0157374_11831045 3300013296 Unclassified 632
192 Ga0157378_10180858 3300013297 Bacteria 1984
193 Ga0157378_10608455 3300013297 Bacteria 1105
194 Ga0157378_10974617 3300013297 Unclassified 881
195 Ga0163162_10011068 3300013306 Bacteria 8789
196 Ga0157372_10000019 3300013307 Bacteria 209591
197 Ga0157372_10043322 3300013307 Bacteria 4982
198 Ga0157372_10286208 3300013307 Bacteria 1917
199 Ga0157372_10786627 3300013307 Unclassified 1106
200 Ga0157372_12989210 3300013307 Unclassified 541
201 Ga0157375_10958407 3300013308 Bacteria 997
202 Ga0157375_12361618 3300013308 Unclassified 634
203 Ga0163163_10016461 3300014325 Bacteria 6875
204 Ga0163163_11014775 3300014325 Bacteria 893
205 Ga0157380_10020084 3300014326 Unclassified 4989
206 Ga0182008_10057561 3300014497 Bacteria 1919
207 Ga0157377_10396824 3300014745 Bacteria 938
208 Ga0157379_10001261 3300014968 Bacteria 20577
209 Ga0157379_10185841 3300014968 Bacteria 1878
210 Ga0157376_10035189 3300014969 Bacteria 4050
211 Ga0157376_10122169 3300014969 Bacteria 2310
212 Ga0182006_1126275 3300015261 Bacteria 884
213 Ga0182007_10007337 3300015262 Bacteria 4631
214 Ga0163161_10012728 3300017792 Bacteria 5843
215 Ga0206356_10773933 3300020070 Unclassified 1030
216 Ga0207656_10080181 3300025321 Unclassified 1465
217 Ga0207656_10149507 3300025321 Bacteria 1105
218 Ga0207642_10012538 3300025899 Bacteria 3063
219 Ga0207710_10077104 3300025900 Bacteria 1539
220 Ga0207710_10124715 3300025900 Unclassified 1233
221 Ga0207710_10196337 3300025900 Bacteria 995
222 Ga0207688_10038592 3300025901 Bacteria 2651
223 Ga0207680_10021976 3300025903 Bacteria 3462
224 Ga0207647_10016486 3300025904 Bacteria 5043
225 Ga0207645_10023159 3300025907 Bacteria 4037
226 Ga0207705_11155952 3300025909 Unclassified 595
227 Ga0207684_10775712 3300025910 Bacteria 811
228 Ga0207654_10316507 3300025911 Bacteria 1065
229 Ga0207654_10940009 3300025911 Bacteria 628
230 Ga0207707_10094923 3300025912 Bacteria 2606
231 Ga0207707_10159682 3300025912 Unclassified 1971
232 Ga0207707_10430672 3300025912 Unclassified 1130
233 Ga0207707_10590242 3300025912 Bacteria 941
234 Ga0207695_10000026 3300025913 Bacteria 624558
235 Ga0207695_10033933 3300025913 Bacteria 5556
236 Ga0207695_10033945 3300025913 Bacteria 5555
237 Ga0207671_10065551 3300025914 Bacteria 2702
238 Ga0207660_10079514 3300025917 Unclassified 2405
239 Ga0207662_10011639 3300025918 Bacteria 4886
240 Ga0207657_10001462 3300025919 Bacteria 25299
241 Ga0207657_10002123 3300025919 Bacteria 21455
242 Ga0207657_10002523 3300025919 Bacteria 19800
243 Ga0207657_11037471 3300025919 Bacteria 628
244 Ga0207649_10002050 3300025920 Bacteria 11460
245 Ga0207649_10157062 3300025920 Bacteria 1572
246 Ga0207649_10464170 3300025920 Bacteria 958
247 Ga0207652_10156194 3300025921 Unclassified 2044
248 Ga0207652_10495375 3300025921 Bacteria 1100
249 Ga0207681_10037927 3300025923 Bacteria 3188
250 Ga0207681_10090969 3300025923 Bacteria 2179
251 Ga0207681_10573072 3300025923 Bacteria 931
252 Ga0207694_10095507 3300025924 Bacteria 2350
253 Ga0207694_10165623 3300025924 Bacteria 1787
