F446096

General Info

Members Datasets Scaffolds Average Seq Length
448 225 896 98

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100069128|Ga0070669_1000691284
Length 111
Sequence MPGWILQSRDEPPITLRLPPGSIKTIGRTARADFIVDAALVSRLHCRLTADRSDQLIVEDLGSTNGTLVNGKRIDRVILRAGDRLKVGRVEFEVSDAWTVTPSSPEPSPTS

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.13
Rhizosphere 94.42
Stem 0
Stem Tuber 0
Unclassified 13.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100069128 3300005353 Bacteria 2608
2 Ga0065704_10079274 3300005289 Bacteria 4208
3 Ga0065712_10068754 3300005290 Bacteria 9141
4 Ga0065715_10006729 3300005293 Bacteria 2822
5 Ga0065715_10065793 3300005293 Bacteria 911
6 Ga0065715_10096368 3300005293 Bacteria 3892
7 Ga0065715_10101413 3300005293 Bacteria 3208
8 Ga0065715_10140785 3300005293 Bacteria 1857
9 Ga0065715_10214008 3300005293 Bacteria 1301
10 Ga0065707_10014373 3300005295 Unclassified 1544
11 Ga0065707_10086386 3300005295 Bacteria 5498
12 Ga0065707_10180745 3300005295 Bacteria 1420
13 Ga0065707_10770321 3300005295 Bacteria 611
14 Ga0065707_10879294 3300005295 Unclassified 573
15 Ga0065707_11066290 3300005295 Bacteria 523
16 Ga0070676_10214823 3300005328 Bacteria 1267
17 Ga0070683_100000702 3300005329 Bacteria 24327
18 Ga0070683_100963306 3300005329 Bacteria 819
19 Ga0070670_100004054 3300005331 Bacteria 12234
20 Ga0070670_100397099 3300005331 Bacteria 1217
21 Ga0070670_100405957 3300005331 Unclassified 1203
22 Ga0070677_10796101 3300005333 Bacteria 539
23 Ga0068869_101427684 3300005334 Bacteria 613
24 Ga0070666_10029520 3300005335 Bacteria 3606
25 Ga0070680_101112093 3300005336 Unclassified 683
26 Ga0068868_100328235 3300005338 Bacteria 1305
27 Ga0070691_10658640 3300005341 Bacteria 624
28 Ga0070692_11042109 3300005345 Bacteria 574
29 Ga0070669_100000965 3300005353 Bacteria 20996
30 Ga0070669_100768391 3300005353 Bacteria 817
31 Ga0070675_100038777 3300005354 Bacteria 3885
32 Ga0070675_100220074 3300005354 Bacteria 1653
33 Ga0070675_101320094 3300005354 Bacteria 665
34 Ga0070675_101735097 3300005354 Bacteria 576
35 Ga0070671_100348271 3300005355 Bacteria 1264
36 Ga0070674_101754562 3300005356 Unclassified 562
37 Ga0070673_100082341 3300005364 Bacteria 2612
38 Ga0070673_101315663 3300005364 Bacteria 679
39 Ga0070688_100098221 3300005365 Bacteria 1926
40 Ga0070688_100442332 3300005365 Bacteria 970
41 Ga0070659_101918129 3300005366 Unclassified 531
42 Ga0070667_100034692 3300005367 Bacteria 4223
43 Ga0070701_10068994 3300005438 Bacteria 1885
44 Ga0070705_100029276 3300005440 Bacteria 3027
45 Ga0070705_100163620 3300005440 Bacteria 1490
46 Ga0070705_100553649 3300005440 Bacteria 882
47 Ga0070694_100007711 3300005444 Bacteria 6571
48 Ga0070694_100204216 3300005444 Bacteria 1474
49 Ga0070694_101697958 3300005444 Unclassified 537
50 Ga0070708_100014168 3300005445 Bacteria 6553
51 Ga0070663_100041620 3300005455 Bacteria 3224
52 Ga0070663_100838149 3300005455 Bacteria 791
53 Ga0070663_101105336 3300005455 Bacteria 693
54 Ga0070663_102030136 3300005455 Bacteria 518
55 Ga0070662_100134363 3300005457 Bacteria 1911
56 Ga0070662_100324420 3300005457 Bacteria 1256
57 Ga0070681_11189866 3300005458 Unclassified 684
58 Ga0070681_11249701 3300005458 Bacteria 665
59 Ga0068867_100139435 3300005459 Bacteria 1894
60 Ga0070706_101288988 3300005467 Unclassified 670
61 Ga0070706_101345544 3300005467 Bacteria 654
62 Ga0070707_100024317 3300005468 Bacteria 5737
63 Ga0070707_100044125 3300005468 Bacteria 4268
64 Ga0070698_100744637 3300005471 Bacteria 923
65 Ga0070679_101759178 3300005530 Unclassified 568
66 Ga0070684_100000068 3300005535 Bacteria 65538
67 Ga0070697_100325962 3300005536 Unclassified 1323
68 Ga0070697_101870769 3300005536 Unclassified 537
69 Ga0068853_101155113 3300005539 Bacteria 747
70 Ga0070672_100043152 3300005543 Bacteria 3476
71 Ga0070672_100304239 3300005543 Bacteria 1352
72 Ga0070686_100977079 3300005544 Bacteria 693
73 Ga0070695_100000785 3300005545 Bacteria 17066
74 Ga0070696_100062272 3300005546 Unclassified 2611
75 Ga0070696_100189727 3300005546 Bacteria 1529
76 Ga0070696_100712846 3300005546 Bacteria 819
77 Ga0070696_101956948 3300005546 Bacteria 508
78 Ga0070665_100134845 3300005548 Bacteria 2471
79 Ga0070704_100068959 3300005549 Bacteria 2560
80 Ga0070704_100075825 3300005549 Bacteria 2458
