F446054

General Info

Members Datasets Scaffolds Average Seq Length
447 275 435 204

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0114536|Ga0500559_0114536_381_1001
Length 206
Sequence MVDHLLQNNVAWAQGKIRSDPHFFERLEGQQAPAYLWIGCSDSRVPANEIVGMDPGELFVHRNVANLAPPQDANYLSVLQYAVEVLKVRHILVVGHYGCGGIATAVDGHRHGLIDHWLHPIREVAGEYRTELEGLDEEARHNRLCELNVQRQVRNVASDVIVQDAWSRGQPLKVHGWVYSLHNGLVTDLKTTLASIEDYQRVAPGG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2643221583 Caulobacter sp. Root655 Isolate Unclassified
4 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
5 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
6 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
7 2849560528 Caulobacter zeae 410 Isolate Unclassified
8 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
9 2851153111 Caulobacter radicis 736 Isolate Unclassified
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
12 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
254 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
258 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
259 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
260 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
261 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.09
Nodule 0.22
Rhizoplane 3.36
Rhizosphere 75.39
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10155068 3300003320 Bacteria 1639
2 rootL2_10109014 3300003322 Bacteria 1545
3 Ga0055537_1001348 3300003773 Bacteria 9936
4 Ga0055524_1010773 3300003775 Bacteria 3617
5 Ga0055528_1019254 3300003790 Bacteria 2272
6 Ga0055531_10003059 3300003794 Bacteria 10834
7 Ga0055543_1007224 3300004625 Bacteria 2589
8 Ga0065165_1000345 3300005262 Bacteria 76072
9 Ga0065165_1001741 3300005262 Bacteria 21716
10 Ga0070658_10110657 3300005327 Bacteria 2275
11 Ga0070690_100168233 3300005330 Bacteria 1507
12 Ga0070670_100016807 3300005331 Bacteria 6279
13 Ga0070670_100030887 3300005331 Bacteria 4614
14 Ga0068869_100257104 3300005334 Bacteria 1397
15 Ga0070680_100205802 3300005336 Bacteria 1660
16 Ga0070680_100510484 3300005336 Bacteria 1029
17 Ga0070660_100044754 3300005339 Bacteria 3386
18 Ga0070660_100091079 3300005339 Bacteria 2405
19 Ga0070668_100020890 3300005347 Bacteria 4945
20 Ga0070668_100025498 3300005347 Bacteria 4483
21 Ga0070668_100034348 3300005347 Bacteria 3864
22 Ga0070668_100051190 3300005347 Bacteria 3182
23 Ga0070669_100005739 3300005353 Bacteria 8946
24 Ga0070669_100061759 3300005353 Bacteria 2754
25 Ga0070671_100014708 3300005355 Bacteria 6324
26 Ga0070671_100034508 3300005355 Bacteria 4188
27 Ga0070674_100237181 3300005356 Bacteria 1426
28 Ga0070659_100003552 3300005366 Bacteria 11105
29 Ga0070667_100022478 3300005367 Bacteria 5230
30 Ga0070667_100074463 3300005367 Bacteria 2897
31 Ga0070714_100189469 3300005435 Bacteria 1876
32 Ga0070713_100591231 3300005436 Bacteria 1054
33 Ga0070711_100132563 3300005439 Bacteria 1858
34 Ga0070711_101334339 3300005439 Bacteria 623
35 Ga0070705_100000274 3300005440 Bacteria 31250
36 Ga0070700_100033844 3300005441 Bacteria 3081
37 Ga0070700_100243197 3300005441 Bacteria 1287
38 Ga0070694_100058420 3300005444 Bacteria 2624
39 Ga0070708_100033258 3300005445 Bacteria 4480
40 Ga0070708_100157716 3300005445 Bacteria 2113
41 Ga0070663_100116045 3300005455 Bacteria 2017
42 Ga0070678_101115948 3300005456 Bacteria 729
43 Ga0070681_10028515 3300005458 Bacteria 5613
44 Ga0070681_10117972 3300005458 Bacteria 2590
45 Ga0070685_10453221 3300005466 Bacteria 899
46 Ga0070706_100189846 3300005467 Bacteria 1920
47 Ga0070699_100001895 3300005518 Bacteria 18874
48 Ga0070697_100062549 3300005536 Bacteria 3038
49 Ga0070695_100017257 3300005545 Bacteria 4376
50 Ga0070696_100000144 3300005546 Bacteria 39344
51 Ga0070665_100000246 3300005548 Bacteria 90170
52 Ga0070665_100003103 3300005548 Bacteria 17889
53 Ga0070665_100323854 3300005548 Bacteria 1545
54 Ga0070704_100001504 3300005549 Bacteria 12551
55 Ga0068855_100081767 3300005563 Bacteria 3744
56 Ga0068855_100181277 3300005563 Bacteria 2381
57 Ga0070664_100950090 3300005564 Bacteria 807
58 Ga0068857_100003944 3300005577 Bacteria 12490
59 Ga0068857_100344644 3300005577 Bacteria 1379
60 Ga0068856_100121239 3300005614 Bacteria 2616
61 Ga0068859_100000111 3300005617 Bacteria 77474
62 Ga0068859_100010211 3300005617 Bacteria 9449
63 Ga0068859_100178508 3300005617 Bacteria 2206
64 Ga0068859_100979706 3300005617 Bacteria 928
65 Ga0068864_100000304 3300005618 Bacteria 43692
66 Ga0068864_100072749 3300005618 Bacteria 2997
67 Ga0068864_100082981 3300005618 Bacteria 2814
68 Ga0068861_100041659 3300005719 Bacteria 3440
69 Ga0068863_100000076 3300005841 Bacteria 109412
70 Ga0068863_100452176 3300005841 Bacteria 1261
71 Ga0068863_101004955 3300005841 Bacteria 837
72 Ga0068858_100000079 3300005842 Bacteria 100753
73 Ga0068858_100000500 3300005842 Bacteria 41083
74 Ga0068860_100000265 3300005843 Bacteria 76672
75 Ga0068860_100015850 3300005843 Bacteria 7358
76 Ga0068860_100036819 3300005843 Bacteria 4686
77 Ga0068860_100279350 3300005843 Bacteria 1631
78 Ga0068862_100018081 3300005844 Bacteria 5871
79 Ga0068862_100025053 3300005844 Bacteria 5008
80 Ga0068862_100062372 3300005844 Bacteria 3205
81 Ga0068862_100068595 3300005844 Bacteria 3059
82 Ga0075368_10000230 3300006042 Bacteria 15775
83 Ga0075363_100138959 3300006048 Bacteria 1367
84 Ga0075364_10012368 3300006051 Bacteria 5218
85 Ga0075367_10000291 3300006178 Bacteria 17585
86 Ga0075366_10057572 3300006195 Bacteria 2310
87 Ga0075428_100475230 3300006844 Bacteria 1338
88 Ga0075433_10242830 3300006852 Bacteria 1599
89 Ga0097620_100000111 3300006931 Bacteria 77474
90 Ga0097620_100010212 3300006931 Bacteria 9449
91 Ga0097620_100178501 3300006931 Bacteria 2206
92 Ga0097620_100979498 3300006931 Bacteria 928
93 Ga0079104_1020581 3300006946 Bacteria 1815
94 Ga0105250_10009947 3300009092 Bacteria 3989
95 Ga0105240_10094794 3300009093 Bacteria 3640
96 Ga0105240_10292278 3300009093 Bacteria 1867
97 Ga0105240_10401193 3300009093 Bacteria 1544
98 Ga0111539_10013797 3300009094 Bacteria 10097
99 Ga0111539_10076916 3300009094 Bacteria 3929
100 Ga0105245_10276745 3300009098 Bacteria 1639
101 Ga0105247_10486976 3300009101 Bacteria 896
102 Ga0114129_10102679 3300009147 Bacteria 3954
103 Ga0105243_10350136 3300009148 Bacteria 1356
104 Ga0105241_10126511 3300009174 Bacteria 2064
105 Ga0105241_10339145 3300009174 Bacteria 1302