254 Ga0207650_10000072 3300025925 Bacteria 137765
255 Ga0207650_10000078 3300025925 Bacteria 130954
256 Ga0207659_10049155 3300025926 Bacteria 2990
257 Ga0207659_10115651 3300025926 Bacteria 2046
258 Ga0207659_11329353 3300025926 Unclassified 617
259 Ga0207687_10001753 3300025927 Bacteria 14922
260 Ga0207687_10037588 3300025927 Bacteria 3304
261 Ga0207700_10114839 3300025928 Bacteria 2173
262 Ga0207700_10344509 3300025928 Bacteria 1296
263 Ga0207664_10000406 3300025929 Bacteria 30847
264 Ga0207664_10249127 3300025929 Unclassified 1550
265 Ga0207644_10139963 3300025931 Bacteria 1862
266 Ga0207644_10380342 3300025931 Unclassified 1151
267 Ga0207690_10136892 3300025932 Bacteria 1799
268 Ga0207690_10141508 3300025932 Bacteria 1773
269 Ga0207690_10429458 3300025932 Bacteria 1058
270 Ga0207706_10000556 3300025933 Bacteria 39738
271 Ga0207706_10000888 3300025933 Bacteria 30709
272 Ga0207706_10021262 3300025933 Bacteria 5829
273 Ga0207686_10434992 3300025934 Unclassified 1006
274 Ga0207686_10480766 3300025934 Bacteria 960
275 Ga0207670_10023478 3300025936 Bacteria 3840
276 Ga0207670_10078857 3300025936 Bacteria 2298
277 Ga0207670_11280145 3300025936 Bacteria 621
278 Ga0207704_10933204 3300025938 Unclassified 731
279 Ga0207665_10048171 3300025939 Unclassified 2859
280 Ga0207665_10320993 3300025939 Bacteria 1162
281 Ga0207691_10000924 3300025940 Bacteria 29147
282 Ga0207691_10188023 3300025940 Bacteria 1802
283 Ga0207711_10004011 3300025941 Bacteria 12641
284 Ga0207711_10042945 3300025941 Bacteria 3854
285 Ga0207711_11024896 3300025941 Unclassified 765
286 Ga0207689_10003024 3300025942 Bacteria 15494
287 Ga0207689_10006007 3300025942 Bacteria 10740
288 Ga0207689_10961177 3300025942 Unclassified 721
289 Ga0207661_10002234 3300025944 Bacteria 13359
290 Ga0207661_10543086 3300025944 Bacteria 1064
291 Ga0207661_11257667 3300025944 Bacteria 680
292 Ga0207679_10000398 3300025945 Bacteria 31173
293 Ga0207679_10000792 3300025945 Bacteria 20692
294 Ga0207679_10025977 3300025945 Bacteria 4033
295 Ga0207679_10172439 3300025945 Bacteria 1782
296 Ga0207667_10003259 3300025949 Bacteria 20031
297 Ga0207667_10019709 3300025949 Bacteria 7519
298 Ga0207667_10104785 3300025949 Bacteria 2917
299 Ga0207667_10264423 3300025949 Bacteria 1759
300 Ga0207651_10010730 3300025960 Bacteria 5090
301 Ga0207712_10003108 3300025961 Bacteria 10591
302 Ga0207712_10036992 3300025961 Bacteria 3327
303 Ga0207712_10628139 3300025961 Bacteria 932
304 Ga0207668_10007634 3300025972 Bacteria 6438
305 Ga0207668_11162677 3300025972 Bacteria 693
306 Ga0207640_10001804 3300025981 Bacteria 11492
307 Ga0207640_10166835 3300025981 Unclassified 1636
308 Ga0207658_10031705 3300025986 Unclassified 3755
309 Ga0207658_10763247 3300025986 Bacteria 876
310 Ga0207677_10016474 3300026023 Bacteria 4381
311 Ga0207703_10058377 3300026035 Unclassified 3149
312 Ga0207703_10125226 3300026035 Bacteria 2211
313 Ga0207639_10104557 3300026041 Unclassified 2296
314 Ga0207639_10110919 3300026041 Bacteria 2235
315 Ga0207639_10448219 3300026041 Unclassified 1171