81 Ga0070704_100086322 3300005549 Unclassified 2325
82 Ga0068855_101593362 3300005563 Bacteria 668
83 Ga0070664_100000769 3300005564 Bacteria 24735
84 Ga0070664_100078310 3300005564 Bacteria 2844
85 Ga0068857_100034716 3300005577 Bacteria 4461
86 Ga0068857_101028060 3300005577 Bacteria 794
87 Ga0068852_101809463 3300005616 Bacteria 633
88 Ga0068859_100053470 3300005617 Bacteria 4062
89 Ga0068859_102442630 3300005617 Bacteria 576
90 Ga0068864_100084125 3300005618 Unclassified 2795
91 Ga0068864_100086536 3300005618 Bacteria 2757
92 Ga0068870_10376892 3300005840 Bacteria 917
93 Ga0068863_100837860 3300005841 Bacteria 918
94 Ga0068863_101361227 3300005841 Bacteria 717
95 Ga0068858_100153536 3300005842 Bacteria 2166
96 Ga0068860_100510323 3300005843 Bacteria 1201
97 Ga0068860_100806432 3300005843 Bacteria 952
98 Ga0068860_100838456 3300005843 Bacteria 934
99 Ga0068862_100008679 3300005844 Bacteria 8407
100 Ga0068862_100167466 3300005844 Unclassified 1965
101 Ga0068862_100835059 3300005844 Bacteria 902
102 Ga0068862_101534763 3300005844 Archaea 672
103 Ga0068862_101745047 3300005844 Bacteria 631
104 Ga0068862_102056853 3300005844 Bacteria 582
105 Ga0075432_10045566 3300006058 Bacteria 1539
106 Ga0097621_100265489 3300006237 Bacteria 1507
107 Ga0097621_101314248 3300006237 Bacteria 683
108 Ga0097621_101363142 3300006237 Bacteria 671
109 Ga0068871_100492927 3300006358 Bacteria 1104
110 Ga0075428_100001682 3300006844 Bacteria 23571
111 Ga0075428_100012058 3300006844 Bacteria 9617
112 Ga0075428_100115830 3300006844 Bacteria 2919
113 Ga0075430_100086936 3300006846 Bacteria 2616
114 Ga0075430_100809840 3300006846 Bacteria 772
115 Ga0075431_100044140 3300006847 Bacteria 4598
116 Ga0075431_100104608 3300006847 Bacteria 2921
117 Ga0075431_100174096 3300006847 Bacteria 2211
118 Ga0075431_100543909 3300006847 Bacteria 1149
119 Ga0075433_10029720 3300006852 Bacteria 4659
120 Ga0075433_10048604 3300006852 Unclassified 3690
121 Ga0075433_10070850 3300006852 Bacteria 3065
122 Ga0075433_10140675 3300006852 Bacteria 2145
123 Ga0075433_10212691 3300006852 Bacteria 1718
124 Ga0075434_100093398 3300006871 Bacteria 3012
125 Ga0075434_100200837 3300006871 Bacteria 2014
126 Ga0075434_100552343 3300006871 Bacteria 1171
127 Ga0075434_101163584 3300006871 Bacteria 784
128 Ga0075429_100012758 3300006880 Bacteria 7289
129 Ga0075429_100047808 3300006880 Bacteria 3721
130 Ga0075429_100548618 3300006880 Bacteria 1013
131 Ga0075429_100748981 3300006880 Bacteria 856
132 Ga0068865_101187326 3300006881 Unclassified 675
133 Ga0075436_100038632 3300006914 Bacteria 3294
134 Ga0075436_100502452 3300006914 Bacteria 887
135 Ga0075436_101457189 3300006914 Unclassified 519
136 Ga0097620_100053470 3300006931 Bacteria 4062
137 Ga0097620_102442089 3300006931 Bacteria 576
138 Ga0075435_100078173 3300007076 Bacteria 2713
139 Ga0075435_100189931 3300007076 Bacteria 1739
140 Ga0075435_100484877 3300007076 Bacteria 1068
141 Ga0099794_10122200 3300007265 Bacteria 1311
142 Ga0105251_10096212 3300009011 Bacteria 1357
143 Ga0105240_10025711 3300009093 Bacteria 7734
144 Ga0105240_10210018 3300009093 Bacteria 2276
145 Ga0111539_10000126 3300009094 Bacteria 86123
146 Ga0111539_10009783 3300009094 Bacteria 12103
147 Ga0111539_10040129 3300009094 Bacteria 5637
148 Ga0111539_10053528 3300009094 Bacteria 4804
149 Ga0111539_10084570 3300009094 Bacteria 3730
150 Ga0111539_10098215 3300009094 Bacteria 3440
151 Ga0111539_10477150 3300009094 Bacteria 1452
152 Ga0111539_11396810 3300009094 Bacteria 812
153 Ga0105245_10183818 3300009098 Bacteria 1999
154 Ga0105245_11106943 3300009098 Bacteria 838
155 Ga0114129_10000113 3300009147 Bacteria 80752
156 Ga0114129_10024838 3300009147 Bacteria 8495
157 Ga0114129_10130079 3300009147 Bacteria 3459
158 Ga0114129_10213774 3300009147 Unclassified 2605
159 Ga0114129_10703285 3300009147 Unclassified 1299
160 Ga0114129_10734328 3300009147 Bacteria 1266
161 Ga0114129_13001806 3300009147 Unclassified 555
162 Ga0105243_10299631 3300009148 Bacteria 1456
163 Ga0105243_11387718 3300009148 Unclassified 723
164 Ga0105243_11762940 3300009148 Bacteria 649
165 Ga0105243_11780851 3300009148 Bacteria 646
166 Ga0105243_11881134 3300009148 Unclassified 631
167 Ga0105242_10335687 3300009176 Bacteria 1391
