F445972

General Info

Members Datasets Scaffolds Average Seq Length
447 323 369 174

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10000008|Ga0265324_1000000820
Length 184
Sequence LNLRWQVMAIRAVLRMGDVHLLQQAEELRVFDTPELHALLADMRDTMHALDGVGLAAPQIGVGLRVVIFEVSSNPRYPDAETVPQTVLINPVLTPLSDTMEEGWEGCLSVPGMRGLVPRYTHLRYQGRDEYGALIDRSVSGFHARVVQHECDHLDGILYPMRIRDMRNFGFNEAMFPGEEVQDE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231022 Pseudomonas sp. GM79 Isolate Nodule
13 2511231023 Pseudomonas sp. GM80 Isolate Nodule
14 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
15 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
16 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
17 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
18 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
19 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
20 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
21 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
22 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
23 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
24 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
25 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
26 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
27 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
28 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
29 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
30 2773857670 Pseudomonas sp. 478 Isolate Unclassified
31 2773857673 Pseudomonas sp. 443 Isolate Unclassified
32 2784132063 Pseudomonas sp. 424 Isolate Unclassified
33 2784132072 Pseudomonas sp. 460 Isolate Unclassified
34 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
35 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
36 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
37 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
38 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
39 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
40 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
41 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
42 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
43 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
44 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
45 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
46 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
47 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
48 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
49 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
50 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
51 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
52 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
53 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
54 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
55 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
56 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
57 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
58 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
59 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
60 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
61 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
62 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
63 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
64 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
65 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
66 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
67 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
68 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
69 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
70 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
71 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
72 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
73 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
74 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
75 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
76 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
187 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
191 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
311 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
312 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
316 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