316 Ga0207678_10000277 3300026067 Bacteria 46368
317 Ga0207678_10004462 3300026067 Bacteria 12586
318 Ga0207708_10086486 3300026075 Bacteria 2413
319 Ga0207702_10013510 3300026078 Bacteria 6782
320 Ga0207702_10109682 3300026078 Bacteria 2451
321 Ga0207702_11696158 3300026078 Bacteria 625
322 Ga0207641_10000237 3300026088 Bacteria 71168
323 Ga0207641_10078311 3300026088 Bacteria 2863
324 Ga0207648_10001291 3300026089 Bacteria 27933
325 Ga0207648_10006494 3300026089 Bacteria 11611
326 Ga0207676_10000050 3300026095 Bacteria 133298
327 Ga0207676_10625813 3300026095 Bacteria 1036
328 Ga0207676_11492200 3300026095 Bacteria 673
329 Ga0207674_10000130 3300026116 Bacteria 88123
330 Ga0207674_10091983 3300026116 Bacteria 3023
331 Ga0207674_10191569 3300026116 Unclassified 1995
332 Ga0207675_100034988 3300026118 Bacteria 4684
333 Ga0207675_100382039 3300026118 Bacteria 1385
334 Ga0207683_10002739 3300026121 Bacteria 15395
335 Ga0207683_10048061 3300026121 Bacteria 3737
336 Ga0207683_10604616 3300026121 Unclassified 1015
337 Ga0207698_10000018 3300026142 Bacteria 176540
338 Ga0207698_10051971 3300026142 Bacteria 3136
339 Ga0207698_10233130 3300026142 Bacteria 1672
340 Ga0209998_10012103 3300027717 Bacteria 1790
341 Ga0207428_10078593 3300027907 Bacteria 2581
342 Ga0268266_10018040 3300028379 Bacteria 6014
343 Ga0268266_10665455 3300028379 Unclassified 1002
344 Ga0268265_10029866 3300028380 Unclassified 3920
345 Ga0268265_10037377 3300028380 Bacteria 3563
346 Ga0268265_11144666 3300028380 Bacteria 774
347 Ga0268264_10980262 3300028381 Bacteria 851
348 Ga0268264_11050088 3300028381 Unclassified 822
349 Ga0265324_10000045 3300029957 Bacteria 107095
350 Ga0265762_1024505 3300030760 Bacteria 1122
351 Ga0265770_1015329 3300030878 Bacteria 1165
352 Ga0265765_1021441 3300030879 Bacteria 784
353 Ga0265760_10011718 3300031090 Bacteria 2505
354 Ga0265760_10118999 3300031090 Bacteria 846
355 Ga0265332_10110144 3300031238 Bacteria 1160
356 Ga0265328_10023610 3300031239 Bacteria 2331
357 Ga0265325_10002356 3300031241 Bacteria 12788
358 Ga0265325_10002758 3300031241 Bacteria 11735
359 Ga0265340_10095345 3300031247 Bacteria 1387
360 Ga0265339_10000002 3300031249 Bacteria 416322
361 Ga0265331_10009813 3300031250 Bacteria 5340
362 Ga0265327_10015554 3300031251 Bacteria 4901
363 Ga0265316_10026323 3300031344 Bacteria 4840
364 Ga0265313_10006225 3300031595 Bacteria 8521
365 Ga0265313_10022218 3300031595 Bacteria 3447
366 Ga0265314_10051442 3300031711 Unclassified 2869
367 Ga0265342_10014936 3300031712 Bacteria 5133
368 Ga0265342_10040566 3300031712 Bacteria 2823
369 Ga0316576_10288445 3300031727 Unclassified 1228
370 Ga0316578_10204255 3300031728 Unclassified 1189
371 Ga0316577_10186754 3300031733 Unclassified 1171
372 Ga0316580_10069318 3300032139 Unclassified 1080
373 Ga0316214_1031603 3300033545 Bacteria 752
374 Ga0373954_0073427 3300035118 Bacteria 1628
375 Ga0373957_0204260 3300035120 Unclassified 824
376 Ga0373955_0357594 3300035172 Unclassified 885
377 Ga0373942_0088540 3300035207 Bacteria 930