106 Ga0105242_10052365 3300009176 Bacteria 3330
107 Ga0105248_10000112 3300009177 Bacteria 91321
108 Ga0105248_10003951 3300009177 Bacteria 16389
109 Ga0105248_10008338 3300009177 Bacteria 11388
110 Ga0105248_10291119 3300009177 Bacteria 1839
111 Ga0105248_11169854 3300009177 Bacteria 869
112 Ga0105237_11161250 3300009545 Bacteria 779
113 Ga0105238_10102639 3300009551 Bacteria 2841
114 Ga0105238_10634816 3300009551 Bacteria 1077
115 Ga0105249_10028728 3300009553 Bacteria 5019
116 Ga0105249_10144292 3300009553 Bacteria 2286
117 Ga0105249_10747832 3300009553 Bacteria 1040
118 Ga0105239_10299144 3300010375 Bacteria 1812
119 Ga0105239_10420756 3300010375 Bacteria 1513
120 Ga0105239_10833442 3300010375 Bacteria 1057
121 Ga0157378_10735192 3300013297 Bacteria 1008
122 Ga0163162_10317560 3300013306 Bacteria 1690
123 Ga0163162_10389261 3300013306 Bacteria 1527
124 Ga0163163_10002482 3300014325 Bacteria 15605
125 Ga0163163_10073353 3300014325 Bacteria 3413
126 Ga0163163_11468325 3300014325 Bacteria 743
127 Ga0157380_10104964 3300014326 Bacteria 2361
128 Ga0157379_10010077 3300014968 Bacteria 8238
129 Ga0157379_10368653 3300014968 Bacteria 1317
130 Ga0157376_10514586 3300014969 Bacteria 1178
131 Ga0157376_10812544 3300014969 Bacteria 948
132 Ga0213872_10189427 3300021361 Bacteria 886
133 Ga0213876_10000183 3300021384 Bacteria 64845
134 Ga0213876_10000852 3300021384 Bacteria 20544
135 Ga0213876_10008707 3300021384 Bacteria 5485
136 Ga0209565_1000192 3300025263 Bacteria 74812
137 Ga0209565_1000416 3300025263 Bacteria 35062
138 Ga0209455_1018319 3300025272 Bacteria 1441
139 Ga0209673_1002928 3300025273 Bacteria 10742
140 Ga0209564_1002796 3300025295 Bacteria 13026
141 Ga0209564_1016042 3300025295 Bacteria 3010
142 Ga0209758_1000404 3300025297 Bacteria 74016
143 Ga0209050_1001947 3300025298 Bacteria 19566
144 Ga0209256_1000810 3300025299 Bacteria 40058
145 Ga0209256_1002332 3300025299 Bacteria 15838
146 Ga0209256_1002347 3300025299 Bacteria 15761
147 Ga0209257_1000227 3300025304 Bacteria 133512
148 Ga0209257_1000507 3300025304 Bacteria 68362
149 Ga0207696_1012150 3300025711 Bacteria 3056
150 Ga0207653_10002344 3300025885 Bacteria 6034
151 Ga0207643_10324067 3300025908 Bacteria 963
152 Ga0207684_10163578 3300025910 Bacteria 1917
153 Ga0207684_10180836 3300025910 Bacteria 1818
154 Ga0207707_10094960 3300025912 Bacteria 2606
155 Ga0207707_10145256 3300025912 Bacteria 2074
156 Ga0207707_10320004 3300025912 Bacteria 1340
157 Ga0207695_10083991 3300025913 Bacteria 3216
158 Ga0207695_10299910 3300025913 Bacteria 1498
159 Ga0207671_10766567 3300025914 Bacteria 766
160 Ga0207663_10219437 3300025916 Bacteria 1383
161 Ga0207660_10047660 3300025917 Bacteria 3031
162 Ga0207681_10005787 3300025923 Bacteria 7582
163 Ga0207681_10179878 3300025923 Bacteria 1610
164 Ga0207694_10380846 3300025924 Bacteria 1171
165 Ga0207694_10433024 3300025924 Bacteria 1096
166 Ga0207650_10016221 3300025925 Bacteria 5203
167 Ga0207650_10071491 3300025925 Bacteria 2610
168 Ga0207687_10322188 3300025927 Bacteria 1251
169 Ga0207664_10506083 3300025929 Bacteria 1082
170 Ga0207644_10001122 3300025931 Bacteria 17189
171 Ga0207644_10878058 3300025931 Bacteria 751
172 Ga0207690_10000230 3300025932 Bacteria 41628
173 Ga0207706_10170769 3300025933 Bacteria 1911
174 Ga0207686_10027356 3300025934 Bacteria 3339
175 Ga0207704_10000424 3300025938 Bacteria 18950
176 Ga0207704_10176258 3300025938 Bacteria 1540
177 Ga0207711_10000718 3300025941 Bacteria 32642
178 Ga0207711_10002456 3300025941 Bacteria 16536
179 Ga0207711_10044816 3300025941 Bacteria 3778
180 Ga0207689_10100415 3300025942 Bacteria 2377
181 Ga0207667_10541974 3300025949 Bacteria 1177
182 Ga0207712_10014795 3300025961 Bacteria 5023
183 Ga0207668_10003109 3300025972 Bacteria 9726
184 Ga0207668_10087714 3300025972 Bacteria 2276
185 Ga0207640_10070422 3300025981 Bacteria 2352
186 Ga0207658_10001987 3300025986 Bacteria 15254
187 Ga0207658_10105707 3300025986 Bacteria 2214
188 Ga0207703_10000051 3300026035 Bacteria 145390
189 Ga0207703_10008131 3300026035 Bacteria 8292
190 Ga0207703_10227756 3300026035 Bacteria 1670
191 Ga0207639_10274051 3300026041 Bacteria 1481
192 Ga0207678_10015751 3300026067 Bacteria 6645
193 Ga0207708_10054015 3300026075 Bacteria 3062
194 Ga0207708_10270478 3300026075 Bacteria 1374
195 Ga0207708_10339630 3300026075 Bacteria 1230
196 Ga0207702_10027809 3300026078 Bacteria 4698
197 Ga0207702_10135746 3300026078 Bacteria 2219
198 Ga0207641_10000003 3300026088 Bacteria 496984
199 Ga0207641_10008043 3300026088 Bacteria 8739
200 Ga0207641_10037118 3300026088 Bacteria 4068
201 Ga0207676_10002718 3300026095 Bacteria 12593
202 Ga0207676_10039898 3300026095 Bacteria 3595
203 Ga0207676_10183148 3300026095 Bacteria 1836
204 Ga0207676_10239811 3300026095 Bacteria 1626
205 Ga0207676_10506050 3300026095 Bacteria 1148
206 Ga0207676_11051695 3300026095 Bacteria 803
207 Ga0207674_10024173 3300026116 Bacteria 6496
208 Ga0207683_10322973 3300026121 Bacteria 1414
209 Ga0207683_10339067 3300026121 Bacteria 1378
210 Ga0207428_10021030 3300027907 Bacteria 5531
211 Ga0268266_10000003 3300028379 Bacteria 1701703
212 Ga0268266_10000127 3300028379 Bacteria 149198
213 Ga0268266_10237347 3300028379 Bacteria 1681
214 Ga0268265_10001625 3300028380 Bacteria 18497
215 Ga0268265_10001992 3300028380 Bacteria 16163
216 Ga0268265_10012100 3300028380 Bacteria 5843
217 Ga0268265_10025845 3300028380 Bacteria 4173
218 Ga0268264_10000318 3300028381 Bacteria 76687
219 Ga0268264_10020024 3300028381 Bacteria 5466
220 Ga0268264_10032918 3300028381 Bacteria 4254
221 Ga0268264_10123576 3300028381 Bacteria 2284
222 Ga0265334_10009927 3300028573 Bacteria 4025
223 Ga0265334_10044329 3300028573 Bacteria 1728
224 Ga0307517_10006025 3300028786 Bacteria 18059
225 Ga0307517_10024782 3300028786 Bacteria 7372
226 Ga0307515_10284611 3300028794 Bacteria 1356
227 Ga0265338_10027878 3300028800 Bacteria 5651
228 Ga0265338_10115304 3300028800 Bacteria 2154
229 Ga0265338_10235249 3300028800 Bacteria 1360
230 Ga0265340_10002223 3300031247 Bacteria 11099
231 Ga0265340_10032874 3300031247 Bacteria 2586
232 Ga0265340_10034368 3300031247 Bacteria 2522
233 Ga0265340_10043595 3300031247 Bacteria 2198
234 Ga0265340_10052288 3300031247 Bacteria 1976
235 Ga0265339_10083049 3300031249 Bacteria 1690
236 Ga0265327_10077899 3300031251 Bacteria 1643