317 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
318 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
319 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
320 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
321 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
322 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
323 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.55
Metatranscriptomes 0
Isolates 17.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 2.68
Rhizoplane 2.46
Rhizosphere 82.33
Stem 0
Stem Tuber 0
Unclassified 8.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3166003 2162886007 Bacteria 3735
2 Ga0055538_1000002 3300003751 Bacteria 999437
3 Ga0055539_1000002 3300003752 Bacteria 999437
4 Ga0055533_1000004 3300003756 Bacteria 999437
5 Ga0055525_1000002 3300003759 Bacteria 999437
6 Ga0055541_1000002 3300003841 Bacteria 896405
7 Ga0070690_100059431 3300005330 Bacteria 2457
8 Ga0070659_100018995 3300005366 Bacteria 5197
9 Ga0070700_100027129 3300005441 Bacteria 3393
10 Ga0070700_100607382 3300005441 Bacteria 858
11 Ga0070663_100898381 3300005455 Bacteria 765
12 Ga0070662_100554229 3300005457 Bacteria 963
13 Ga0070679_100610147 3300005530 Bacteria 1034
14 Ga0070684_100042163 3300005535 Bacteria 3939
15 Ga0070697_100001705 3300005536 Bacteria 16785
16 Ga0068855_100001741 3300005563 Bacteria 27181
17 Ga0068855_100515589 3300005563 Bacteria 1298
18 Ga0068855_101078592 3300005563 Bacteria 840
19 Ga0070664_100138253 3300005564 Bacteria 2143
20 Ga0068854_100051852 3300005578 Bacteria 2941
21 Ga0070702_100065669 3300005615 Bacteria 2126
22 Ga0070702_100188408 3300005615 Bacteria 1355
23 Ga0068859_100366057 3300005617 Bacteria 1537
24 Ga0068859_100669876 3300005617 Bacteria 1129
25 Ga0068864_100280225 3300005618 Bacteria 1556
26 Ga0068851_10312235 3300005834 Bacteria 906
27 Ga0068863_100484407 3300005841 Bacteria 1217
28 Ga0068858_100044568 3300005842 Bacteria 4111
29 Ga0068858_100262868 3300005842 Bacteria 1641
30 Ga0075366_10002796 3300006195 Bacteria 9022
31 Ga0097621_100021280 3300006237 Bacteria 5013
32 Ga0068871_100002565 3300006358 Bacteria 12407
33 Ga0075430_100250838 3300006846 Bacteria 1466
34 Ga0075433_11029066 3300006852 Bacteria 717
35 Ga0068865_100873176 3300006881 Bacteria 780
36 Ga0097620_100366031 3300006931 Bacteria 1537
37 Ga0097620_100669893 3300006931 Bacteria 1129
38 Ga0105251_10000268 3300009011 Bacteria 52036
39 Ga0105250_10123424 3300009092 Bacteria 1066
40 Ga0105240_10097593 3300009093 Bacteria 3580
41 Ga0105240_10442186 3300009093 Bacteria 1457
42 Ga0111539_10007340 3300009094 Bacteria 14116
43 Ga0111539_10157499 3300009094 Bacteria 2657
44 Ga0111539_10959333 3300009094 Bacteria 994
45 Ga0105245_10130564 3300009098 Bacteria 2356
46 Ga0114129_10064085 3300009147 Bacteria 5129
47 Ga0105243_10017031 3300009148 Bacteria 5495
48 Ga0105243_10113095 3300009148 Bacteria 2276
49 Ga0105241_10170626 3300009174 Bacteria 1797
50 Ga0105242_10049101 3300009176 Bacteria 3433
51 Ga0105248_10194423 3300009177 Bacteria 2286
52 Ga0105237_10014721 3300009545 Bacteria 8167
53 Ga0105238_10000977 3300009551 Bacteria 29236
54 Ga0105238_10265924 3300009551 Bacteria 1695
55 Ga0105246_10566989 3300011119 Bacteria 976
56 Ga0157370_10047742 3300013104 Bacteria 4103
57 Ga0157370_10095123 3300013104 Bacteria 2795
58 Ga0163162_11092377 3300013306 Bacteria 904
59 Ga0157372_10037230 3300013307 Bacteria 5365
60 Ga0163163_10175587 3300014325 Bacteria 2189
61 Ga0182008_10000515 3300014497 Bacteria 29030
62 Ga0182008_10113232 3300014497 Bacteria 1345
63 Ga0157379_11131953 3300014968 Bacteria 751
64 Ga0157376_10011821 3300014969 Bacteria 6454
65 Ga0157376_10375426 3300014969 Bacteria 1368
66 Ga0182006_1000112 3300015261 Bacteria 87378
67 Ga0182006_1011405 3300015261 Bacteria 3912
68 Ga0182006_1032526 3300015261 Bacteria 2096
69 Ga0182007_10000020 3300015262 Bacteria 194053
70 Ga0182005_1000001 3300015265 Bacteria 1014869
71 Ga0182005_1016912 3300015265 Bacteria 2021
72 Ga0209784_100002 3300025224 Bacteria 1753105
73 Ga0209566_100003 3300025225 Bacteria 1753105
74 Ga0209674_100004 3300025226 Bacteria 1753105
75 Ga0209672_103329 3300025228 Bacteria 3371
76 Ga0209563_100006 3300025230 Bacteria 1753105
77 Ga0209437_100053 3300025233 Bacteria 375580
78 Ga0209677_100003 3300025253 Bacteria 1753105
79 Ga0207656_10163713 3300025321 Bacteria 1060