378 Ga0373961_0055506 3300035241 Bacteria 1187
379 Ga0373931_0003282 3300035691 Bacteria 7240
380 Ga0373937_0712147 3300036401 Unclassified 951
381 Ga0316584_0516335 3300036712 Unclassified 838
382 Ga0373925_1180403 3300037068 Bacteria 629
383 Ga0451577_0324923 3300042876 Bacteria 1395
384 Ga0453684_0228955 3300044712 Bacteria 2147
385 Ga0453684_0266686 3300044712 Bacteria 1959
386 Ga0453684_0392650 3300044712 Bacteria 1556
387 Ga0453684_0986219 3300044712 Bacteria 897
388 Ga0466958_0773233 3300045836 Bacteria 626
389 Ga0466967_1799654 3300045976 Bacteria 610
390 Ga0495651_0066346 3300046462 Unclassified 2755
391 Ga0495587_0006250 3300046536 Bacteria 7777
392 Ga0495657_0217027 3300046675 Unclassified 1161
393 Ga0495669_0158383 3300046684 Unclassified 1074
394 Ga0495604_0255161 3300047317 Bacteria 1194
395 Ga0496100_0026440 3300048903 Unclassified 3559
396 Ga0496100_0120753 3300048903 Bacteria 1833
397 Ga0496101_0427815 3300048904 Bacteria 1044
398 Ga0496102_0008366 3300048905 Bacteria 8860
399 Ga0496102_0100727 3300048905 Bacteria 2683
400 Ga0496102_0356233 3300048905 Bacteria 1377
401 Ga0496102_0662775 3300048905 Bacteria 966
402 Ga0496103_0017449 3300048906 Bacteria 4295
403 Ga0496103_0027477 3300048906 Bacteria 3448
404 Ga0496103_0084287 3300048906 Bacteria 2002
405 Ga0496104_0113154 3300048907 Bacteria 2603
406 Ga0496104_0330692 3300048907 Unclassified 1437
407 Ga0496104_0338974 3300048907 Bacteria 1416
408 Ga0496104_0464320 3300048907 Bacteria 1177
409 Ga0496105_0209562 3300048908 Bacteria 1589
410 Ga0496105_0257315 3300048908 Bacteria 1413
411 Ga0496105_0466552 3300048908 Bacteria 995
412 Ga0496106_0117734 3300048909 Bacteria 2074
413 Ga0496106_0363715 3300048909 Bacteria 1162
414 Ga0496106_0703086 3300048909 Bacteria 805
415 Ga0496106_0960667 3300048909 Bacteria 673
416 Ga0496108_0000106 3300048911 Bacteria 87028
417 Ga0496108_0169764 3300048911 Bacteria 1887
418 Ga0496108_0257726 3300048911 Unclassified 1518
419 Ga0496109_0000133 3300048912 Bacteria 76299
420 Ga0496109_0754839 3300048912 Bacteria 910
421 Ga0496110_0001098 3300048913 Bacteria 19076
422 Ga0496110_0050104 3300048913 Bacteria 3666
423 Ga0496110_0050158 3300048913 Bacteria 3664
424 Ga0496111_0004523 3300048914 Bacteria 8799
425 Ga0496111_0017370 3300048914 Bacteria 4975
426 Ga0496111_0058365 3300048914 Bacteria 2794
427 Ga0496112_0000028 3300048915 Bacteria 130942
428 Ga0496112_0031990 3300048915 Bacteria 5107
429 Ga0496112_0134936 3300048915 Bacteria 2438
430 Ga0496113_0001934 3300048916 Bacteria 11859
431 Ga0496114_0602837 3300048917 Bacteria 968
432 Ga0501039_0314057 3300049575 Bacteria 1232
433 Ga0501076_0167990 3300049592 Bacteria 1788
434 Ga0501083_0574405 3300049744 Bacteria 734
435 nmdc:mga0yw44_296157_c1 3300050492 Bacteria 1083
436 nmdc:mga05p37_1018105_c1 3300050507 Bacteria 878
437 nmdc:mga05p37_1499377_c1 3300050507 Bacteria 671
438 nmdc:mga05p37_25994_c1 3300050507 Bacteria 7117
439 nmdc:mga09592_615529_c1 3300050508 Bacteria 929
440 nmdc:mga08y16_9554_c1 3300050511 Bacteria 10179
441 nmdc:mga0rr50_401155_c1 3300050513 Bacteria 1158