237 Ga0265327_10145970 3300031251 Bacteria 1102
238 Ga0265316_10003139 3300031344 Bacteria 16822
239 Ga0307513_10005316 3300031456 Bacteria 17027
240 Ga0307513_10007002 3300031456 Bacteria 14669
241 Ga0307513_10127980 3300031456 Bacteria 2490
242 Ga0307513_10174828 3300031456 Bacteria 2019
243 Ga0265313_10002915 3300031595 Bacteria 14297
244 Ga0265313_10125194 3300031595 Bacteria 1117
245 Ga0307508_10288924 3300031616 Bacteria 1233
246 Ga0265314_10041692 3300031711 Bacteria 3282
247 Ga0265314_10104319 3300031711 Bacteria 1816
248 Ga0265314_10147099 3300031711 Bacteria 1450
249 Ga0265342_10014140 3300031712 Bacteria 5309
250 Ga0307516_10000002 3300031730 Bacteria 467851
251 Ga0307516_10128358 3300031730 Bacteria 2318
252 Ga0307405_10181420 3300031731 Bacteria 1512
253 Ga0307406_10231536 3300031901 Bacteria 1380
254 Ga0307412_10547050 3300031911 Bacteria 972
255 Ga0373944_0043418 3300035089 Bacteria 1397
256 Ga0373936_0029084 3300035113 Bacteria 2174
257 Ga0373936_0236540 3300035113 Bacteria 813
258 Ga0373945_0181452 3300035116 Bacteria 867
259 Ga0373946_0006963 3300035171 Bacteria 4120
260 Ga0373935_0030494 3300035692 Bacteria 3343
261 Ga0373935_0344237 3300035692 Bacteria 1062
262 Ga0373927_0000257 3300035695 Bacteria 41787
263 Ga0373927_0003697 3300035695 Bacteria 10880
264 Ga0373937_0334279 3300036401 Bacteria 1434
265 Ga0373925_0000083 3300037068 Bacteria 101171
266 Ga0373925_0082389 3300037068 Bacteria 2448
267 Ga0373925_0232935 3300037068 Bacteria 1473
268 Ga0373925_0344033 3300037068 Bacteria 1210
269 Ga0395899_0212460 3300037312 Bacteria 1344
270 Ga0395900_0011388 3300037418 Bacteria 9102
271 Ga0395900_0392346 3300037418 Bacteria 1354
272 Ga0395898_0063909 3300037466 Bacteria 3571
273 Ga0395898_0311361 3300037466 Bacteria 1502
274 Ga0395905_0042139 3300037471 Bacteria 4283
275 Ga0395901_0022971 3300038443 Bacteria 6393
276 Ga0436365_0186359 3300039437 Bacteria 1529
277 Ga0436365_0572622 3300039437 Bacteria 1340
278 Ga0436365_0640791 3300039437 Bacteria 50242
279 Ga0436365_0981941 3300039437 Bacteria 54107
280 Ga0436365_1912376 3300039437 Bacteria 2388
281 Ga0436360_0194920 3300039438 Bacteria 994
282 Ga0436360_0602113 3300039438 Bacteria 1891
283 Ga0436360_1042683 3300039438 Bacteria 1482
284 Ga0436360_1208427 3300039438 Bacteria 859
285 Ga0436361_0208418 3300039447 Bacteria 17479
286 Ga0436361_0431335 3300039447 Bacteria 5764
287 Ga0436362_0821359 3300039453 Bacteria 731
288 Ga0451807_1489295 3300041486 Bacteria 867
289 Ga0466961_0355811 3300044693 Bacteria 891
290 Ga0495627_000906 3300046453 Bacteria 20642
291 Ga0495590_0005965 3300046457 Bacteria 4776
292 Ga0495629_0227815 3300046459 Bacteria 1285
293 Ga0495638_0000185 3300046460 Bacteria 95220
294 Ga0495638_0001344 3300046460 Bacteria 22555
295 Ga0495638_0018150 3300046460 Bacteria 4675
296 Ga0495650_0108502 3300046471 Bacteria 1033
297 Ga0495580_0143254 3300046472 Bacteria 1657
298 Ga0495580_0451018 3300046472 Bacteria 863
299 Ga0495639_0049685 3300046475 Bacteria 1904
300 Ga0495585_0051553 3300046492 Bacteria 2280
301 Ga0495583_0000003 3300046506 Bacteria 709273
302 Ga0495606_0006146 3300046507 Bacteria 11190
303 Ga0495608_0548677 3300046511 Bacteria 697
304 Ga0495610_0000524 3300046512 Bacteria 38586
305 Ga0495610_0000985 3300046512 Bacteria 26266
306 Ga0495616_0284999 3300046513 Bacteria 701
307 Ga0495628_0251797 3300046516 Bacteria 1318
308 Ga0495648_0000191 3300046524 Bacteria 70452
309 Ga0495663_0079782 3300046525 Bacteria 1053
310 Ga0495665_0246785 3300046531 Bacteria 919
311 Ga0495640_0182965 3300046533 Bacteria 1335
312 Ga0495645_0040922 3300046543 Bacteria 3379
313 Ga0495633_0245112 3300046558 Bacteria 818
314 Ga0495668_0002187 3300046616 Bacteria 16721
315 Ga0495668_0050500 3300046616 Bacteria 2305
316 Ga0495625_0004176 3300046660 Bacteria 13761
317 Ga0495625_0004648 3300046660 Bacteria 12893
318 Ga0495625_0006767 3300046660 Bacteria 10144
319 Ga0495625_0014722 3300046660 Bacteria 6227
320 Ga0495625_0125929 3300046660 Bacteria 1739
321 Ga0495669_0000081 3300046684 Bacteria 63806
322 Ga0495671_0040168 3300046692 Bacteria 2360
323 Ga0495671_0099566 3300046692 Bacteria 1421
324 Ga0495589_0049791 3300046794 Bacteria 2073
325 Ga0495581_0120222 3300047315 Bacteria 1529
326 Ga0495674_0325070 3300047319 Bacteria 1252
327 Ga0495672_0004566 3300047320 Bacteria 11257
328 Ga0495676_0537315 3300047321 Bacteria 765
329 Ga0495673_0000312 3300047469 Bacteria 63724
330 Ga0495673_0000433 3300047469 Bacteria 47031
331 Ga0495673_0002154 3300047469 Bacteria 14295
332 Ga0495684_0061226 3300047471 Bacteria 2864
333 Ga0495686_0000850 3300047472 Bacteria 39221
334 Ga0495602_0183743 3300048088 Bacteria 1610
335 Ga0496100_0129660 3300048903 Bacteria 1775
336 Ga0496100_0163171 3300048903 Bacteria 1599
337 Ga0496101_0455189 3300048904 Bacteria 1010
338 Ga0496102_0064197 3300048905 Bacteria 3363
339 Ga0496103_0024857 3300048906 Bacteria 3615
340 Ga0496106_0005275 3300048909 Bacteria 9573
341 Ga0496106_0017948 3300048909 Bacteria 5233
342 Ga0496107_0000209 3300048910 Bacteria 30900
343 Ga0496107_0052817 3300048910 Bacteria 2931
344 Ga0496109_0539591 3300048912 Bacteria 1100
345 Ga0496111_0647899 3300048914 Bacteria 771
346 Ga0496115_0001829 3300048918 Bacteria 15223
347 Ga0496115_0012114 3300048918 Bacteria 6483
348 Ga0496115_0015505 3300048918 Bacteria 5782
349 Ga0496117_0014642 3300048920 Bacteria 6745
350 Ga0496118_0010767 3300048921 Bacteria 9014
351 Ga0496119_0226318 3300048922 Bacteria 954
352 Ga0496121_0000334 3300048924 Bacteria 98442
353 Ga0496121_0004173 3300048924 Bacteria 19753
354 Ga0501031_0166906 3300049568 Bacteria 1439
355 Ga0501032_0172178 3300049569 Bacteria 1419
356 Ga0501032_0539470 3300049569 Bacteria 744
357 Ga0501033_0018934 3300049570 Bacteria 5204
358 Ga0501033_0124259 3300049570 Bacteria 1871
359 Ga0501034_0033419 3300049571 Bacteria 5219
360 Ga0501034_0105974 3300049571 Bacteria 2804
361 Ga0501037_0324063 3300049573 Bacteria 1066
362 Ga0501038_0021087 3300049574 Bacteria 5853
363 Ga0501039_0786093 3300049575 Bacteria 743
364 Ga0501040_0050903 3300049576 Bacteria 2834
365 Ga0501042_0369862 3300049578 Bacteria 1037
366 Ga0501043_0028724 3300049579 Bacteria 4366
367 Ga0501047_0008914 3300049581 Bacteria 9469
368 Ga0501047_0107180 3300049581 Bacteria 2676
369 Ga0501047_0123235 3300049581 Bacteria 2473
370 Ga0501047_0438890 3300049581 Bacteria 1136