168 Ga0105242_13081240 3300009176 Bacteria 516
169 Ga0105248_10006941 3300009177 Bacteria 12409
170 Ga0105248_10114834 3300009177 Bacteria 3037
171 Ga0105248_10429866 3300009177 Bacteria 1487
172 Ga0105238_11842241 3300009551 Bacteria 637
173 Ga0105249_10011538 3300009553 Bacteria 7764
174 Ga0105249_10093719 3300009553 Bacteria 2813
175 Ga0105249_10123450 3300009553 Bacteria 2463
176 Ga0105249_12772715 3300009553 Unclassified 562
177 Ga0105249_12826943 3300009553 Bacteria 557
178 Ga0105246_10079888 3300011119 Bacteria 2327
179 Ga0157374_10395579 3300013296 Bacteria 1378
180 Ga0163162_12563513 3300013306 Bacteria 586
181 Ga0157372_12371786 3300013307 Bacteria 609
182 Ga0163163_10000047 3300014325 Bacteria 131685
183 Ga0163163_10253917 3300014325 Bacteria 1809
184 Ga0157380_10250359 3300014326 Bacteria 1603
185 Ga0157380_10371312 3300014326 Bacteria 1346
186 Ga0157380_11444413 3300014326 Bacteria 739
187 Ga0157380_12771211 3300014326 Bacteria 557
188 Ga0157377_10152035 3300014745 Bacteria 1432
189 Ga0157379_10413321 3300014968 Bacteria 1242
190 Ga0157379_10435284 3300014968 Unclassified 1209
191 Ga0157379_11979929 3300014968 Bacteria 575
192 Ga0157376_10186820 3300014969 Bacteria 1898
193 Ga0207666_1037328 3300025271 Bacteria 756
194 Ga0207697_10064899 3300025315 Bacteria 1523
195 Ga0207697_10360385 3300025315 Bacteria 646
196 Ga0207713_1194595 3300025735 Bacteria 625
197 Ga0207688_10262361 3300025901 Bacteria 1049
198 Ga0207688_10320674 3300025901 Bacteria 951
199 Ga0207680_10025794 3300025903 Bacteria 3247
200 Ga0207643_10308724 3300025908 Bacteria 986
201 Ga0207684_11132540 3300025910 Bacteria 650
202 Ga0207684_11725747 3300025910 Bacteria 504
203 Ga0207707_11308031 3300025912 Unclassified 582
204 Ga0207695_10061830 3300025913 Bacteria 3869
205 Ga0207695_10965128 3300025913 Bacteria 732
206 Ga0207660_10996012 3300025917 Unclassified 684
207 Ga0207657_10176668 3300025919 Bacteria 1728
208 Ga0207649_11103221 3300025920 Bacteria 626
209 Ga0207646_10035990 3300025922 Bacteria 4469
210 Ga0207646_10133484 3300025922 Bacteria 2235
211 Ga0207646_10458437 3300025922 Unclassified 1150
212 Ga0207646_10673883 3300025922 Bacteria 926
213 Ga0207681_10005213 3300025923 Bacteria 7981
214 Ga0207681_10035010 3300025923 Bacteria 3307
215 Ga0207681_11310740 3300025923 Unclassified 608
216 Ga0207694_10457548 3300025924 Bacteria 1066
217 Ga0207650_10108393 3300025925 Bacteria 2147
218 Ga0207650_10133569 3300025925 Bacteria 1944
219 Ga0207659_10026744 3300025926 Bacteria 3897
220 Ga0207659_11313483 3300025926 Bacteria 621
221 Ga0207659_11341961 3300025926 Bacteria 614
222 Ga0207687_11638982 3300025927 Bacteria 552
223 Ga0207644_10770246 3300025931 Bacteria 804
224 Ga0207690_10473343 3300025932 Bacteria 1010
225 Ga0207706_10056738 3300025933 Bacteria 3452
226 Ga0207706_10453381 3300025933 Bacteria 1109
227 Ga0207709_10852334 3300025935 Bacteria 738
228 Ga0207709_11407685 3300025935 Bacteria 577
229 Ga0207669_10006251 3300025937 Bacteria 5427
230 Ga0207704_10133261 3300025938 Bacteria 1725
231 Ga0207691_10287652 3300025940 Bacteria 1414
232 Ga0207691_10307331 3300025940 Bacteria 1361
233 Ga0207711_10039684 3300025941 Bacteria 4005
234 Ga0207711_10488946 3300025941 Bacteria 1147
235 Ga0207661_10002311 3300025944 Bacteria 13129
236 Ga0207661_10918344 3300025944 Bacteria 806
237 Ga0207679_10008033 3300025945 Bacteria 6711
238 Ga0207679_10061251 3300025945 Bacteria 2801
239 Ga0207651_10194233 3300025960 Bacteria 1621
240 Ga0207651_11672711 3300025960 Bacteria 573
241 Ga0207712_10007910 3300025961 Bacteria 6715
242 Ga0207712_10070755 3300025961 Bacteria 2507
243 Ga0207712_10504492 3300025961 Bacteria 1035
244 Ga0207712_11690351 3300025961 Unclassified 567
245 Ga0207668_11289371 3300025972 Bacteria 657
246 Ga0207658_10457007 3300025986 Bacteria 1131
247 Ga0207677_10250176 3300026023 Bacteria 1439
248 Ga0207703_10215869 3300026035 Bacteria 1713
249 Ga0207678_10036758 3300026067 Bacteria 4263
250 Ga0207678_11475157 3300026067 Bacteria 601
251 Ga0207708_10165335 3300026075 Bacteria 1749
252 Ga0207708_10364718 3300026075 Bacteria 1188
253 Ga0207641_10632081 3300026088 Bacteria 1050
254 Ga0207641_10919982 3300026088 Bacteria 869
255 Ga0207674_10162533 3300026116 Bacteria 2187
256 Ga0207674_10448916 3300026116 Bacteria 1246