442 Ga0501084_0311354 3300054114 Bacteria 1330
443 Ga0501084_1853542 3300054114 Bacteria 503
444 Ga0590071_004651 3300059421 Bacteria 3319
445 Ga0590074_003077 3300059423 Bacteria 2754
446 Ga0590075_001137 3300059424 Bacteria 6770
447 Ga0590077_000405 3300059426 Bacteria 12109
448 Ga0466962_0611396 3300061719 Bacteria 556
449 Ga0265356_1009347
450 rootH2_10112388
451 JGI25407J50210_10151511
452 Ga0065704_10290066
453 Ga0065715_10147367
454 Ga0065715_10596453
455 Ga0065707_10000637
456 Ga0070658_10055855
457 Ga0070658_10949354
458 Ga0070658_11396316
459 Ga0070683_100001992
460 Ga0070683_100031462
461 Ga0070683_100125515
462 Ga0070683_101142054
463 Ga0070690_100006748
464 Ga0070690_100023037
465 Ga0070670_100084207
466 Ga0070670_100379276
467 Ga0068869_100009104
468 Ga0068869_100037785
469 Ga0070666_10101171
470 Ga0070666_10400733
471 Ga0070680_100581984
472 Ga0070682_100124771
473 Ga0070682_101431823
474 Ga0068868_100006962
475 Ga0068868_100022883
476 Ga0068868_100545356
477 Ga0070660_100041640
478 Ga0070660_100084185
479 Ga0070660_100134629
480 Ga0070689_100121289
481 Ga0070689_100143098
482 Ga0070689_100299151
483 Ga0070691_10171328
484 Ga0070691_10511622
485 Ga0070687_100822144
486 Ga0070661_100027027
487 Ga0070661_100570084
488 Ga0070692_10021479
489 Ga0070668_100023183
490 Ga0070669_100018022
491 Ga0070669_100085971
492 Ga0070669_100106955
493 Ga0070669_101005530
494 Ga0070675_100014681
495 Ga0070675_100026692
496 Ga0070671_100083134
497 Ga0070671_101610779
498 Ga0070673_100019083
499 Ga0070673_100121333
500 Ga0070688_100047369
501 Ga0070659_100052103
502 Ga0070659_100056466
503 Ga0070659_100085383
504 Ga0070667_100232141
505 Ga0070667_101241536
506 Ga0070709_10343686
507 Ga0070714_100000105
508 Ga0070714_100396136
509 Ga0070714_100479324
510 Ga0070713_100170070
511 Ga0070701_10117854
512 Ga0070705_100407168
513 Ga0070700_100041698
514 Ga0070700_100146286
515 Ga0070694_100113868
516 Ga0070694_100500314
517 Ga0070663_100014043
518 Ga0070663_100474624
519 Ga0070678_100070320
520 Ga0070678_100397522
521 Ga0070662_100000369
522 Ga0070662_100045832
523 Ga0070681_10020665
524 Ga0070681_10056739
525 Ga0068867_100010269
526 Ga0068867_100025533
527 Ga0070685_10002867
528 Ga0070685_10203632
529 Ga0070707_100195013
530 Ga0070698_102096620
531 Ga0070679_100002860
532 Ga0070684_100024040
533 Ga0070684_100040538
534 Ga0068853_100042908
535 Ga0068853_100894289
536 Ga0070672_100008845
537 Ga0070672_100139260
538 Ga0070686_100032265
539 Ga0070686_101197534
540 Ga0070695_100098489
541 Ga0070695_100150809
542 Ga0070696_100315516
543 Ga0070696_100341606
544 Ga0070693_100018522
545 Ga0070665_100013657
546 Ga0070704_100231189
547 Ga0068855_100003203
548 Ga0068855_100011531
549 Ga0068855_100147975
550 Ga0068855_100907290
551 Ga0070664_100056563
552 Ga0070664_100083403
553 Ga0068857_100048426
554 Ga0068857_100268568
555 Ga0068857_100420068
556 Ga0068854_100002631
557 Ga0068854_100124761
558 Ga0068856_100382690
559 Ga0068856_101794227
560 Ga0070702_100073842
561 Ga0070702_100223745
562 Ga0068852_100000157