371 Ga0501067_0004591 3300049583 Bacteria 7641
372 Ga0501067_0053687 3300049583 Bacteria 2233
373 Ga0501067_0243038 3300049583 Bacteria 1002
374 Ga0501067_0271610 3300049583 Bacteria 944
375 Ga0501070_0446768 3300049586 Bacteria 1043
376 Ga0501073_0033101 3300049589 Bacteria 3682
377 Ga0501074_0223032 3300049590 Bacteria 1342
378 Ga0501075_0139820 3300049591 Bacteria 1845
379 Ga0501076_0386559 3300049592 Bacteria 1150
380 Ga0501257_005091 3300049686 Bacteria 2889
381 Ga0501079_0171045 3300049741 Bacteria 1694
382 Ga0501080_0007769 3300049742 Bacteria 9695
383 Ga0501080_0057552 3300049742 Bacteria 3619
384 Ga0501035_0054979 3300049822 Bacteria 3555
385 Ga0501035_0239735 3300049822 Bacteria 1543
386 Ga0501044_0020080 3300049823 Bacteria 7133
387 Ga0501044_0135373 3300049823 Bacteria 2455
388 Ga0501044_0140081 3300049823 Bacteria 2408
389 nmdc:mga03n38_108541_c1 3300050490 Bacteria 1348
390 nmdc:mga00v17_9721_c1 3300050491 Bacteria 5219
391 nmdc:mga0yw44_18104_c1 3300050492 Bacteria 3851
392 nmdc:mga0k408_217464_c1 3300050493 Bacteria 1141
393 nmdc:mga0k408_464551_c1 3300050493 Bacteria 751
394 nmdc:mga07m45_15340_c2 3300050496 Bacteria 3016
395 nmdc:mga07m45_54998_c1 3300050496 Bacteria 2249
396 nmdc:mga09592_140409_c1 3300050508 Bacteria 2082
397 nmdc:mga08y16_20570_c1 3300050511 Bacteria 6967
398 nmdc:mga08x19_59028_c1 3300050514 Bacteria 2483
399 Ga0495612_0220419 3300053078 Bacteria 840
400 Ga0500578_0000015 3300053086 Bacteria 179217
401 Ga0500643_003965 3300053087 Bacteria 6846
402 Ga0500643_015284 3300053087 Bacteria 2636
403 Ga0500643_016405 3300053087 Bacteria 2509
404 Ga0500644_0000058 3300053088 Bacteria 64557
405 Ga0500644_0018082 3300053088 Bacteria 2058
406 Ga0500641_0001454 3300053096 Bacteria 8437
407 Ga0500555_000733 3300053103 Bacteria 12145
408 Ga0500556_0002463 3300053104 Bacteria 5921
409 Ga0500556_0005726 3300053104 Bacteria 3516
410 Ga0500556_0119479 3300053104 Bacteria 1027
411 Ga0500562_000626 3300053108 Bacteria 8522
412 Ga0500562_001605 3300053108 Bacteria 5617
413 Ga0500562_001894 3300053108 Bacteria 5246
414 Ga0500572_001580 3300053111 Bacteria 6048
415 Ga0500594_0000249 3300053118 Bacteria 12919
416 Ga0500595_014391 3300053119 Bacteria 3001
417 Ga0500595_017283 3300053119 Bacteria 2665
418 Ga0500607_016083 3300053121 Bacteria 4299
419 Ga0500642_0004345 3300053130 Bacteria 4425
420 Ga0500652_223450 3300053131 Bacteria 756
421 Ga0500658_0000956 3300053134 Bacteria 11804
422 Ga0500559_0114536 3300053136 Bacteria 1251
423 Ga0500564_000038 3300053138 Bacteria 36426
424 Ga0500604_0024725 3300053151 Bacteria 1722
425 Ga0500616_0075604 3300053153 Bacteria 1704
426 Ga0500622_0003083 3300053156 Bacteria 11483
427 Ga0500622_0105743 3300053156 Bacteria 1380
428 Ga0500645_002623 3300053730 Bacteria 7872
429 Ga0500645_003616 3300053730 Bacteria 6190
430 Ga0500645_009128 3300053730 Bacteria 3345
431 Ga0501084_0093878 3300054114 Bacteria 2519
432 Ga0501084_0262169 3300054114 Bacteria 1459
433 Ga0501082_0381610 3300060353 Bacteria 1230
434 Ga0501082_1521323 3300060353 Bacteria 584
435 Ga0530510_0821320 3300061734 Bacteria 709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_1521323 Ga0501082_1521323_17_571 182
2 3300039438 Ga0436360_1208427 Ga0436360_1208427_287_841 184
3 3300049589 Ga0501073_0033101 Ga0501073_0033101_29_598 189
4 3300031247 Ga0265340_10043595 Ga0265340_100435953 191
5 3300048088 Ga0495602_0183743 Ga0495602_0183743_205_789 194
6 3300021384 Ga0213876_10000183 Ga0213876_1000018341 196
7 3300026035 Ga0207703_10227756 Ga0207703_102277562 196
8 3300039437 Ga0436365_0640791 Ga0436365_0640791_21812_22408 196
9 3300005336 Ga0070680_100510484 Ga0070680_1005104841 197
10 3300005439 Ga0070711_101334339 Ga0070711_1013343391 197
11 3300014326 Ga0157380_10104964 Ga0157380_101049642 197
12 3300025908 Ga0207643_10324067 Ga0207643_103240671 197
13 3300026121 Ga0207683_10339067 Ga0207683_103390671 197
14 3300046459 Ga0495629_0227815 Ga0495629_0227815_236_829 197
15 3300046472 Ga0495580_0451018 Ga0495580_0451018_166_759 197
16 3300046475 Ga0495639_0049685 Ga0495639_0049685_318_911 197
17 3300046531 Ga0495665_0246785 Ga0495665_0246785_277_870 197
18 3300047319 Ga0495674_0325070 Ga0495674_0325070_592_1185 197
19 3300005617 Ga0068859_100979706 Ga0068859_1009797061 198
20 3300006931 Ga0097620_100979498 Ga0097620_1009794982 198
21 3300049583 Ga0501067_0243038 Ga0501067_0243038_278_886 198
22 3300054114 Ga0501084_0262169 Ga0501084_0262169_294_896 198
23 3300005330 Ga0070690_100168233 Ga0070690_1001682331 199
24 3300005334 Ga0068869_100257104 Ga0068869_1002571042 199
25 3300005336 Ga0070680_100205802 Ga0070680_1002058022 199
26 3300005435 Ga0070714_100189469 Ga0070714_1001894692 199
27 3300005439 Ga0070711_100132563 Ga0070711_1001325631 199
28 3300005440 Ga0070705_100000274 Ga0070705_10000027433 199
29 3300005441 Ga0070700_100033844 Ga0070700_1000338442 199
30 3300005444 Ga0070694_100058420 Ga0070694_1000584202 199
31 3300005445 Ga0070708_100033258 Ga0070708_1000332584 199
32 3300005445 Ga0070708_100157716 Ga0070708_1001577161 199
33 3300005455 Ga0070663_100116045 Ga0070663_1001160451 199
34 3300005458 Ga0070681_10028515 Ga0070681_100285155 199
35 3300005467 Ga0070706_100189846 Ga0070706_1001898462 199
36 3300005518 Ga0070699_100001895 Ga0070699_1000018952 199
37 3300005536 Ga0070697_100062549 Ga0070697_1000625491 199
38 3300005545 Ga0070695_100017257 Ga0070695_1000172574 199
39 3300005546 Ga0070696_100000144 Ga0070696_10000014441 199
40 3300005549 Ga0070704_100001504 Ga0070704_10000150413 199
41 3300005577 Ga0068857_100003944 Ga0068857_1000039443 199
42 3300005617 Ga0068859_100010211 Ga0068859_1000102113 199
43 3300005618 Ga0068864_100082981 Ga0068864_1000829812 199
44 3300005719 Ga0068861_100041659 Ga0068861_1000416594 199
45 3300005843 Ga0068860_100036819 Ga0068860_1000368195 199
46 3300005844 Ga0068862_100068595 Ga0068862_1000685953 199
47 3300006931 Ga0097620_100010212 Ga0097620_1000102123 199
48 3300009174 Ga0105241_10126511 Ga0105241_101265112 199
49 3300009174 Ga0105241_10339145 Ga0105241_103391452 199
50 3300009553 Ga0105249_10028728 Ga0105249_100287285 199
51 3300014968 Ga0157379_10368653 Ga0157379_103686532 199
52 3300014969 Ga0157376_10514586 Ga0157376_105145861 199
53 3300025885 Ga0207653_10002344 Ga0207653_100023441 199
54 3300025910 Ga0207684_10163578 Ga0207684_101635782 199
55 3300025912 Ga0207707_10145256 Ga0207707_101452562 199