257 Ga0207675_100010444 3300026118 Bacteria 8695
258 Ga0207683_10737973 3300026121 Bacteria 913
259 Ga0207698_11268114 3300026142 Unclassified 751
260 Ga0207698_12659100 3300026142 Bacteria 509
261 Ga0209983_1049113 3300027665 Bacteria 921
262 Ga0209588_1109933 3300027671 Bacteria 885
263 Ga0207428_10001071 3300027907 Bacteria 29876
264 Ga0207428_10018064 3300027907 Bacteria 6036
265 Ga0207428_10022769 3300027907 Bacteria 5281
266 Ga0207428_10056925 3300027907 Bacteria 3105
267 Ga0207428_10118851 3300027907 Bacteria 2028
268 Ga0207428_10366821 3300027907 Bacteria 1058
269 Ga0268266_10533694 3300028379 Bacteria 1123
270 Ga0268265_10018025 3300028380 Bacteria 4887
271 Ga0268265_10170884 3300028380 Bacteria 1858
272 Ga0268265_10254487 3300028380 Unclassified 1558
273 Ga0268265_11251415 3300028380 Bacteria 741
274 Ga0268264_10253345 3300028381 Bacteria 1636
275 Ga0307408_100124816 3300031548 Bacteria 2000
276 Ga0307405_10339004 3300031731 Bacteria 1155
277 Ga0307413_10422937 3300031824 Bacteria 1050
278 Ga0307410_10160939 3300031852 Bacteria 1682
279 Ga0307409_100790504 3300031995 Bacteria 956
280 Ga0307416_100045960 3300032002 Bacteria 3442
281 Ga0307416_101134419 3300032002 Bacteria 887
282 Ga0307416_101522031 3300032002 Bacteria 775
283 Ga0307416_101633354 3300032002 Bacteria 750
284 Ga0307416_103068333 3300032002 Bacteria 559
285 Ga0307416_103750398 3300032002 Unclassified 509
286 Ga0307414_11282659 3300032004 Bacteria 679
287 Ga0307415_100284599 3300032126 Bacteria 1361
288 Ga0373934_0001956 3300035086 Bacteria 7554
289 Ga0373953_0076563 3300035117 Bacteria 1386
290 Ga0373954_0075691 3300035118 Bacteria 1603
291 Ga0373957_0012771 3300035120 Unclassified 2833
292 Ga0373943_0686641 3300035170 Unclassified 606
293 Ga0373955_0043386 3300035172 Unclassified 2419
294 Ga0373924_0185935 3300035410 Bacteria 915
295 Ga0373924_0374799 3300035410 Unclassified 635
296 Ga0373933_0009005 3300035724 Bacteria 5446
297 Ga0373937_0000267 3300036401 Bacteria 50314
298 Ga0373937_0388403 3300036401 Bacteria 1324
299 Ga0373925_0900702 3300037068 Bacteria 729
300 Ga0439453_0067270 3300041408 Unclassified 752
301 Ga0451804_0293665 3300041463 Unclassified 582
302 Ga0451853_0456858 3300041512 Unclassified 549
303 Ga0451853_2496172 3300041512 Bacteria 663
304 Ga0439441_086432 3300042001 Bacteria 689
305 Ga0439435_0036665 3300042436 Bacteria 1356
306 Ga0439444_0034195 3300042437 Bacteria 969
307 Ga0439460_0107751 3300042461 Unclassified 901
308 Ga0451577_0020611 3300042876 Bacteria 6046
309 Ga0451577_0111535 3300042876 Bacteria 2447
310 Ga0453684_0132059 3300044712 Bacteria 2995
311 Ga0453684_0346175 3300044712 Bacteria 1677
312 Ga0451576_0005651 3300045051 Bacteria 15616
313 Ga0451576_0495931 3300045051 Unclassified 1283
314 Ga0495587_0219545 3300046536 Bacteria 1072
315 Ga0495635_0376372 3300046663 Bacteria 945
316 Ga0495659_0326355 3300046664 Unclassified 652
317 Ga0495599_0579449 3300046678 Unclassified 655
318 Ga0495672_0209222 3300047320 Bacteria 970
319 Ga0496101_0270204 3300048904 Bacteria 1327
320 Ga0496101_1137905 3300048904 Bacteria 612
321 Ga0496102_0457084 3300048905 Bacteria 1198
322 Ga0496103_0712094 3300048906 Bacteria 636
323 Ga0496104_0012100 3300048907 Bacteria 7746
324 Ga0496104_0408203 3300048907 Bacteria 1271
325 Ga0496105_0006874 3300048908 Bacteria 8757
326 Ga0496105_0346638 3300048908 Bacteria 1187
327 Ga0496105_0741566 3300048908 Bacteria 751
328 Ga0496106_0351063 3300048909 Bacteria 1185
329 Ga0496108_0011085 3300048911 Bacteria 7321
330 Ga0496109_0001290 3300048912 Bacteria 20786
331 Ga0496110_0001182 3300048913 Bacteria 18558
332 Ga0496111_0460981 3300048914 Bacteria 937
333 Ga0496111_0951713 3300048914 Bacteria 617
334 Ga0496112_0000287 3300048915 Bacteria 32756
335 Ga0496112_0386688 3300048915 Bacteria 1340
336 Ga0496113_0318402 3300048916 Bacteria 1246
337 Ga0496114_0167083 3300048917 Unclassified 1916
338 Ga0496114_0178063 3300048917 Bacteria 1856
339 Ga0496114_0361502 3300048917 Bacteria 1284
340 Ga0496114_1747637 3300048917 Bacteria 510
341 Ga0501031_0216882 3300049568 Bacteria 1246
342 Ga0501031_0654848 3300049568 Bacteria 675
343 Ga0501032_0021618 3300049569 Bacteria 4472
344 Ga0501032_0133238 3300049569 Bacteria 1638
345 Ga0501034_0002358 3300049571 Bacteria 23001
346 Ga0501034_0527196 3300049571 Bacteria 1092