563 Ga0068852_100046072
564 Ga0068852_102666505
565 Ga0068859_100027502
566 Ga0068864_100369607
567 Ga0068866_10001973
568 Ga0068866_10088759
569 Ga0068861_100033807
570 Ga0068861_100257145
571 Ga0068851_10012545
572 Ga0068851_10051231
573 Ga0068863_100299335
574 Ga0068858_100169309
575 Ga0068858_100283266
576 Ga0068860_100013965
577 Ga0068860_100428794
578 Ga0068862_100034135
579 Ga0068862_100049843
580 Ga0070717_11199606
581 Ga0075365_10593932
582 Ga0070716_100021051
583 Ga0070716_100052177
584 Ga0097621_100047384
585 Ga0068871_100013727
586 Ga0068871_100172709
587 Ga0068871_100199978
588 Ga0075429_101444705
589 Ga0068865_100134094
590 Ga0097620_100027502
591 Ga0075435_100677565
592 Ga0099795_10105549
593 Ga0105251_10184745
594 Ga0105240_10000110
595 Ga0105240_10066640
596 Ga0105240_10080601
597 Ga0105240_10500690
598 Ga0105240_11409585
599 Ga0111539_10013394
600 Ga0105245_10001481
601 Ga0105245_10077138
602 Ga0105247_10010167
603 Ga0105247_10026217
604 Ga0105247_10148371
605 Ga0114129_10927899
606 Ga0114129_11364305
607 Ga0105243_10022276
608 Ga0105241_10017249
609 Ga0105241_10025585
610 Ga0105241_10238849
611 Ga0105241_10270551
612 Ga0105242_10003190
613 Ga0105242_10034770
614 Ga0105248_10054795
615 Ga0105248_10151365
616 Ga0105237_10132334
617 Ga0105237_10299337
618 Ga0105238_10056881
619 Ga0105249_10039402
620 Ga0105249_12864326
621 Ga0105239_10028233
622 Ga0105239_10049083
623 Ga0105239_10728443
624 Ga0105239_10781064
625 Ga0105246_10039129
626 Ga0105246_10039292
627 Ga0157373_10467845
628 Ga0157371_10012223
629 Ga0157371_10012705
630 Ga0157371_10141049
631 Ga0157370_10000001
632 Ga0157369_10000017
633 Ga0157369_10023279
634 Ga0157369_10066695
635 Ga0157369_10068012
636 Ga0157374_10009922
637 Ga0157374_10083487
638 Ga0157374_11266545
639 Ga0157374_11831045
640 Ga0157378_10180858
641 Ga0157378_10608455
642 Ga0157378_10974617
643 Ga0163162_10011068
644 Ga0157372_10000019
645 Ga0157372_10043322
646 Ga0157372_10286208
647 Ga0157372_10786627
648 Ga0157372_12989210
649 Ga0157375_10958407
650 Ga0157375_12361618
651 Ga0163163_10016461
652 Ga0163163_11014775
653 Ga0157380_10020084
654 Ga0182008_10057561
655 Ga0157377_10396824
656 Ga0157379_10001261
657 Ga0157379_10185841
658 Ga0157376_10035189
659 Ga0157376_10122169
660 Ga0182006_1126275
661 Ga0182007_10007337
662 Ga0163161_10012728
663 Ga0206356_10773933
664 Ga0207656_10080181
665 Ga0207656_10149507
666 Ga0207642_10012538
667 Ga0207710_10077104
668 Ga0207710_10124715
669 Ga0207710_10196337
670 Ga0207688_10038592
671 Ga0207680_10021976
672 Ga0207647_10016486
673 Ga0207645_10023159
674 Ga0207705_11155952
675 Ga0207684_10775712
676 Ga0207654_10316507
677 Ga0207654_10940009
678 Ga0207707_10094923
679 Ga0207707_10159682
680 Ga0207707_10430672
681 Ga0207707_10590242
682 Ga0207695_10000026
683 Ga0207695_10033933
684 Ga0207695_10033945
685 Ga0207671_10065551
686 Ga0207660_10079514
687 Ga0207662_10011639
688 Ga0207657_10001462
689 Ga0207657_10002123
690 Ga0207657_10002523
691 Ga0207657_11037471
692 Ga0207649_10002050
693 Ga0207649_10157062