56 3300025917 Ga0207660_10047660 Ga0207660_100476602 199
57 3300025938 Ga0207704_10176258 Ga0207704_101762581 199
58 3300025942 Ga0207689_10100415 Ga0207689_101004152 199
59 3300025961 Ga0207712_10014795 Ga0207712_100147955 199
60 3300026067 Ga0207678_10015751 Ga0207678_100157514 199
61 3300026075 Ga0207708_10054015 Ga0207708_100540153 199
62 3300026078 Ga0207702_10135746 Ga0207702_101357462 199
63 3300026095 Ga0207676_10039898 Ga0207676_100398984 199
64 3300026116 Ga0207674_10024173 Ga0207674_100241732 199
65 3300028380 Ga0268265_10001992 Ga0268265_100019924 199
66 3300028381 Ga0268264_10123576 Ga0268264_101235762 199
67 3300028573 Ga0265334_10044329 Ga0265334_100443291 199
68 3300039437 Ga0436365_0186359 Ga0436365_0186359_443_1042 199
69 3300046533 Ga0495640_0182965 Ga0495640_0182965_648_1247 199
70 3300047471 Ga0495684_0061226 Ga0495684_0061226_341_940 199
71 3300048905 Ga0496102_0064197 Ga0496102_0064197_1084_1683 199
72 3300048906 Ga0496103_0024857 Ga0496103_0024857_1977_2576 199
73 3300048909 Ga0496106_0005275 Ga0496106_0005275_1107_1706 199
74 3300048910 Ga0496107_0052817 Ga0496107_0052817_139_738 199
75 3300048912 Ga0496109_0539591 Ga0496109_0539591_476_1075 199
76 3300049571 Ga0501034_0033419 Ga0501034_0033419_1395_1994 199
77 3300049576 Ga0501040_0050903 Ga0501040_0050903_798_1397 199
78 3300049578 Ga0501042_0369862 Ga0501042_0369862_179_778 199
79 3300049581 Ga0501047_0107180 Ga0501047_0107180_1148_1747 199
80 3300049591 Ga0501075_0139820 Ga0501075_0139820_909_1508 199
81 3300049592 Ga0501076_0386559 Ga0501076_0386559_304_903 199
82 3300049741 Ga0501079_0171045 Ga0501079_0171045_417_1016 199
83 3300061734 Ga0530510_0821320 Ga0530510_0821320_67_666 199
84 iso_pu_bacteria 2896109856 2896112130 199
85 3300005356 Ga0070674_100237181 Ga0070674_1002371812 200
86 3300031730 Ga0307516_10000002 Ga0307516_1000000276 200
87 3300048903 Ga0496100_0163171 Ga0496100_0163171_40_642 200
88 3300049581 Ga0501047_0438890 Ga0501047_0438890_197_799 200
89 3300049583 Ga0501067_0053687 Ga0501067_0053687_754_1356 200
90 3300049583 Ga0501067_0271610 Ga0501067_0271610_332_934 200
91 3300054114 Ga0501084_0093878 Ga0501084_0093878_1164_1766 200
92 3300009093 Ga0105240_10292278 Ga0105240_102922782 201
93 3300009147 Ga0114129_10102679 Ga0114129_101026792 201
94 3300009148 Ga0105243_10350136 Ga0105243_103501361 201
95 3300013297 Ga0157378_10735192 Ga0157378_107351922 201
96 3300021361 Ga0213872_10189427 Ga0213872_101894272 201
97 3300035692 Ga0373935_0344237 Ga0373935_0344237_392_1006 201
98 3300035695 Ga0373927_0003697 Ga0373927_0003697_1154_1768 201
99 3300037068 Ga0373925_0082389 Ga0373925_0082389_791_1405 201
100 3300037068 Ga0373925_0232935 Ga0373925_0232935_349_954 201
101 3300039447 Ga0436361_0431335 Ga0436361_0431335_4844_5449 201
102 3300047321 Ga0495676_0537315 Ga0495676_0537315_76_690 201
103 3300049583 Ga0501067_0004591 Ga0501067_0004591_6552_7157 201
104 3300050508 nmdc:mga09592_140409_c1 nmdc:mga09592_140409_c1_1120_1737 201
105 iso_pu_bacteria 2643221598 2643998251 201
106 3300005563 Ga0068855_100081767 Ga0068855_1000817672 202
107 3300025913 Ga0207695_10083991 Ga0207695_100839912 202
108 3300025929 Ga0207664_10506083 Ga0207664_105060832 202
109 iso_pu_bacteria 2510917020 2511122222 202
110 iso_pu_bacteria 2582581279 2585149880 202
111 iso_pu_bacteria 2643221583 2643926844 202
112 iso_pu_bacteria 2791355048 2792463112 202
113 iso_pu_bacteria 2843744320 2843745403 202
114 iso_pu_bacteria 2849560528 2849561012 202
115 iso_pu_bacteria 2849573788 2849576242 202
116 iso_pu_bacteria 2851153111 2851157052 202
117 iso_pu_bacteria 2898329390 2898332704 202
118 iso_pu_bacteria 2928531327 2928532340 202
119 3300005353 Ga0070669_100005739 Ga0070669_1000057395 203
120 3300005355 Ga0070671_100014708 Ga0070671_1000147089 203
121 3300005466 Ga0070685_10453221 Ga0070685_104532211 203
122 3300005617 Ga0068859_100000111 Ga0068859_10000011149 203
123 3300005842 Ga0068858_100000500 Ga0068858_10000050051 203
124 3300006042 Ga0075368_10000230 Ga0075368_100002302 203
125 3300006051 Ga0075364_10012368 Ga0075364_100123682 203
126 3300006178 Ga0075367_10000291 Ga0075367_100002918 203
127 3300006195 Ga0075366_10057572 Ga0075366_100575723 203
128 3300006931 Ga0097620_100000111 Ga0097620_10000011149 203
129 3300009101 Ga0105247_10486976 Ga0105247_104869762 203
130 3300009177 Ga0105248_10291119 Ga0105248_102911192 203
131 3300010375 Ga0105239_10299144 Ga0105239_102991442 203
132 3300013306 Ga0163162_10389261 Ga0163162_103892612 203
133 3300014968 Ga0157379_10010077 Ga0157379_100100773 203
134 3300025923 Ga0207681_10005787 Ga0207681_100057873 203
135 3300025931 Ga0207644_10001122 Ga0207644_1000112212 203
136 3300026035 Ga0207703_10008131 Ga0207703_100081319 203
137 3300026088 Ga0207641_10037118 Ga0207641_100371182 203
138 3300026095 Ga0207676_10183148 Ga0207676_101831482 203
139 3300028381 Ga0268264_10020024 Ga0268264_100200242 203
140 3300031456 Ga0307513_10174828 Ga0307513_101748282 203
141 3300039438 Ga0436360_0194920 Ga0436360_0194920_140_766 203
142 3300050491 nmdc:mga00v17_9721_c1 nmdc:mga00v17_9721_c1_977_1588 203
143 3300050496 nmdc:mga07m45_15340_c2 nmdc:mga07m45_15340_c2_706_1317 203
144 3300005327 Ga0070658_10110657 Ga0070658_101106572 204
145 3300005331 Ga0070670_100030887 Ga0070670_1000308872 204
146 3300005339 Ga0070660_100044754 Ga0070660_1000447544 204
147 3300005339 Ga0070660_100091079 Ga0070660_1000910792 204
148 3300005347 Ga0070668_100025498 Ga0070668_1000254984 204
149 3300005347 Ga0070668_100034348 Ga0070668_1000343483 204
150 3300005347 Ga0070668_100051190 Ga0070668_1000511903 204
151 3300005353 Ga0070669_100061759 Ga0070669_1000617592 204
152 3300005355 Ga0070671_100034508 Ga0070671_1000345081 204
153 3300005366 Ga0070659_100003552 Ga0070659_1000035523 204
154 3300005367 Ga0070667_100022478 Ga0070667_1000224782 204
155 3300005441 Ga0070700_100243197 Ga0070700_1002431971 204
156 3300005458 Ga0070681_10117972 Ga0070681_101179722 204
157 3300005548 Ga0070665_100000246 Ga0070665_10000024632 204
158 3300005548 Ga0070665_100003103 Ga0070665_1000031034 204
159 3300005548 Ga0070665_100323854 Ga0070665_1003238543 204
160 3300005617 Ga0068859_100178508 Ga0068859_1001785083 204
161 3300005618 Ga0068864_100000304 Ga0068864_1000003045 204
162 3300005618 Ga0068864_100072749 Ga0068864_1000727492 204