80 Ga0207696_1000044 3300025711 Bacteria 300953
81 Ga0207713_1000013 3300025735 Bacteria 475751
82 Ga0207695_10013645 3300025913 Bacteria 9675
83 Ga0207671_10018653 3300025914 Bacteria 5316
84 Ga0207649_10004863 3300025920 Bacteria 7267
85 Ga0207694_10039691 3300025924 Bacteria 3623
86 Ga0207690_10021194 3300025932 Bacteria 4027
87 Ga0207686_10056326 3300025934 Bacteria 2471
88 Ga0207711_10222160 3300025941 Bacteria 1728
89 Ga0207679_10013087 3300025945 Bacteria 5432
90 Ga0207667_10000036 3300025949 Bacteria 297966
91 Ga0207667_10081172 3300025949 Bacteria 3359
92 Ga0207667_11193722 3300025949 Bacteria 741
93 Ga0207640_10023722 3300025981 Bacteria 3691
94 Ga0207640_10339567 3300025981 Bacteria 1202
95 Ga0207658_10681503 3300025986 Bacteria 928
96 Ga0207703_10006062 3300026035 Bacteria 9668
97 Ga0207703_10112325 3300026035 Bacteria 2327
98 Ga0207641_10408044 3300026088 Bacteria 1306
99 Ga0207676_10175192 3300026095 Bacteria 1873
100 Ga0209981_1005799 3300027378 Bacteria 1647
101 Ga0209968_1013816 3300027526 Bacteria 1269
102 Ga0207428_10009441 3300027907 Bacteria 8740
103 Ga0207428_10017731 3300027907 Bacteria 6107
104 Ga0265318_10019700 3300028577 Bacteria 2733
105 Ga0265336_10000931 3300028666 Bacteria 14816
106 Ga0265338_10098868 3300028800 Bacteria 2386
107 Ga0265324_10000008 3300029957 Bacteria 259947
108 Ga0265324_10000813 3300029957 Bacteria 20352
109 Ga0316182_1089273 3300030745 Bacteria 741
110 Ga0265330_10029320 3300031235 Bacteria 2475
111 Ga0265332_10023432 3300031238 Bacteria 2722
112 Ga0265320_10016343 3300031240 Bacteria 4161
113 Ga0265325_10000154 3300031241 Bacteria 48571
114 Ga0265325_10074594 3300031241 Bacteria 1696
115 Ga0265329_10018599 3300031242 Bacteria 2373
116 Ga0265331_10009344 3300031250 Bacteria 5508
117 Ga0265331_10034042 3300031250 Bacteria 2516
118 Ga0307408_100847225 3300031548 Bacteria 833
119 Ga0265314_10000136 3300031711 Bacteria 109906
120 Ga0265314_10008502 3300031711 Bacteria 8776
121 Ga0265314_10019805 3300031711 Bacteria 5203
122 Ga0265342_10062451 3300031712 Bacteria 2192
123 Ga0307410_10092515 3300031852 Bacteria 2150
124 Ga0307407_10625710 3300031903 Bacteria 804
125 Ga0307409_101191950 3300031995 Bacteria 785
126 Ga0307411_10130526 3300032005 Bacteria 1836
127 Ga0307411_10202140 3300032005 Bacteria 1527
128 Ga0373960_0004285 3300035121 Bacteria 3259
129 Ga0373960_0014564 3300035121 Bacteria 1995
130 Ga0373942_0040261 3300035207 Bacteria 1274
131 Ga0373961_0005880 3300035241 Bacteria 2948
132 Ga0373961_0010109 3300035241 Bacteria 2321
133 Ga0373931_0009704 3300035691 Bacteria 4609
134 Ga0395899_0002047 3300037312 Bacteria 16612
135 Ga0395899_0009612 3300037312 Bacteria 7421
136 Ga0395900_0002186 3300037418 Bacteria 21856
137 Ga0395900_0164245 3300037418 Bacteria 2263
138 Ga0395900_0217505 3300037418 Bacteria 1927
139 Ga0395898_0071146 3300037466 Bacteria 3362
140 Ga0395898_0174523 3300037466 Bacteria 2054
141 Ga0395898_0251006 3300037466 Bacteria 1687
142 Ga0395905_0200968 3300037471 Bacteria 1868
143 Ga0395901_0009268 3300038443 Bacteria 9982
144 Ga0395901_0176429 3300038443 Bacteria 2241
145 Ga0395901_0885606 3300038443 Bacteria 875
146 Ga0436361_0560696 3300039447 Bacteria 5389
147 Ga0439438_170635 3300041405 Bacteria 517
148 Ga0439447_123262 3300041407 Bacteria 594
149 Ga0451807_1641279 3300041486 Bacteria 1162
150 Ga0439448_0238874 3300042005 Bacteria 640
151 Ga0439449_0019421 3300042007 Bacteria 2547
152 Ga0439455_0010147 3300042012 Bacteria 2063
153 Ga0439463_016900 3300042016 Bacteria 1805
154 Ga0450911_048007 3300042115 Bacteria 554
155 Ga0450923_067874 3300042125 Bacteria 787
156 Ga0439446_0005376 3300042156 Bacteria 3290
157 Ga0451577_0000002 3300042876 Bacteria 1731375
158 Ga0451577_0137759 3300042876 Bacteria 2192
159 Ga0451577_0847036 3300042876 Bacteria 825
160 Ga0451577_1210132 3300042876 Bacteria 674
161 Ga0439440_0044109 3300042993 Bacteria 1096
162 Ga0466982_0056404 3300044672 Bacteria 2413
163 Ga0453683_0000003 3300044673 Bacteria 942572
164 Ga0466965_0039961 3300044683 Bacteria 2307
165 Ga0466966_0038405 3300044684 Bacteria 3085
166 Ga0466961_0402081 3300044693 Bacteria 831
167 Ga0466963_0009383 3300044694 Bacteria 5894
168 Ga0466964_0001256 3300044706 Bacteria 8623
169 Ga0466964_0081713 3300044706 Bacteria 1388
170 Ga0453684_0000002 3300044712 Bacteria 1731375
171 Ga0453684_0000029 3300044712 Bacteria 757969