347 Ga0501034_1502030 3300049571 Bacteria 547
348 Ga0501036_0039144 3300049572 Bacteria 4014
349 Ga0501036_0096705 3300049572 Bacteria 2496
350 Ga0501037_0166348 3300049573 Bacteria 1570
351 Ga0501038_0002400 3300049574 Bacteria 17457
352 Ga0501038_0020106 3300049574 Bacteria 6007
353 Ga0501039_0033039 3300049575 Bacteria 3991
354 Ga0501039_0118745 3300049575 Bacteria 2071
355 Ga0501040_0206274 3300049576 Unclassified 1396
356 Ga0501041_0034467 3300049577 Unclassified 3065
357 Ga0501043_0007237 3300049579 Bacteria 8813
358 Ga0501046_0021038 3300049580 Bacteria 5387
359 Ga0501046_0132689 3300049580 Bacteria 1888
360 Ga0501047_0057255 3300049581 Bacteria 3769
361 Ga0501047_0187099 3300049581 Bacteria 1935
362 Ga0501048_0017058 3300049582 Bacteria 5352
363 Ga0501048_0383478 3300049582 Bacteria 1004
364 Ga0501048_0421321 3300049582 Bacteria 955
365 Ga0501048_1156071 3300049582 Bacteria 557
366 Ga0501067_0180834 3300049583 Bacteria 1174
367 Ga0501068_0017017 3300049584 Bacteria 4201
368 Ga0501068_0020430 3300049584 Bacteria 3858
369 Ga0501069_0239316 3300049585 Bacteria 1057
370 Ga0501071_0168697 3300049587 Bacteria 1638
371 Ga0501071_0232091 3300049587 Bacteria 1390
372 Ga0501072_0065791 3300049588 Unclassified 2859
373 Ga0501072_0073631 3300049588 Bacteria 2700
374 Ga0501072_0613366 3300049588 Bacteria 857
375 Ga0501072_1087386 3300049588 Bacteria 622
376 Ga0501073_0011385 3300049589 Bacteria 6508
377 Ga0501073_0217948 3300049589 Bacteria 1318
378 Ga0501073_0973167 3300049589 Bacteria 584
379 Ga0501074_1024129 3300049590 Bacteria 580
380 Ga0501074_1043248 3300049590 Bacteria 575
381 Ga0501075_0010549 3300049591 Bacteria 6495
382 Ga0501075_0631581 3300049591 Bacteria 817
383 Ga0501076_0006120 3300049592 Bacteria 8710
384 Ga0501076_0588145 3300049592 Bacteria 918
385 Ga0501079_0008072 3300049741 Bacteria 7975
386 Ga0501079_0115737 3300049741 Bacteria 2084
387 Ga0501079_0244396 3300049741 Bacteria 1402
388 Ga0501080_0023524 3300049742 Bacteria 5709
389 Ga0501080_0258535 3300049742 Unclassified 1587
390 Ga0501081_0004609 3300049743 Bacteria 8848
391 Ga0501081_0032922 3300049743 Bacteria 3519
392 Ga0501081_1060896 3300049743 Bacteria 613
393 Ga0501081_1309444 3300049743 Unclassified 549
394 Ga0501083_0075200 3300049744 Bacteria 2243
395 Ga0501044_0001407 3300049823 Bacteria 28211
396 Ga0501044_0229974 3300049823 Bacteria 1802
397 Ga0501045_0291535 3300049824 Bacteria 1214
398 Ga0501045_0550045 3300049824 Bacteria 856
399 Ga0501045_0699583 3300049824 Bacteria 748
400 nmdc:mga05p37_1382257_c1 3300050507 Bacteria 711
401 nmdc:mga05p37_216183_c1 3300050507 Unclassified 2315
402 nmdc:mga05p37_263011_c1 3300050507 Bacteria 2064
403 nmdc:mga05p37_37_c1 3300050507 Bacteria 110157
404 nmdc:mga05p37_8920_c1 3300050507 Bacteria 11852
405 nmdc:mga09592_25866_c1 3300050508 Bacteria 4860
406 nmdc:mga09592_396657_c1 3300050508 Bacteria 1193
407 nmdc:mga09592_84105_c1 3300050508 Bacteria 2713
408 nmdc:mga0qj67_369650_c1 3300050509 Unclassified 1158
409 nmdc:mga0qj67_95510_c1 3300050509 Bacteria 2393
410 nmdc:mga06r32_135869_c1 3300050510 Bacteria 2433
411 nmdc:mga06r32_166763_c1 3300050510 Bacteria 2186
412 nmdc:mga06r32_73271_c1 3300050510 Bacteria 3317
413 nmdc:mga08y16_2505_c1 3300050511 Bacteria 18893
414 nmdc:mga08y16_298453_c1 3300050511 Bacteria 1661
415 nmdc:mga08y16_40186_c1 3300050511 Bacteria 4904
416 nmdc:mga08y16_410430_c1 3300050511 Bacteria 1385
417 nmdc:mga08y16_540111_c1 3300050511 Bacteria 1181
418 nmdc:mga08y16_58009_c1 3300050511 Unclassified 4045
419 nmdc:mga08y16_65376_c1 3300050511 Bacteria 3797
420 nmdc:mga08y16_7485_c1 3300050511 Bacteria 11436
421 nmdc:mga0n895_1154940_c1 3300050512 Bacteria 750
422 nmdc:mga0n895_15474_c1 3300050512 Bacteria 6957
423 nmdc:mga0n895_167856_c1 3300050512 Bacteria 2227
424 nmdc:mga0n895_873624_c1 3300050512 Bacteria 886
425 nmdc:mga0rr50_1004014_c1 3300050513 Bacteria 711
426 nmdc:mga0rr50_552527_c1 3300050513 Unclassified 980
427 nmdc:mga0rr50_776568_c1 3300050513 Bacteria 818
428 nmdc:mga08x19_144796_c1 3300050514 Bacteria 1607
429 nmdc:mga08x19_222478_c1 3300050514 Bacteria 1297
430 nmdc:mga08x19_95898_c1 3300050514 Bacteria 1963
431 nmdc:mga0a205_152124_c1 3300050515 Bacteria 2213
432 nmdc:mga0a205_212101_c1 3300050515 Bacteria 1824