163 3300005841 Ga0068863_100000076 Ga0068863_10000007629 204
164 3300005841 Ga0068863_100452176 Ga0068863_1004521762 204
165 3300005842 Ga0068858_100000079 Ga0068858_10000007986 204
166 3300005843 Ga0068860_100000265 Ga0068860_10000026511 204
167 3300005843 Ga0068860_100279350 Ga0068860_1002793502 204
168 3300005844 Ga0068862_100018081 Ga0068862_1000180814 204
169 3300005844 Ga0068862_100062372 Ga0068862_1000623722 204
170 3300006844 Ga0075428_100475230 Ga0075428_1004752302 204
171 3300006852 Ga0075433_10242830 Ga0075433_102428302 204
172 3300006931 Ga0097620_100178501 Ga0097620_1001785013 204
173 3300009092 Ga0105250_10009947 Ga0105250_100099473 204
174 3300009093 Ga0105240_10094794 Ga0105240_100947943 204
175 3300009094 Ga0111539_10013797 Ga0111539_100137973 204
176 3300009094 Ga0111539_10076916 Ga0111539_100769162 204
177 3300009098 Ga0105245_10276745 Ga0105245_102767453 204
178 3300009176 Ga0105242_10052365 Ga0105242_100523654 204
179 3300009177 Ga0105248_10008338 Ga0105248_100083385 204
180 3300009177 Ga0105248_11169854 Ga0105248_111698541 204
181 3300009545 Ga0105237_11161250 Ga0105237_111612501 204
182 3300009551 Ga0105238_10102639 Ga0105238_101026392 204
183 3300009553 Ga0105249_10747832 Ga0105249_107478321 204
184 3300010375 Ga0105239_10420756 Ga0105239_104207563 204
185 3300014325 Ga0163163_10073353 Ga0163163_100733534 204
186 3300014325 Ga0163163_11468325 Ga0163163_114683251 204
187 3300025711 Ga0207696_1012150 Ga0207696_10121502 204
188 3300025910 Ga0207684_10180836 Ga0207684_101808362 204
189 3300025912 Ga0207707_10094960 Ga0207707_100949602 204
190 3300025916 Ga0207663_10219437 Ga0207663_102194372 204
191 3300025923 Ga0207681_10179878 Ga0207681_101798782 204
192 3300025925 Ga0207650_10016221 Ga0207650_100162216 204
193 3300025927 Ga0207687_10322188 Ga0207687_103221881 204
194 3300025931 Ga0207644_10878058 Ga0207644_108780581 204
195 3300025932 Ga0207690_10000230 Ga0207690_100002308 204
196 3300025933 Ga0207706_10170769 Ga0207706_101707692 204
197 3300025934 Ga0207686_10027356 Ga0207686_100273562 204
198 3300025972 Ga0207668_10003109 Ga0207668_100031094 204
199 3300025981 Ga0207640_10070422 Ga0207640_100704223 204
200 3300025986 Ga0207658_10105707 Ga0207658_101057073 204
201 3300026035 Ga0207703_10000051 Ga0207703_1000005131 204
202 3300026041 Ga0207639_10274051 Ga0207639_102740512 204
203 3300026075 Ga0207708_10270478 Ga0207708_102704782 204
204 3300026088 Ga0207641_10000003 Ga0207641_1000000340 204
205 3300026088 Ga0207641_10008043 Ga0207641_100080435 204
206 3300026095 Ga0207676_10002718 Ga0207676_100027186 204
207 3300026095 Ga0207676_10239811 Ga0207676_102398111 204
208 3300026095 Ga0207676_10506050 Ga0207676_105060502 204
209 3300026095 Ga0207676_11051695 Ga0207676_110516951 204
210 3300027907 Ga0207428_10021030 Ga0207428_100210304 204
211 3300028379 Ga0268266_10000003 Ga0268266_10000003972 204
212 3300028379 Ga0268266_10000127 Ga0268266_1000012747 204
213 3300028379 Ga0268266_10237347 Ga0268266_102373472 204
214 3300028380 Ga0268265_10001625 Ga0268265_100016256 204
215 3300028380 Ga0268265_10012100 Ga0268265_100121002 204
216 3300028380 Ga0268265_10025845 Ga0268265_100258452 204
217 3300028381 Ga0268264_10000318 Ga0268264_1000031858 204
218 3300028381 Ga0268264_10032918 Ga0268264_100329184 204
219 3300028573 Ga0265334_10009927 Ga0265334_100099272 204
220 3300028786 Ga0307517_10024782 Ga0307517_100247821 204
221 3300028800 Ga0265338_10027878 Ga0265338_100278783 204
222 3300028800 Ga0265338_10115304 Ga0265338_101153043 204
223 3300028800 Ga0265338_10235249 Ga0265338_102352492 204
224 3300031247 Ga0265340_10034368 Ga0265340_100343682 204
225 3300031247 Ga0265340_10052288 Ga0265340_100522883 204
226 3300031251 Ga0265327_10145970 Ga0265327_101459702 204
227 3300031456 Ga0307513_10007002 Ga0307513_100070027 204
228 3300031595 Ga0265313_10125194 Ga0265313_101251942 204
229 3300031711 Ga0265314_10041692 Ga0265314_100416922 204
230 3300031711 Ga0265314_10104319 Ga0265314_101043192 204
231 3300031731 Ga0307405_10181420 Ga0307405_101814202 204
232 3300031901 Ga0307406_10231536 Ga0307406_102315362 204
233 3300031911 Ga0307412_10547050 Ga0307412_105470502 204
234 3300035089 Ga0373944_0043418 Ga0373944_0043418_735_1349 204
235 3300035113 Ga0373936_0029084 Ga0373936_0029084_931_1545 204
236 3300035113 Ga0373936_0236540 Ga0373936_0236540_27_641 204
237 3300035116 Ga0373945_0181452 Ga0373945_0181452_161_775 204
238 3300035171 Ga0373946_0006963 Ga0373946_0006963_2354_2968 204
239 3300035695 Ga0373927_0000257 Ga0373927_0000257_29076_29690 204
240 3300036401 Ga0373937_0334279 Ga0373937_0334279_534_1148 204
241 3300037068 Ga0373925_0000083 Ga0373925_0000083_37640_38254 204
242 3300037068 Ga0373925_0344033 Ga0373925_0344033_215_829 204
243 3300037418 Ga0395900_0011388 Ga0395900_0011388_7644_8258 204
244 3300037418 Ga0395900_0392346 Ga0395900_0392346_506_1132 204
245 3300037466 Ga0395898_0063909 Ga0395898_0063909_204_818 204
246 3300038443 Ga0395901_0022971 Ga0395901_0022971_3902_4516 204
247 3300039437 Ga0436365_0572622 Ga0436365_0572622_28_642 204
248 3300039438 Ga0436360_0602113 Ga0436360_0602113_997_1611 204
249 3300039438 Ga0436360_1042683 Ga0436360_1042683_595_1209 204
250 3300039447 Ga0436361_0208418 Ga0436361_0208418_8252_8866 204
251 3300039453 Ga0436362_0821359 Ga0436362_0821359_32_646 204
252 3300044693 Ga0466961_0355811 Ga0466961_0355811_189_803 204
253 3300046472 Ga0495580_0143254 Ga0495580_0143254_19_651 204
254 3300046492 Ga0495585_0051553 Ga0495585_0051553_941_1555 204
255 3300046511 Ga0495608_0548677 Ga0495608_0548677_68_682 204
256 3300046616 Ga0495668_0050500 Ga0495668_0050500_1230_1844 204
257 3300046660 Ga0495625_0014722 Ga0495625_0014722_1236_1850 204
258 3300046660 Ga0495625_0125929 Ga0495625_0125929_616_1230 204
259 3300046684 Ga0495669_0000081 Ga0495669_0000081_18812_19426 204
260 3300047315 Ga0495581_0120222 Ga0495581_0120222_732_1346 204
261 3300048904 Ga0496101_0455189 Ga0496101_0455189_320_934 204
262 3300048918 Ga0496115_0001829 Ga0496115_0001829_3290_3904 204
263 3300049568 Ga0501031_0166906 Ga0501031_0166906_486_1103 204
264 3300049569 Ga0501032_0172178 Ga0501032_0172178_169_783 204
265 3300049569 Ga0501032_0539470 Ga0501032_0539470_21_638 204
266 3300049570 Ga0501033_0018934 Ga0501033_0018934_4157_4771 204
267 3300049570 Ga0501033_0124259 Ga0501033_0124259_414_1028 204