172 Ga0453684_0219390 3300044712 Bacteria 2204
173 Ga0453684_0430014 3300044712 Bacteria 1473
174 Ga0466957_0005465 3300044842 Bacteria 7131
175 Ga0466957_0019951 3300044842 Bacteria 3945
176 Ga0451576_0000004 3300045051 Bacteria 1312238
177 Ga0451576_0000057 3300045051 Bacteria 300798
178 Ga0451576_0001043 3300045051 Bacteria 51028
179 Ga0451576_0089229 3300045051 Bacteria 3206
180 Ga0451576_0225540 3300045051 Bacteria 1956
181 Ga0466958_0283602 3300045836 Bacteria 1062
182 Ga0466967_0001817 3300045976 Bacteria 12817
183 Ga0466967_0237218 3300045976 Bacteria 1738
184 Ga0495590_0000002 3300046457 Bacteria 485720
185 Ga0495590_0001727 3300046457 Bacteria 9288
186 Ga0495629_0990920 3300046459 Bacteria 547
187 Ga0495638_0006961 3300046460 Bacteria 8164
188 Ga0495651_0099989 3300046462 Bacteria 2161
189 Ga0495653_0077617 3300046463 Bacteria 2465
190 Ga0495650_0009555 3300046471 Bacteria 5506
191 Ga0495650_0037977 3300046471 Bacteria 2090
192 Ga0495582_0079824 3300046473 Bacteria 1816
193 Ga0495605_0010710 3300046474 Bacteria 5124
194 Ga0495605_0111151 3300046474 Bacteria 1250
195 Ga0495605_0138725 3300046474 Bacteria 1092
196 Ga0495605_0191671 3300046474 Bacteria 894
197 Ga0495584_0019749 3300046491 Bacteria 3423
198 Ga0495584_0037279 3300046491 Bacteria 2456
199 Ga0495585_0019406 3300046492 Bacteria 3919
200 Ga0495594_0132236 3300046499 Bacteria 1413
201 Ga0495607_0001356 3300046501 Bacteria 21830
202 Ga0495607_0061954 3300046501 Bacteria 2123
203 Ga0495583_0000741 3300046506 Bacteria 41476
204 Ga0495583_0003758 3300046506 Bacteria 11291
205 Ga0495606_0046684 3300046507 Bacteria 2861
206 Ga0495606_0121875 3300046507 Bacteria 1560
207 Ga0495606_0297211 3300046507 Bacteria 876
208 Ga0495608_0054992 3300046511 Bacteria 2630
209 Ga0495610_0002587 3300046512 Bacteria 15005
210 Ga0495610_0023783 3300046512 Bacteria 3322
211 Ga0495610_0051705 3300046512 Bacteria 1998
212 Ga0495610_0150526 3300046512 Bacteria 993
213 Ga0495616_0010712 3300046513 Bacteria 5292
214 Ga0495616_0130604 3300046513 Bacteria 1151
215 Ga0495616_0206705 3300046513 Bacteria 860
216 Ga0495620_0109596 3300046515 Bacteria 1095
217 Ga0495628_0000929 3300046516 Bacteria 26874
218 Ga0495630_0069090 3300046517 Bacteria 2657
219 Ga0495630_0298801 3300046517 Bacteria 1230
220 Ga0495631_0009695 3300046518 Bacteria 4800
221 Ga0495632_0021509 3300046519 Bacteria 3475
222 Ga0495637_0011956 3300046520 Bacteria 4160
223 Ga0495637_0014428 3300046520 Bacteria 3728
224 Ga0495637_0031134 3300046520 Bacteria 2361
225 Ga0495637_0031328 3300046520 Bacteria 2353
226 Ga0495643_0000643 3300046522 Bacteria 41372
227 Ga0495643_0020951 3300046522 Bacteria 3760
228 Ga0495643_0329049 3300046522 Bacteria 689
229 Ga0495644_0011213 3300046523 Bacteria 3454
230 Ga0495644_0197682 3300046523 Bacteria 775
231 Ga0495648_0002410 3300046524 Bacteria 17336
232 Ga0495648_0045016 3300046524 Bacteria 2749
233 Ga0495666_0036015 3300046526 Bacteria 2410
234 Ga0495642_0004947 3300046528 Bacteria 5138
235 Ga0495642_0050938 3300046528 Bacteria 1703
236 Ga0495642_0383139 3300046528 Bacteria 619
237 Ga0495652_0002952 3300046529 Bacteria 17113
238 Ga0495652_0009247 3300046529 Bacteria 8959
239 Ga0495652_0010677 3300046529 Bacteria 8319
240 Ga0495654_0153228 3300046530 Bacteria 1017
241 Ga0495654_0263226 3300046530 Bacteria 714
242 Ga0495665_0033730 3300046531 Bacteria 2737
243 Ga0495587_0321883 3300046536 Bacteria 863
244 Ga0495609_0280427 3300046538 Bacteria 681
245 Ga0495609_0381628 3300046538 Bacteria 565
246 Ga0495597_0000874 3300046542 Bacteria 23420
247 Ga0495597_0061505 3300046542 Bacteria 1635
248 Ga0495597_0249096 3300046542 Bacteria 698
249 Ga0495645_0008074 3300046543 Bacteria 7334
250 Ga0495645_0261783 3300046543 Bacteria 1145
251 Ga0495633_0376169 3300046558 Bacteria 643
252 Ga0495634_0022173 3300046642 Bacteria 4476
253 Ga0495611_0113926 3300046648 Bacteria 1259
254 Ga0495625_0595339 3300046660 Bacteria 664
255 Ga0495661_0020196 3300046665 Bacteria 4353
256 Ga0495623_0006164 3300046679 Bacteria 7796
257 Ga0495623_0008650 3300046679 Bacteria 6610
258 Ga0495646_0012297 3300046680 Bacteria 5443
259 Ga0495646_0103756 3300046680 Bacteria 1627
260 Ga0495669_0159024 3300046684 Bacteria 1072
261 Ga0495671_0038443 3300046692 Bacteria 2419
262 Ga0495589_0006804 3300046794 Bacteria 6019
263 Ga0495600_0124297 3300046809 Bacteria 1678
264 Ga0495660_0035872 3300046810 Bacteria 2768