694 Ga0207649_10464170
695 Ga0207652_10156194
696 Ga0207652_10495375
697 Ga0207681_10037927
698 Ga0207681_10090969
699 Ga0207681_10573072
700 Ga0207694_10095507
701 Ga0207694_10165623
702 Ga0207650_10000072
703 Ga0207650_10000078
704 Ga0207659_10049155
705 Ga0207659_10115651
706 Ga0207659_11329353
707 Ga0207687_10001753
708 Ga0207687_10037588
709 Ga0207700_10114839
710 Ga0207700_10344509
711 Ga0207664_10000406
712 Ga0207664_10249127
713 Ga0207644_10139963
714 Ga0207644_10380342
715 Ga0207690_10136892
716 Ga0207690_10141508
717 Ga0207690_10429458
718 Ga0207706_10000556
719 Ga0207706_10000888
720 Ga0207706_10021262
721 Ga0207686_10434992
722 Ga0207686_10480766
723 Ga0207670_10023478
724 Ga0207670_10078857
725 Ga0207670_11280145
726 Ga0207704_10933204
727 Ga0207665_10048171
728 Ga0207665_10320993
729 Ga0207691_10000924
730 Ga0207691_10188023
731 Ga0207711_10004011
732 Ga0207711_10042945
733 Ga0207711_11024896
734 Ga0207689_10003024
735 Ga0207689_10006007
736 Ga0207689_10961177
737 Ga0207661_10002234
738 Ga0207661_10543086
739 Ga0207661_11257667
740 Ga0207679_10000398
741 Ga0207679_10000792
742 Ga0207679_10025977
743 Ga0207679_10172439
744 Ga0207667_10003259
745 Ga0207667_10019709
746 Ga0207667_10104785
747 Ga0207667_10264423
748 Ga0207651_10010730
749 Ga0207712_10003108
750 Ga0207712_10036992
751 Ga0207712_10628139
752 Ga0207668_10007634
753 Ga0207668_11162677
754 Ga0207640_10001804
755 Ga0207640_10166835
756 Ga0207658_10031705
757 Ga0207658_10763247
758 Ga0207677_10016474
759 Ga0207703_10058377
760 Ga0207703_10125226
761 Ga0207639_10104557
762 Ga0207639_10110919
763 Ga0207639_10448219
764 Ga0207678_10000277
765 Ga0207678_10004462
766 Ga0207708_10086486
767 Ga0207702_10013510
768 Ga0207702_10109682
769 Ga0207702_11696158
770 Ga0207641_10000237
771 Ga0207641_10078311
772 Ga0207648_10001291
773 Ga0207648_10006494
774 Ga0207676_10000050
775 Ga0207676_10625813
776 Ga0207676_11492200
777 Ga0207674_10000130
778 Ga0207674_10091983
779 Ga0207674_10191569
780 Ga0207675_100034988
781 Ga0207675_100382039
782 Ga0207683_10002739
783 Ga0207683_10048061
784 Ga0207683_10604616
785 Ga0207698_10000018
786 Ga0207698_10051971
787 Ga0207698_10233130
788 Ga0209998_10012103
789 Ga0207428_10078593
790 Ga0268266_10018040
791 Ga0268266_10665455
792 Ga0268265_10029866
793 Ga0268265_10037377
794 Ga0268265_11144666
795 Ga0268264_10980262
796 Ga0268264_11050088
797 Ga0265324_10000045
798 Ga0265762_1024505
799 Ga0265770_1015329
800 Ga0265765_1021441
801 Ga0265760_10011718
802 Ga0265760_10118999
803 Ga0265332_10110144
804 Ga0265328_10023610
805 Ga0265325_10002356
806 Ga0265325_10002758
807 Ga0265340_10095345
808 Ga0265339_10000002
809 Ga0265331_10009813
810 Ga0265327_10015554
811 Ga0265316_10026323
812 Ga0265313_10006225
813 Ga0265313_10022218
814 Ga0265314_10051442
815 Ga0265342_10014936
816 Ga0265342_10040566
817 Ga0316576_10288445
818 Ga0316578_10204255
819 Ga0316577_10186754
820 Ga0316580_10069318
821 Ga0316214_1031603
822 Ga0373954_0073427
823 Ga0373957_0204260
824 Ga0373955_0357594
825 Ga0373942_0088540
826 Ga0373961_0055506