268 3300049571 Ga0501034_0105974 Ga0501034_0105974_1057_1749 204
269 3300049573 Ga0501037_0324063 Ga0501037_0324063_245_859 204
270 3300049574 Ga0501038_0021087 Ga0501038_0021087_884_1498 204
271 3300049575 Ga0501039_0786093 Ga0501039_0786093_76_690 204
272 3300049579 Ga0501043_0028724 Ga0501043_0028724_583_1197 204
273 3300049581 Ga0501047_0123235 Ga0501047_0123235_852_1466 204
274 3300049586 Ga0501070_0446768 Ga0501070_0446768_37_651 204
275 3300049590 Ga0501074_0223032 Ga0501074_0223032_35_649 204
276 3300049686 Ga0501257_005091 Ga0501257_005091_482_1096 204
277 3300049742 Ga0501080_0007769 Ga0501080_0007769_967_1593 204
278 3300049742 Ga0501080_0057552 Ga0501080_0057552_1613_2227 204
279 3300049822 Ga0501035_0054979 Ga0501035_0054979_1159_1773 204
280 3300049822 Ga0501035_0239735 Ga0501035_0239735_135_749 204
281 3300049823 Ga0501044_0020080 Ga0501044_0020080_5517_6131 204
282 3300049823 Ga0501044_0135373 Ga0501044_0135373_1289_1903 204
283 3300049823 Ga0501044_0140081 Ga0501044_0140081_456_1073 204
284 3300050511 nmdc:mga08y16_20570_c1 nmdc:mga08y16_20570_c1_4431_5045 204
285 3300053078 Ga0495612_0220419 Ga0495612_0220419_88_702 204
286 3300053087 Ga0500643_003965 Ga0500643_003965_3202_3816 204
287 3300053087 Ga0500643_016405 Ga0500643_016405_19_711 204
288 3300053096 Ga0500641_0001454 Ga0500641_0001454_4561_5175 204
289 3300053103 Ga0500555_000733 Ga0500555_000733_4951_5565 204
290 3300053104 Ga0500556_0002463 Ga0500556_0002463_1192_1806 204
291 3300053104 Ga0500556_0119479 Ga0500556_0119479_259_873 204
292 3300053108 Ga0500562_000626 Ga0500562_000626_4685_5299 204
293 3300053108 Ga0500562_001894 Ga0500562_001894_2033_2647 204
294 3300053119 Ga0500595_017283 Ga0500595_017283_622_1239 204
295 3300053151 Ga0500604_0024725 Ga0500604_0024725_185_799 204
296 3300053153 Ga0500616_0075604 Ga0500616_0075604_152_766 204
297 3300053156 Ga0500622_0105743 Ga0500622_0105743_132_746 204
298 3300053730 Ga0500645_002623 Ga0500645_002623_3484_4098 204
299 3300053730 Ga0500645_009128 Ga0500645_009128_2552_3166 204
300 3300060353 Ga0501082_0381610 Ga0501082_0381610_544_1170 204
301 3300003794 Ga0055531_10003059 Ga0055531_100030597 205
302 3300005262 Ga0065165_1001741 Ga0065165_10017411 205
303 3300005331 Ga0070670_100016807 Ga0070670_1000168073 205
304 3300005347 Ga0070668_100020890 Ga0070668_1000208901 205
305 3300005367 Ga0070667_100074463 Ga0070667_1000744632 205
306 3300005563 Ga0068855_100181277 Ga0068855_1001812772 205
307 3300005564 Ga0070664_100950090 Ga0070664_1009500901 205
308 3300005614 Ga0068856_100121239 Ga0068856_1001212393 205
309 3300005843 Ga0068860_100015850 Ga0068860_1000158502 205
310 3300005844 Ga0068862_100025053 Ga0068862_1000250534 205
311 3300006048 Ga0075363_100138959 Ga0075363_1001389592 205
312 3300006946 Ga0079104_1020581 Ga0079104_10205812 205
313 3300009093 Ga0105240_10401193 Ga0105240_104011931 205
314 3300009551 Ga0105238_10634816 Ga0105238_106348162 205
315 3300009553 Ga0105249_10144292 Ga0105249_101442922 205
316 3300010375 Ga0105239_10833442 Ga0105239_108334422 205
317 3300014325 Ga0163163_10002482 Ga0163163_1000248223 205
318 3300021384 Ga0213876_10000852 Ga0213876_1000085214 205
319 3300021384 Ga0213876_10008707 Ga0213876_100087074 205
320 3300025272 Ga0209455_1018319 Ga0209455_10183192 205
321 3300025297 Ga0209758_1000404 Ga0209758_100040438 205
322 3300025298 Ga0209050_1001947 Ga0209050_10019478 205
323 3300025304 Ga0209257_1000227 Ga0209257_100022757 205
324 3300025304 Ga0209257_1000507 Ga0209257_100050715 205
325 3300025913 Ga0207695_10299910 Ga0207695_102999103 205
326 3300025914 Ga0207671_10766567 Ga0207671_107665671 205
327 3300025924 Ga0207694_10380846 Ga0207694_103808462 205
328 3300025924 Ga0207694_10433024 Ga0207694_104330242 205
329 3300025925 Ga0207650_10071491 Ga0207650_100714913 205
330 3300025941 Ga0207711_10044816 Ga0207711_100448162 205
331 3300025949 Ga0207667_10541974 Ga0207667_105419742 205
332 3300025972 Ga0207668_10087714 Ga0207668_100877142 205
333 3300025986 Ga0207658_10001987 Ga0207658_1000198723 205
334 3300026075 Ga0207708_10339630 Ga0207708_103396302 205
335 3300026078 Ga0207702_10027809 Ga0207702_100278093 205
336 3300031247 Ga0265340_10032874 Ga0265340_100328743 205
337 3300031616 Ga0307508_10288924 Ga0307508_102889242 205
338 3300031730 Ga0307516_10128358 Ga0307516_101283582 205
339 3300035692 Ga0373935_0030494 Ga0373935_0030494_2656_3273 205
340 3300037312 Ga0395899_0212460 Ga0395899_0212460_466_1083 205
341 3300037466 Ga0395898_0311361 Ga0395898_0311361_416_1033 205
342 3300037471 Ga0395905_0042139 Ga0395905_0042139_300_917 205
343 3300039437 Ga0436365_0981941 Ga0436365_0981941_38479_39096 205
344 3300039437 Ga0436365_1912376 Ga0436365_1912376_199_816 205
345 3300041486 Ga0451807_1489295 Ga0451807_1489295_210_845 205
346 3300046471 Ga0495650_0108502 Ga0495650_0108502_59_679 205
347 3300049581 Ga0501047_0008914 Ga0501047_0008914_4896_5513 205
348 3300050490 nmdc:mga03n38_108541_c1 nmdc:mga03n38_108541_c1_110_730 205
349 3300053087 Ga0500643_015284 Ga0500643_015284_828_1445 205
350 3300053104 Ga0500556_0005726 Ga0500556_0005726_2130_2747 205
351 3300053119 Ga0500595_014391 Ga0500595_014391_1055_1672 205
352 3300053130 Ga0500642_0004345 Ga0500642_0004345_3262_3879 205
353 3300053136 Ga0500559_0114536 Ga0500559_0114536_381_1001 205
354 3300003320 rootH2_10155068 rootH2_101550682 206
355 3300003322 rootL2_10109014 rootL2_101090143 206
356 3300003773 Ga0055537_1001348 Ga0055537_10013484 206
357 3300003775 Ga0055524_1010773 Ga0055524_10107733 206
358 3300003790 Ga0055528_1019254 Ga0055528_10192542 206
359 3300004625 Ga0055543_1007224 Ga0055543_10072242 206
360 3300005262 Ga0065165_1000345 Ga0065165_100034567 206
361 3300005436 Ga0070713_100591231 Ga0070713_1005912311 206
362 3300005456 Ga0070678_101115948 Ga0070678_1011159481 206
363 3300005577 Ga0068857_100344644 Ga0068857_1003446442 206
364 3300005841 Ga0068863_101004955 Ga0068863_1010049551 206
365 3300009177 Ga0105248_10000112 Ga0105248_100001123 206
366 3300009177 Ga0105248_10003951 Ga0105248_1000395114 206
367 3300013306 Ga0163162_10317560 Ga0163162_103175602 206
368 3300014969 Ga0157376_10812544 Ga0157376_108125442 206
369 3300025263 Ga0209565_1000192 Ga0209565_100019228 206
370 3300025263 Ga0209565_1000416 Ga0209565_10004166 206
371 3300025273 Ga0209673_1002928 Ga0209673_10029286 206
372 3300025295 Ga0209564_1002796 Ga0209564_100279610 206