265 Ga0495660_0064123 3300046810 Bacteria 1964
266 Ga0495660_0068743 3300046810 Bacteria 1884
267 Ga0495581_0089081 3300047315 Bacteria 1789
268 Ga0495581_0255855 3300047315 Bacteria 1024
269 Ga0495604_0045818 3300047317 Bacteria 3411
270 Ga0495672_0000021 3300047320 Bacteria 422795
271 Ga0495672_0045238 3300047320 Bacteria 2635
272 Ga0495675_0041172 3300047444 Bacteria 2944
273 Ga0495675_0063595 3300047444 Bacteria 2334
274 Ga0495685_015504 3300047447 Bacteria 2599
275 Ga0495681_0009303 3300047470 Bacteria 6068
276 Ga0495686_0003022 3300047472 Bacteria 14935
277 Ga0495602_0008077 3300048088 Bacteria 10998
278 Ga0495602_0193909 3300048088 Bacteria 1555
279 Ga0495614_0166595 3300048089 Bacteria 987
280 Ga0495626_0030461 3300048091 Bacteria 2602
281 Ga0496100_0259860 3300048903 Bacteria 1287
282 Ga0496104_0476810 3300048907 Bacteria 1159
283 Ga0496110_1031042 3300048913 Bacteria 730
284 Ga0496111_0012430 3300048914 Bacteria 5764
285 Ga0496114_0194807 3300048917 Bacteria 1774
286 Ga0496116_0026598 3300048919 Bacteria 4227
287 Ga0496116_0104553 3300048919 Bacteria 1682
288 Ga0496117_0000094 3300048920 Bacteria 201853
289 Ga0496118_0000071 3300048921 Bacteria 201853
290 Ga0496121_0089329 3300048924 Bacteria 2413
291 Ga0496122_0009932 3300048925 Bacteria 9915
292 Ga0496123_0002403 3300048926 Bacteria 23383
293 Ga0496124_0111979 3300048927 Bacteria 2195
294 Ga0496124_0246949 3300048927 Bacteria 1323
295 Ga0496125_0038118 3300048928 Bacteria 4166
296 Ga0495678_008263 3300049459 Bacteria 5274
297 Ga0495678_119330 3300049459 Bacteria 888
298 Ga0495682_0075523 3300049460 Bacteria 1212
299 Ga0501033_0001193 3300049570 Bacteria 23470
300 Ga0501036_0000543 3300049572 Bacteria 27032
301 Ga0501037_0037385 3300049573 Bacteria 3579
302 Ga0501037_0175925 3300049573 Bacteria 1520
303 Ga0501038_0000909 3300049574 Bacteria 26221
304 Ga0501038_0215763 3300049574 Bacteria 1533
305 Ga0501039_0000990 3300049575 Bacteria 20671
306 Ga0501039_0089002 3300049575 Bacteria 2405
307 Ga0501039_0555830 3300049575 Bacteria 900
308 Ga0501040_0001274 3300049576 Bacteria 16022
309 Ga0501041_0000405 3300049577 Bacteria 21753
310 Ga0501041_0103851 3300049577 Bacteria 1760
311 Ga0501042_0002353 3300049578 Bacteria 11598
312 Ga0501043_0008861 3300049579 Bacteria 7917
313 Ga0501046_0053624 3300049580 Bacteria 3175
314 Ga0501047_0152621 3300049581 Bacteria 2185
315 Ga0501047_0493765 3300049581 Bacteria 1051
316 Ga0501047_0972274 3300049581 Bacteria 662
317 Ga0501048_0000804 3300049582 Bacteria 23031
318 Ga0501068_0002016 3300049584 Bacteria 10806
319 Ga0501068_0398122 3300049584 Bacteria 888
320 Ga0501070_0058246 3300049586 Bacteria 3202
321 Ga0501070_0813577 3300049586 Bacteria 733
322 Ga0501071_0028877 3300049587 Bacteria 3910
323 Ga0501071_0353424 3300049587 Bacteria 1119
324 Ga0501072_0000322 3300049588 Bacteria 34133
325 Ga0501073_0166663 3300049589 Bacteria 1525
326 Ga0501074_0008612 3300049590 Bacteria 7387
327 Ga0501075_0003775 3300049591 Bacteria 10180
328 Ga0501075_0141108 3300049591 Bacteria 1836
329 Ga0501076_0000092 3300049592 Bacteria 47957
330 Ga0501076_0199368 3300049592 Bacteria 1634
331 Ga0501076_0263795 3300049592 Bacteria 1410
332 Ga0501077_0000070 3300049593 Bacteria 51447
333 Ga0501247_038810 3300049677 Bacteria 675
334 Ga0501079_0000005 3300049741 Bacteria 85998
335 Ga0501079_0154167 3300049741 Bacteria 1791
336 Ga0501079_1087409 3300049741 Bacteria 630
337 Ga0501080_0163493 3300049742 Bacteria 2055
338 Ga0501080_1048826 3300049742 Bacteria 705
339 Ga0501081_0001888 3300049743 Bacteria 13011
340 Ga0501035_0001495 3300049822 Bacteria 23928
341 Ga0501045_0000596 3300049824 Bacteria 22747
342 Ga0501045_0156042 3300049824 Bacteria 1698
343 nmdc:mga0k408_2939_c1 3300050493 Bacteria 9034
344 nmdc:mga05p37_60826_c1 3300050507 Bacteria 4650
345 nmdc:mga05p37_610618_c1 3300050507 Bacteria 1229
346 nmdc:mga05p37_636338_c1 3300050507 Bacteria 1197
347 nmdc:mga09592_1131067_c1 3300050508 Bacteria 650
348 nmdc:mga09592_371_c1 3300050508 Bacteria 32873
349 nmdc:mga0qj67_121011_c1 3300050509 Bacteria 2117
350 nmdc:mga0qj67_71446_c2 3300050509 Bacteria 1217
351 nmdc:mga06r32_116217_c1 3300050510 Bacteria 2636
352 nmdc:mga06r32_66_c1 3300050510 Bacteria 67675
353 nmdc:mga08y16_124413_c1 3300050511 Bacteria 2683
354 nmdc:mga08y16_1425993_c1 3300050511 Bacteria 655
355 nmdc:mga08y16_2926_c1 3300050511 Bacteria 17573