827 Ga0373931_0003282
828 Ga0373937_0712147
829 Ga0316584_0516335
830 Ga0373925_1180403
831 Ga0451577_0324923
832 Ga0453684_0228955
833 Ga0453684_0266686
834 Ga0453684_0392650
835 Ga0453684_0986219
836 Ga0466958_0773233
837 Ga0466967_1799654
838 Ga0495651_0066346
839 Ga0495587_0006250
840 Ga0495657_0217027
841 Ga0495669_0158383
842 Ga0495604_0255161
843 Ga0496100_0026440
844 Ga0496100_0120753
845 Ga0496101_0427815
846 Ga0496102_0008366
847 Ga0496102_0100727
848 Ga0496102_0356233
849 Ga0496102_0662775
850 Ga0496103_0017449
851 Ga0496103_0027477
852 Ga0496103_0084287
853 Ga0496104_0113154
854 Ga0496104_0330692
855 Ga0496104_0338974
856 Ga0496104_0464320
857 Ga0496105_0209562
858 Ga0496105_0257315
859 Ga0496105_0466552
860 Ga0496106_0117734
861 Ga0496106_0363715
862 Ga0496106_0703086
863 Ga0496106_0960667
864 Ga0496108_0000106
865 Ga0496108_0169764
866 Ga0496108_0257726
867 Ga0496109_0000133
868 Ga0496109_0754839
869 Ga0496110_0001098
870 Ga0496110_0050104
871 Ga0496110_0050158
872 Ga0496111_0004523
873 Ga0496111_0017370
874 Ga0496111_0058365
875 Ga0496112_0000028
876 Ga0496112_0031990
877 Ga0496112_0134936
878 Ga0496113_0001934
879 Ga0496114_0602837
880 Ga0501039_0314057
881 Ga0501076_0167990
882 Ga0501083_0574405
883 nmdc:mga0yw44_296157_c1
884 nmdc:mga05p37_1018105_c1
885 nmdc:mga05p37_1499377_c1
886 nmdc:mga05p37_25994_c1
887 nmdc:mga09592_615529_c1
888 nmdc:mga08y16_9554_c1
889 nmdc:mga0rr50_401155_c1
890 Ga0501084_0311354
891 Ga0501084_1853542
892 Ga0590071_004651
893 Ga0590074_003077
894 Ga0590075_001137
895 Ga0590077_000405
896 Ga0466962_0611396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

19

161

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9726 1 143
3ko7-assembly2.cif.gz_D dtd from plasmodium falciparum in complex with d-lysine 0.9719 1 147
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9716 1 148
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9708 1 144
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9696 1 147
ID Description Score Start End Superfamily
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9871 1 147 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9819 1 147 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9772 1 144 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9716 1 148 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9708 1 144 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A2V9ZRN4-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9963 1 149 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A2E0XJE1-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9956 1 149 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-Q1ATQ8-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) 0.9954 1 144 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A132P4S2-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9946 1 147 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1S6INM5-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9945 1 146 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Map