433 nmdc:mga0a205_246784_c1 3300050515 Bacteria 1666
434 nmdc:mga0a205_46099_c1 3300050515 Bacteria 4204
435 nmdc:mga0a205_646859_c1 3300050515 Bacteria 909
436 Ga0495601_0147481 3300053077 Bacteria 1536
437 Ga0495595_0017629 3300053084 Unclassified 3074
438 Ga0495619_0356455 3300053085 Unclassified 1012
439 Ga0501084_0193283 3300054114 Bacteria 1717
440 Ga0501084_0452937 3300054114 Bacteria 1085
441 Ga0590075_040677 3300059424 Bacteria 1188
442 Ga0590077_025772 3300059426 Bacteria 1268
443 Ga0501082_0012678 3300060353 Bacteria 7244
444 Ga0501082_0099712 3300060353 Bacteria 2511
445 Ga0501082_0111694 3300060353 Unclassified 2366
446 Ga0501082_1032375 3300060353 Bacteria 719
447 Ga0501082_1160180 3300060353 Unclassified 675
448 Ga0530510_0030866 3300061734 Bacteria 3851
449 Ga0070669_100069128
450 Ga0065704_10079274
451 Ga0065712_10068754
452 Ga0065715_10006729
453 Ga0065715_10065793
454 Ga0065715_10096368
455 Ga0065715_10101413
456 Ga0065715_10140785
457 Ga0065715_10214008
458 Ga0065707_10014373
459 Ga0065707_10086386
460 Ga0065707_10180745
461 Ga0065707_10770321
462 Ga0065707_10879294
463 Ga0065707_11066290
464 Ga0070676_10214823
465 Ga0070683_100000702
466 Ga0070683_100963306
467 Ga0070670_100004054
468 Ga0070670_100397099
469 Ga0070670_100405957
470 Ga0070677_10796101
471 Ga0068869_101427684
472 Ga0070666_10029520
473 Ga0070680_101112093
474 Ga0068868_100328235
475 Ga0070691_10658640
476 Ga0070692_11042109
477 Ga0070669_100000965
478 Ga0070669_100768391
479 Ga0070675_100038777
480 Ga0070675_100220074
481 Ga0070675_101320094
482 Ga0070675_101735097
483 Ga0070671_100348271
484 Ga0070674_101754562
485 Ga0070673_100082341
486 Ga0070673_101315663
487 Ga0070688_100098221
488 Ga0070688_100442332
489 Ga0070659_101918129
490 Ga0070667_100034692
491 Ga0070701_10068994
492 Ga0070705_100029276
493 Ga0070705_100163620
494 Ga0070705_100553649
495 Ga0070694_100007711
496 Ga0070694_100204216
497 Ga0070694_101697958
498 Ga0070708_100014168
499 Ga0070663_100041620
500 Ga0070663_100838149
501 Ga0070663_101105336
502 Ga0070663_102030136
503 Ga0070662_100134363
504 Ga0070662_100324420
505 Ga0070681_11189866
506 Ga0070681_11249701
507 Ga0068867_100139435
508 Ga0070706_101288988
509 Ga0070706_101345544
510 Ga0070707_100024317
511 Ga0070707_100044125
512 Ga0070698_100744637
513 Ga0070679_101759178
514 Ga0070684_100000068
515 Ga0070697_100325962
516 Ga0070697_101870769
517 Ga0068853_101155113
518 Ga0070672_100043152
519 Ga0070672_100304239
520 Ga0070686_100977079
521 Ga0070695_100000785
522 Ga0070696_100062272
523 Ga0070696_100189727
524 Ga0070696_100712846
525 Ga0070696_101956948
526 Ga0070665_100134845
527 Ga0070704_100068959
528 Ga0070704_100075825
529 Ga0070704_100086322
530 Ga0068855_101593362
531 Ga0070664_100000769
532 Ga0070664_100078310
533 Ga0068857_100034716
534 Ga0068857_101028060
535 Ga0068852_101809463
536 Ga0068859_100053470
537 Ga0068859_102442630
538 Ga0068864_100084125
539 Ga0068864_100086536
540 Ga0068870_10376892
541 Ga0068863_100837860
542 Ga0068863_101361227
543 Ga0068858_100153536
544 Ga0068860_100510323
545 Ga0068860_100806432
546 Ga0068860_100838456
547 Ga0068862_100008679
548 Ga0068862_100167466
549 Ga0068862_100835059
550 Ga0068862_101534763
551 Ga0068862_101745047
552 Ga0068862_102056853
553 Ga0075432_10045566
554 Ga0097621_100265489
555 Ga0097621_101314248
556 Ga0097621_101363142
557 Ga0068871_100492927
558 Ga0075428_100001682
559 Ga0075428_100012058
560 Ga0075428_100115830
561 Ga0075430_100086936
562 Ga0075430_100809840
563 Ga0075431_100044140
564 Ga0075431_100104608
565 Ga0075431_100174096
566 Ga0075431_100543909
567 Ga0075433_10029720
568 Ga0075433_10048604
569 Ga0075433_10070850
570 Ga0075433_10140675
571 Ga0075433_10212691
572 Ga0075434_100093398
573 Ga0075434_100200837
574 Ga0075434_100552343
575 Ga0075434_101163584
576 Ga0075429_100012758
577 Ga0075429_100047808
578 Ga0075429_100548618
579 Ga0075429_100748981
580 Ga0068865_101187326
581 Ga0075436_100038632
582 Ga0075436_100502452
583 Ga0075436_101457189
584 Ga0097620_100053470
585 Ga0097620_102442089
586 Ga0075435_100078173
587 Ga0075435_100189931
588 Ga0075435_100484877
589 Ga0099794_10122200
590 Ga0105251_10096212
591 Ga0105240_10025711
592 Ga0105240_10210018
593 Ga0111539_10000126
594 Ga0111539_10009783
595 Ga0111539_10040129