356 nmdc:mga08y16_3200_c1 3300050511 Bacteria 16945
357 nmdc:mga08y16_613066_c1 3300050511 Bacteria 1096
358 nmdc:mga0n895_461513_c1 3300050512 Bacteria 1282
359 nmdc:mga0a205_1356108_c1 3300050515 Bacteria 559
360 nmdc:mga0a205_746245_c1 3300050515 Bacteria 827
361 Ga0500617_065453 3300053124 Bacteria 1602
362 Ga0500573_0059208 3300053140 Bacteria 2195
363 Ga0500588_0021082 3300053146 Bacteria 1755
364 Ga0501084_0001577 3300054114 Bacteria 18055
365 Ga0501084_0194337 3300054114 Bacteria 1712
366 Ga0501082_0000755 3300060353 Bacteria 28412
367 Ga0501082_0294979 3300060353 Bacteria 1412
368 Ga0501082_0518031 3300060353 Bacteria 1042
369 Ga0530510_0000240 3300061734 Bacteria 34436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0191671 Ga0495605_0191671_175_630 138
2 3300048913 Ga0496110_1031042 Ga0496110_1031042_11_460 149
3 3300050511 nmdc:mga08y16_1425993_c1 nmdc:mga08y16_1425993_c1_196_645 149
4 3300046522 Ga0495643_0329049 Ga0495643_0329049_10_462 150
5 3300046558 Ga0495633_0376169 Ga0495633_0376169_17_469 150
6 3300060353 Ga0501082_0294979 Ga0501082_0294979_930_1382 150
7 3300030745 Ga0316182_1089273 Ga0316182_10892731 151
8 3300045051 Ga0451576_0001043 Ga0451576_0001043_33135_33629 151
9 3300045051 Ga0451576_0089229 Ga0451576_0089229_1357_1851 151
10 3300045051 Ga0451576_0225540 Ga0451576_0225540_116_610 151
11 3300041405 Ga0439438_170635 Ga0439438_170635_13_483 156
12 3300041407 Ga0439447_123262 Ga0439447_123262_33_503 156
13 3300042016 Ga0439463_016900 Ga0439463_016900_1321_1791 156
14 3300042125 Ga0450923_067874 Ga0450923_067874_289_759 156
15 3300042156 Ga0439446_0005376 Ga0439446_0005376_32_502 156
16 3300046459 Ga0495629_0990920 Ga0495629_0990920_62_532 156
17 3300046512 Ga0495610_0051705 Ga0495610_0051705_1052_1558 156
18 3300046513 Ga0495616_0206705 Ga0495616_0206705_10_480 156
19 3300046520 Ga0495637_0031134 Ga0495637_0031134_17_487 156
20 3300046530 Ga0495654_0153228 Ga0495654_0153228_14_484 156
21 3300046530 Ga0495654_0263226 Ga0495654_0263226_33_503 156
22 3300046538 Ga0495609_0381628 Ga0495609_0381628_11_481 156
23 3300046542 Ga0495597_0249096 Ga0495597_0249096_33_503 156
24 3300046692 Ga0495671_0038443 Ga0495671_0038443_1910_2380 156
25 3300047315 Ga0495581_0089081 Ga0495581_0089081_15_485 156
26 3300048924 Ga0496121_0089329 Ga0496121_0089329_30_500 156
27 3300050515 nmdc:mga0a205_746245_c1 nmdc:mga0a205_746245_c1_109_642 157
28 3300044706 Ga0466964_0081713 Ga0466964_0081713_902_1378 158
29 3300050508 nmdc:mga09592_1131067_c1 nmdc:mga09592_1131067_c1_149_625 158
30 3300049574 Ga0501038_0215763 Ga0501038_0215763_422_904 160
31 3300049575 Ga0501039_0089002 Ga0501039_0089002_1337_1819 160
32 3300049577 Ga0501041_0103851 Ga0501041_0103851_733_1215 160
33 3300049580 Ga0501046_0053624 Ga0501046_0053624_2179_2661 160
34 3300049584 Ga0501068_0398122 Ga0501068_0398122_265_747 160
35 3300049591 Ga0501075_0141108 Ga0501075_0141108_455_937 160
36 3300049592 Ga0501076_0263795 Ga0501076_0263795_577_1059 160
37 3300049741 Ga0501079_0154167 Ga0501079_0154167_788_1270 160
38 3300049742 Ga0501080_0163493 Ga0501080_0163493_279_761 160
39 3300049824 Ga0501045_0156042 Ga0501045_0156042_202_684 160
40 3300054114 Ga0501084_0194337 Ga0501084_0194337_315_797 160
41 3300060353 Ga0501082_0518031 Ga0501082_0518031_172_654 160
42 3300038443 Ga0395901_0885606 Ga0395901_0885606_15_503 162
43 3300042005 Ga0439448_0238874 Ga0439448_0238874_20_508 162
44 3300042876 Ga0451577_0847036 Ga0451577_0847036_63_590 163
45 3300045051 Ga0451576_0000057 Ga0451576_0000057_276769_277296 163
46 3300014969 Ga0157376_10375426 Ga0157376_103754261 164
47 3300050507 nmdc:mga05p37_610618_c1 nmdc:mga05p37_610618_c1_705_1211 164
48 3300005441 Ga0070700_100607382 Ga0070700_1006073822 165
49 3300005530 Ga0070679_100610147 Ga0070679_1006101472 165
50 3300005618 Ga0068864_100280225 Ga0068864_1002802252 165
51 3300005841 Ga0068863_100484407 Ga0068863_1004844071 165
52 3300006846 Ga0075430_100250838 Ga0075430_1002508381 165
53 3300009094 Ga0111539_10007340 Ga0111539_100073408 165
54 3300009098 Ga0105245_10130564 Ga0105245_101305644 165
55 3300009147 Ga0114129_10064085 Ga0114129_100640851 165
56 3300013104 Ga0157370_10047742 Ga0157370_100477422 165
57 3300013306 Ga0163162_11092377 Ga0163162_110923771 165
58 3300013307 Ga0157372_10037230 Ga0157372_100372302 165
59 3300014497 Ga0182008_10113232 Ga0182008_101132321 165
60 3300025986 Ga0207658_10681503 Ga0207658_106815031 165