373 3300025295 Ga0209564_1016042 Ga0209564_10160423 206
374 3300025299 Ga0209256_1000810 Ga0209256_100081035 206
375 3300025299 Ga0209256_1002332 Ga0209256_10023325 206
376 3300025299 Ga0209256_1002347 Ga0209256_10023476 206
377 3300025912 Ga0207707_10320004 Ga0207707_103200042 206
378 3300025938 Ga0207704_10000424 Ga0207704_1000042412 206
379 3300025941 Ga0207711_10000718 Ga0207711_1000071836 206
380 3300025941 Ga0207711_10002456 Ga0207711_100024564 206
381 3300026121 Ga0207683_10322973 Ga0207683_103229732 206
382 3300028786 Ga0307517_10006025 Ga0307517_1000602517 206
383 3300028794 Ga0307515_10284611 Ga0307515_102846112 206
384 3300031247 Ga0265340_10002223 Ga0265340_1000222311 206
385 3300031249 Ga0265339_10083049 Ga0265339_100830492 206
386 3300031251 Ga0265327_10077899 Ga0265327_100778992 206
387 3300031344 Ga0265316_10003139 Ga0265316_1000313911 206
388 3300031456 Ga0307513_10005316 Ga0307513_1000531613 206
389 3300031456 Ga0307513_10127980 Ga0307513_101279801 206
390 3300031595 Ga0265313_10002915 Ga0265313_100029152 206
391 3300031711 Ga0265314_10147099 Ga0265314_101470992 206
392 3300031712 Ga0265342_10014140 Ga0265342_100141403 206
393 3300046453 Ga0495627_000906 Ga0495627_000906_8781_9407 206
394 3300046457 Ga0495590_0005965 Ga0495590_0005965_2400_3026 206
395 3300046460 Ga0495638_0000185 Ga0495638_0000185_61537_62163 206
396 3300046460 Ga0495638_0001344 Ga0495638_0001344_12101_12727 206
397 3300046460 Ga0495638_0018150 Ga0495638_0018150_960_1586 206
398 3300046506 Ga0495583_0000003 Ga0495583_0000003_400822_401448 206
399 3300046507 Ga0495606_0006146 Ga0495606_0006146_752_1378 206
400 3300046512 Ga0495610_0000524 Ga0495610_0000524_32454_33080 206
401 3300046512 Ga0495610_0000985 Ga0495610_0000985_9318_9944 206
402 3300046513 Ga0495616_0284999 Ga0495616_0284999_47_673 206
403 3300046516 Ga0495628_0251797 Ga0495628_0251797_314_937 206
404 3300046524 Ga0495648_0000191 Ga0495648_0000191_37236_37862 206
405 3300046525 Ga0495663_0079782 Ga0495663_0079782_415_1035 206
406 3300046543 Ga0495645_0040922 Ga0495645_0040922_165_788 206
407 3300046558 Ga0495633_0245112 Ga0495633_0245112_128_754 206
408 3300046616 Ga0495668_0002187 Ga0495668_0002187_12574_13200 206
409 3300046660 Ga0495625_0004176 Ga0495625_0004176_12341_12967 206
410 3300046660 Ga0495625_0004648 Ga0495625_0004648_681_1307 206
411 3300046660 Ga0495625_0006767 Ga0495625_0006767_1335_1961 206
412 3300046692 Ga0495671_0040168 Ga0495671_0040168_666_1292 206
413 3300046692 Ga0495671_0099566 Ga0495671_0099566_260_886 206
414 3300046794 Ga0495589_0049791 Ga0495589_0049791_1200_1826 206
415 3300047320 Ga0495672_0004566 Ga0495672_0004566_5126_5752 206
416 3300047469 Ga0495673_0000312 Ga0495673_0000312_37687_38313 206
417 3300047469 Ga0495673_0000433 Ga0495673_0000433_8480_9106 206
418 3300047469 Ga0495673_0002154 Ga0495673_0002154_7291_7917 206
419 3300047472 Ga0495686_0000850 Ga0495686_0000850_2085_2711 206
420 3300048903 Ga0496100_0129660 Ga0496100_0129660_835_1455 206
421 3300048909 Ga0496106_0017948 Ga0496106_0017948_2578_3201 206
422 3300048910 Ga0496107_0000209 Ga0496107_0000209_682_1305 206
423 3300048914 Ga0496111_0647899 Ga0496111_0647899_112_747 206
424 3300048918 Ga0496115_0012114 Ga0496115_0012114_3559_4185 206
425 3300048918 Ga0496115_0015505 Ga0496115_0015505_1135_1755 206
426 3300048920 Ga0496117_0014642 Ga0496117_0014642_1802_2422 206
427 3300048921 Ga0496118_0010767 Ga0496118_0010767_8205_8825 206
428 3300048922 Ga0496119_0226318 Ga0496119_0226318_144_764 206
429 3300048924 Ga0496121_0000334 Ga0496121_0000334_13315_13935 206
430 3300048924 Ga0496121_0004173 Ga0496121_0004173_12377_13000 206
431 3300050492 nmdc:mga0yw44_18104_c1 nmdc:mga0yw44_18104_c1_1073_1699 206
432 3300050493 nmdc:mga0k408_217464_c1 nmdc:mga0k408_217464_c1_340_966 206
433 3300050493 nmdc:mga0k408_464551_c1 nmdc:mga0k408_464551_c1_10_636 206
434 3300050496 nmdc:mga07m45_54998_c1 nmdc:mga07m45_54998_c1_1061_1690 206
435 3300050514 nmdc:mga08x19_59028_c1 nmdc:mga08x19_59028_c1_87_737 206
436 3300053086 Ga0500578_0000015 Ga0500578_0000015_145412_146038 206
437 3300053088 Ga0500644_0000058 Ga0500644_0000058_24164_24790 206
438 3300053088 Ga0500644_0018082 Ga0500644_0018082_795_1421 206
439 3300053108 Ga0500562_001605 Ga0500562_001605_2628_3254 206
440 3300053111 Ga0500572_001580 Ga0500572_001580_2852_3472 206
441 3300053118 Ga0500594_0000249 Ga0500594_0000249_145_771 206
442 3300053121 Ga0500607_016083 Ga0500607_016083_2667_3290 206
443 3300053131 Ga0500652_223450 Ga0500652_223450_26_658 206
444 3300053134 Ga0500658_0000956 Ga0500658_0000956_5552_6178 206
445 3300053138 Ga0500564_000038 Ga0500564_000038_8165_8791 206
446 3300053156 Ga0500622_0003083 Ga0500622_0003083_8448_9074 206
447 3300053730 Ga0500645_003616 Ga0500645_003616_2126_2752 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

35

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.9749 31 202
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.971 32 202
4o1k-assembly1.cif.gz_A crystal structures of two tetrameric beta-carbonic anhydrases from the filamentous ascomycete sordaria macrospora. 0.9706 3 192
3e24-assembly1.cif.gz_A h. influenzae beta-carbonic anhydrase, variant w39f 0.9701 33 202
6d2j-assembly1.cif.gz_A beta carbonic anhydrase in complex with thiocyanate 0.9663 1 198
ID Description Score Start End Superfamily
af_O94255_95_324_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9572 1 192 3.40.1050.10
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9561 32 202 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9429 2 202 3.40.1050.10
4o1jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9398 2 195 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9361 31 205 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A354VAU8-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9877 1 196 GO:0004089
GO:0008270
GO:0015976
AF-A0A368UPG8-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9876 1 196 GO:0004089
GO:0008270
GO:0015976
AF-A0A1G2X526-F1-model_v4 deleted 0.9875 2 183
AF-A0A058Z508-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.987 2 198 GO:0004089
GO:0008270
GO:0015976
AF-A0A507EBU8-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.987 1 199 GO:0004089
GO:0008270
GO:0015976

Feature Viewer

pLDDT pTM Quality
92.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map