596 Ga0111539_10053528
597 Ga0111539_10084570
598 Ga0111539_10098215
599 Ga0111539_10477150
600 Ga0111539_11396810
601 Ga0105245_10183818
602 Ga0105245_11106943
603 Ga0114129_10000113
604 Ga0114129_10024838
605 Ga0114129_10130079
606 Ga0114129_10213774
607 Ga0114129_10703285
608 Ga0114129_10734328
609 Ga0114129_13001806
610 Ga0105243_10299631
611 Ga0105243_11387718
612 Ga0105243_11762940
613 Ga0105243_11780851
614 Ga0105243_11881134
615 Ga0105242_10335687
616 Ga0105242_13081240
617 Ga0105248_10006941
618 Ga0105248_10114834
619 Ga0105248_10429866
620 Ga0105238_11842241
621 Ga0105249_10011538
622 Ga0105249_10093719
623 Ga0105249_10123450
624 Ga0105249_12772715
625 Ga0105249_12826943
626 Ga0105246_10079888
627 Ga0157374_10395579
628 Ga0163162_12563513
629 Ga0157372_12371786
630 Ga0163163_10000047
631 Ga0163163_10253917
632 Ga0157380_10250359
633 Ga0157380_10371312
634 Ga0157380_11444413
635 Ga0157380_12771211
636 Ga0157377_10152035
637 Ga0157379_10413321
638 Ga0157379_10435284
639 Ga0157379_11979929
640 Ga0157376_10186820
641 Ga0207666_1037328
642 Ga0207697_10064899
643 Ga0207697_10360385
644 Ga0207713_1194595
645 Ga0207688_10262361
646 Ga0207688_10320674
647 Ga0207680_10025794
648 Ga0207643_10308724
649 Ga0207684_11132540
650 Ga0207684_11725747
651 Ga0207707_11308031
652 Ga0207695_10061830
653 Ga0207695_10965128
654 Ga0207660_10996012
655 Ga0207657_10176668
656 Ga0207649_11103221
657 Ga0207646_10035990
658 Ga0207646_10133484
659 Ga0207646_10458437
660 Ga0207646_10673883
661 Ga0207681_10005213
662 Ga0207681_10035010
663 Ga0207681_11310740
664 Ga0207694_10457548
665 Ga0207650_10108393
666 Ga0207650_10133569
667 Ga0207659_10026744
668 Ga0207659_11313483
669 Ga0207659_11341961
670 Ga0207687_11638982
671 Ga0207644_10770246
672 Ga0207690_10473343
673 Ga0207706_10056738
674 Ga0207706_10453381
675 Ga0207709_10852334
676 Ga0207709_11407685
677 Ga0207669_10006251
678 Ga0207704_10133261
679 Ga0207691_10287652
680 Ga0207691_10307331
681 Ga0207711_10039684
682 Ga0207711_10488946
683 Ga0207661_10002311
684 Ga0207661_10918344
685 Ga0207679_10008033
686 Ga0207679_10061251
687 Ga0207651_10194233
688 Ga0207651_11672711
689 Ga0207712_10007910
690 Ga0207712_10070755
691 Ga0207712_10504492
692 Ga0207712_11690351
693 Ga0207668_11289371
694 Ga0207658_10457007
695 Ga0207677_10250176
696 Ga0207703_10215869
697 Ga0207678_10036758
698 Ga0207678_11475157
699 Ga0207708_10165335
700 Ga0207708_10364718
701 Ga0207641_10632081
702 Ga0207641_10919982
703 Ga0207674_10162533
704 Ga0207674_10448916
705 Ga0207675_100010444
706 Ga0207683_10737973
707 Ga0207698_11268114
708 Ga0207698_12659100
709 Ga0209983_1049113
710 Ga0209588_1109933
711 Ga0207428_10001071
712 Ga0207428_10018064
713 Ga0207428_10022769
714 Ga0207428_10056925
715 Ga0207428_10118851
716 Ga0207428_10366821
717 Ga0268266_10533694
718 Ga0268265_10018025
719 Ga0268265_10170884
720 Ga0268265_10254487
721 Ga0268265_11251415
722 Ga0268264_10253345
723 Ga0307408_100124816
724 Ga0307405_10339004
725 Ga0307413_10422937
726 Ga0307410_10160939
727 Ga0307409_100790504
728 Ga0307416_100045960
729 Ga0307416_101134419
730 Ga0307416_101522031
731 Ga0307416_101633354
732 Ga0307416_103068333
733 Ga0307416_103750398
734 Ga0307414_11282659
735 Ga0307415_100284599
736 Ga0373934_0001956
737 Ga0373953_0076563
738 Ga0373954_0075691
739 Ga0373957_0012771
740 Ga0373943_0686641
741 Ga0373955_0043386
742 Ga0373924_0185935
743 Ga0373924_0374799
744 Ga0373933_0009005
745 Ga0373937_0000267
746 Ga0373937_0388403
747 Ga0373925_0900702
748 Ga0439453_0067270
749 Ga0451804_0293665
750 Ga0451853_0456858
751 Ga0451853_2496172
752 Ga0439441_086432
753 Ga0439435_0036665
754 Ga0439444_0034195
755 Ga0439460_0107751
756 Ga0451577_0020611
757 Ga0451577_0111535
758 Ga0453684_0132059
759 Ga0453684_0346175
760 Ga0451576_0005651
761 Ga0451576_0495931
762 Ga0495587_0219545
763 Ga0495635_0376372
764 Ga0495659_0326355
765 Ga0495599_0579449
766 Ga0495672_0209222
767 Ga0496101_0270204
768 Ga0496101_1137905
769 Ga0496102_0457084
770 Ga0496103_0712094
771 Ga0496104_0012100
772 Ga0496104_0408203
773 Ga0496105_0006874
774 Ga0496105_0346638
775 Ga0496105_0741566
776 Ga0496106_0351063
777 Ga0496108_0011085
778 Ga0496109_0001290
779 Ga0496110_0001182
780 Ga0496111_0460981
781 Ga0496111_0951713
782 Ga0496112_0000287