61 3300026088 Ga0207641_10408044 Ga0207641_104080442 165
62 3300027907 Ga0207428_10009441 Ga0207428_100094411 165
63 3300028577 Ga0265318_10019700 Ga0265318_100197002 165
64 3300028666 Ga0265336_10000931 Ga0265336_100009319 165
65 3300028800 Ga0265338_10098868 Ga0265338_100988681 165
66 3300029957 Ga0265324_10000008 Ga0265324_1000000820 165
67 3300029957 Ga0265324_10000813 Ga0265324_100008135 165
68 3300031235 Ga0265330_10029320 Ga0265330_100293203 165
69 3300031238 Ga0265332_10023432 Ga0265332_100234324 165
70 3300031240 Ga0265320_10016343 Ga0265320_100163433 165
71 3300031241 Ga0265325_10000154 Ga0265325_1000015439 165
72 3300031241 Ga0265325_10074594 Ga0265325_100745942 165
73 3300031242 Ga0265329_10018599 Ga0265329_100185992 165
74 3300031250 Ga0265331_10009344 Ga0265331_100093444 165
75 3300031250 Ga0265331_10034042 Ga0265331_100340422 165
76 3300031711 Ga0265314_10000136 Ga0265314_1000013687 165
77 3300031711 Ga0265314_10008502 Ga0265314_100085023 165
78 3300031711 Ga0265314_10019805 Ga0265314_100198052 165
79 3300031712 Ga0265342_10062451 Ga0265342_100624512 165
80 3300035121 Ga0373960_0004285 Ga0373960_0004285_515_1048 165
81 3300035241 Ga0373961_0010109 Ga0373961_0010109_1280_1813 165
82 3300042876 Ga0451577_0000002 Ga0451577_0000002_491722_492231 165
83 3300042876 Ga0451577_0137759 Ga0451577_0137759_303_812 165
84 3300042876 Ga0451577_1210132 Ga0451577_1210132_19_528 165
85 3300042993 Ga0439440_0044109 Ga0439440_0044109_251_781 165
86 3300044673 Ga0453683_0000003 Ga0453683_0000003_491722_492231 165
87 3300044712 Ga0453684_0000002 Ga0453684_0000002_1239145_1239654 165
88 3300044712 Ga0453684_0000029 Ga0453684_0000029_722677_723186 165
89 3300044712 Ga0453684_0219390 Ga0453684_0219390_1230_1739 165
90 3300044712 Ga0453684_0430014 Ga0453684_0430014_118_627 165
91 3300045051 Ga0451576_0000004 Ga0451576_0000004_865785_866294 165
92 3300046528 Ga0495642_0050938 Ga0495642_0050938_801_1310 165
93 3300049575 Ga0501039_0555830 Ga0501039_0555830_154_663 165
94 3300049581 Ga0501047_0972274 Ga0501047_0972274_38_574 165
95 3300049587 Ga0501071_0353424 Ga0501071_0353424_463_972 165
96 3300049592 Ga0501076_0199368 Ga0501076_0199368_682_1191 165
97 3300049677 Ga0501247_038810 Ga0501247_038810_48_578 165
98 3300050507 nmdc:mga05p37_60826_c1 nmdc:mga05p37_60826_c1_1237_1746 165
99 3300050507 nmdc:mga05p37_636338_c1 nmdc:mga05p37_636338_c1_192_722 165
100 3300050508 nmdc:mga09592_371_c1 nmdc:mga09592_371_c1_11611_12120 165
101 3300050509 nmdc:mga0qj67_121011_c1 nmdc:mga0qj67_121011_c1_262_792 165
102 3300050509 nmdc:mga0qj67_71446_c2 nmdc:mga0qj67_71446_c2_642_1151 165
103 3300050510 nmdc:mga06r32_66_c1 nmdc:mga06r32_66_c1_4348_4857 165
104 3300050511 nmdc:mga08y16_2926_c1 nmdc:mga08y16_2926_c1_12726_13235 165
105 3300050511 nmdc:mga08y16_3200_c1 nmdc:mga08y16_3200_c1_12500_13030 165
106 3300050512 nmdc:mga0n895_461513_c1 nmdc:mga0n895_461513_c1_688_1197 165
107 3300050515 nmdc:mga0a205_1356108_c1 nmdc:mga0a205_1356108_c1_24_533 165
108 3300053124 Ga0500617_065453 Ga0500617_065453_802_1311 165
109 3300053146 Ga0500588_0021082 Ga0500588_0021082_1232_1741 165
110 2162886007 SwRhRL2b_contig_3166003 SwRhRL2b_0042.00002940 166
111 3300003751 Ga0055538_1000002 Ga0055538_1000002526 166
112 3300003752 Ga0055539_1000002 Ga0055539_1000002526 166
113 3300003756 Ga0055533_1000004 Ga0055533_1000004526 166
114 3300003759 Ga0055525_1000002 Ga0055525_1000002526 166
115 3300003841 Ga0055541_1000002 Ga0055541_1000002317 166
116 3300005330 Ga0070690_100059431 Ga0070690_1000594312 166
117 3300005366 Ga0070659_100018995 Ga0070659_1000189952 166
118 3300005441 Ga0070700_100027129 Ga0070700_1000271293 166
119 3300005455 Ga0070663_100898381 Ga0070663_1008983811 166
120 3300005457 Ga0070662_100554229 Ga0070662_1005542292 166
121 3300005535 Ga0070684_100042163 Ga0070684_1000421633 166
122 3300005536 Ga0070697_100001705 Ga0070697_1000017059 166
123 3300005563 Ga0068855_100001741 Ga0068855_1000017419 166
124 3300005563 Ga0068855_100515589 Ga0068855_1005155892 166
125 3300005563 Ga0068855_101078592 Ga0068855_1010785922 166
126 3300005564 Ga0070664_100138253 Ga0070664_1001382532 166
127 3300005578 Ga0068854_100051852 Ga0068854_1000518523 166
128 3300005615 Ga0070702_100065669 Ga0070702_1000656693 166
129 3300005615 Ga0070702_100188408 Ga0070702_1001884081 166
130 3300005617 Ga0068859_100366057 Ga0068859_1003660572 166