783 Ga0496112_0386688
784 Ga0496113_0318402
785 Ga0496114_0167083
786 Ga0496114_0178063
787 Ga0496114_0361502
788 Ga0496114_1747637
789 Ga0501031_0216882
790 Ga0501031_0654848
791 Ga0501032_0021618
792 Ga0501032_0133238
793 Ga0501034_0002358
794 Ga0501034_0527196
795 Ga0501034_1502030
796 Ga0501036_0039144
797 Ga0501036_0096705
798 Ga0501037_0166348
799 Ga0501038_0002400
800 Ga0501038_0020106
801 Ga0501039_0033039
802 Ga0501039_0118745
803 Ga0501040_0206274
804 Ga0501041_0034467
805 Ga0501043_0007237
806 Ga0501046_0021038
807 Ga0501046_0132689
808 Ga0501047_0057255
809 Ga0501047_0187099
810 Ga0501048_0017058
811 Ga0501048_0383478
812 Ga0501048_0421321
813 Ga0501048_1156071
814 Ga0501067_0180834
815 Ga0501068_0017017
816 Ga0501068_0020430
817 Ga0501069_0239316
818 Ga0501071_0168697
819 Ga0501071_0232091
820 Ga0501072_0065791
821 Ga0501072_0073631
822 Ga0501072_0613366
823 Ga0501072_1087386
824 Ga0501073_0011385
825 Ga0501073_0217948
826 Ga0501073_0973167
827 Ga0501074_1024129
828 Ga0501074_1043248
829 Ga0501075_0010549
830 Ga0501075_0631581
831 Ga0501076_0006120
832 Ga0501076_0588145
833 Ga0501079_0008072
834 Ga0501079_0115737
835 Ga0501079_0244396
836 Ga0501080_0023524
837 Ga0501080_0258535
838 Ga0501081_0004609
839 Ga0501081_0032922
840 Ga0501081_1060896
841 Ga0501081_1309444
842 Ga0501083_0075200
843 Ga0501044_0001407
844 Ga0501044_0229974
845 Ga0501045_0291535
846 Ga0501045_0550045
847 Ga0501045_0699583
848 nmdc:mga05p37_1382257_c1
849 nmdc:mga05p37_216183_c1
850 nmdc:mga05p37_263011_c1
851 nmdc:mga05p37_37_c1
852 nmdc:mga05p37_8920_c1
853 nmdc:mga09592_25866_c1
854 nmdc:mga09592_396657_c1
855 nmdc:mga09592_84105_c1
856 nmdc:mga0qj67_369650_c1
857 nmdc:mga0qj67_95510_c1
858 nmdc:mga06r32_135869_c1
859 nmdc:mga06r32_166763_c1
860 nmdc:mga06r32_73271_c1
861 nmdc:mga08y16_2505_c1
862 nmdc:mga08y16_298453_c1
863 nmdc:mga08y16_40186_c1
864 nmdc:mga08y16_410430_c1
865 nmdc:mga08y16_540111_c1
866 nmdc:mga08y16_58009_c1
867 nmdc:mga08y16_65376_c1
868 nmdc:mga08y16_7485_c1
869 nmdc:mga0n895_1154940_c1
870 nmdc:mga0n895_15474_c1
871 nmdc:mga0n895_167856_c1
872 nmdc:mga0n895_873624_c1
873 nmdc:mga0rr50_1004014_c1
874 nmdc:mga0rr50_552527_c1
875 nmdc:mga0rr50_776568_c1
876 nmdc:mga08x19_144796_c1
877 nmdc:mga08x19_222478_c1
878 nmdc:mga08x19_95898_c1
879 nmdc:mga0a205_152124_c1
880 nmdc:mga0a205_212101_c1
881 nmdc:mga0a205_246784_c1
882 nmdc:mga0a205_46099_c1
883 nmdc:mga0a205_646859_c1
884 Ga0495601_0147481
885 Ga0495595_0017629
886 Ga0495619_0356455
887 Ga0501084_0193283
888 Ga0501084_0452937
889 Ga0590075_040677
890 Ga0590077_025772
891 Ga0501082_0012678
892 Ga0501082_0099712
893 Ga0501082_0111694
894 Ga0501082_1032375
895 Ga0501082_1160180
896 Ga0530510_0030866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

24

88

0.98

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

14

97

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gqs-assembly2.cif.gz_B crystal structure of the fha domain of ct664 protein from chlamydia trachomatis 0.9061 2 96
3gqs-assembly2.cif.gz_B crystal structure of the fha domain of ct664 protein from chlamydia trachomatis 0.8886 2 96
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.8772 2 95
3oun-assembly1.cif.gz_A crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910 0.8764 1 93
3oun-assembly1.cif.gz_A crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910 0.8589 1 93
ID Description Score Start End Superfamily
2ff4B03 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8677 1 95 2.60.200.20
2ff4B03 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8591 1 95 2.60.200.20
af_Q54PF7_21_118_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8561 16 96 2.60.200.20
3poaA00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8483 2 96 2.60.200.20
af_Q5I2W8_2_94_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8459 2 91 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A2V8B2U7-F1-model_v4 FHA domain-containing protein 0.9427 1 96
AF-A0A6L8GH98-F1-model_v4 FHA domain-containing protein 0.9369 1 96
AF-A0A2V8B2U7-F1-model_v4 FHA domain-containing protein 0.9327 1 96
AF-A0A2V7PZZ0-F1-model_v4 FHA domain-containing protein 0.9312 2 96 GO:0004016
GO:0005886
GO:0006171
GO:0035556
AF-A0A3N5PEZ4-F1-model_v4 FHA domain-containing protein 0.9293 1 96

Map