131 3300005617 Ga0068859_100669876 Ga0068859_1006698762 166
132 3300005834 Ga0068851_10312235 Ga0068851_103122351 166
133 3300005842 Ga0068858_100044568 Ga0068858_1000445684 166
134 3300005842 Ga0068858_100262868 Ga0068858_1002628682 166
135 3300006195 Ga0075366_10002796 Ga0075366_100027963 166
136 3300006237 Ga0097621_100021280 Ga0097621_1000212803 166
137 3300006358 Ga0068871_100002565 Ga0068871_1000025656 166
138 3300006852 Ga0075433_11029066 Ga0075433_110290661 166
139 3300006881 Ga0068865_100873176 Ga0068865_1008731762 166
140 3300006931 Ga0097620_100366031 Ga0097620_1003660313 166
141 3300006931 Ga0097620_100669893 Ga0097620_1006698932 166
142 3300009011 Ga0105251_10000268 Ga0105251_1000026813 166
143 3300009092 Ga0105250_10123424 Ga0105250_101234241 166
144 3300009093 Ga0105240_10097593 Ga0105240_100975932 166
145 3300009093 Ga0105240_10442186 Ga0105240_104421862 166
146 3300009094 Ga0111539_10157499 Ga0111539_101574992 166
147 3300009094 Ga0111539_10959333 Ga0111539_109593332 166
148 3300009148 Ga0105243_10017031 Ga0105243_100170313 166
149 3300009148 Ga0105243_10113095 Ga0105243_101130952 166
150 3300009174 Ga0105241_10170626 Ga0105241_101706262 166
151 3300009176 Ga0105242_10049101 Ga0105242_100491012 166
152 3300009177 Ga0105248_10194423 Ga0105248_101944232 166
153 3300009545 Ga0105237_10014721 Ga0105237_100147212 166
154 3300009551 Ga0105238_10000977 Ga0105238_1000097722 166
155 3300009551 Ga0105238_10265924 Ga0105238_102659242 166
156 3300011119 Ga0105246_10566989 Ga0105246_105669892 166
157 3300013104 Ga0157370_10095123 Ga0157370_100951234 166
158 3300014325 Ga0163163_10175587 Ga0163163_101755872 166
159 3300014497 Ga0182008_10000515 Ga0182008_1000051521 166
160 3300014968 Ga0157379_11131953 Ga0157379_111319532 166
161 3300014969 Ga0157376_10011821 Ga0157376_100118215 166
162 3300015261 Ga0182006_1000112 Ga0182006_100011248 166
163 3300015261 Ga0182006_1011405 Ga0182006_10114053 166
164 3300015261 Ga0182006_1032526 Ga0182006_10325263 166
165 3300015262 Ga0182007_10000020 Ga0182007_1000002058 166
166 3300015265 Ga0182005_1000001 Ga0182005_100000159 166
167 3300015265 Ga0182005_1016912 Ga0182005_10169123 166
168 3300025224 Ga0209784_100002 Ga0209784_100002753 166
169 3300025225 Ga0209566_100003 Ga0209566_100003753 166
170 3300025226 Ga0209674_100004 Ga0209674_100004753 166
171 3300025228 Ga0209672_103329 Ga0209672_1033293 166
172 3300025230 Ga0209563_100006 Ga0209563_100006753 166
173 3300025233 Ga0209437_100053 Ga0209437_100053290 166
174 3300025253 Ga0209677_100003 Ga0209677_100003753 166
175 3300025321 Ga0207656_10163713 Ga0207656_101637131 166
176 3300025711 Ga0207696_1000044 Ga0207696_1000044198 166
177 3300025735 Ga0207713_1000013 Ga0207713_100001372 166
178 3300025913 Ga0207695_10013645 Ga0207695_100136453 166
179 3300025914 Ga0207671_10018653 Ga0207671_100186532 166
180 3300025920 Ga0207649_10004863 Ga0207649_100048637 166
181 3300025924 Ga0207694_10039691 Ga0207694_100396912 166
182 3300025932 Ga0207690_10021194 Ga0207690_100211943 166
183 3300025934 Ga0207686_10056326 Ga0207686_100563263 166
184 3300025941 Ga0207711_10222160 Ga0207711_102221603 166
185 3300025945 Ga0207679_10013087 Ga0207679_100130874 166
186 3300025949 Ga0207667_10000036 Ga0207667_1000003640 166
187 3300025949 Ga0207667_10081172 Ga0207667_100811723 166
188 3300025949 Ga0207667_11193722 Ga0207667_111937222 166
189 3300025981 Ga0207640_10023722 Ga0207640_100237223 166
190 3300025981 Ga0207640_10339567 Ga0207640_103395672 166
191 3300026035 Ga0207703_10006062 Ga0207703_100060624 166
192 3300026035 Ga0207703_10112325 Ga0207703_101123252 166
193 3300026095 Ga0207676_10175192 Ga0207676_101751921 166
194 3300027378 Ga0209981_1005799 Ga0209981_10057992 166
195 3300027526 Ga0209968_1013816 Ga0209968_10138162 166
196 3300027907 Ga0207428_10017731 Ga0207428_100177314 166
197 3300031548 Ga0307408_100847225 Ga0307408_1008472252 166
198 3300031852 Ga0307410_10092515 Ga0307410_100925151 166
199 3300031903 Ga0307407_10625710 Ga0307407_106257101 166
200 3300031995 Ga0307409_101191950 Ga0307409_1011919502 166
201 3300032005 Ga0307411_10130526 Ga0307411_101305262 166
202 3300032005 Ga0307411_10202140 Ga0307411_102021402 166
203 3300035121 Ga0373960_0014564 Ga0373960_0014564_108_641 166
204 3300035207 Ga0373942_0040261 Ga0373942_0040261_18_551 166
205 3300035241 Ga0373961_0005880 Ga0373961_0005880_520_1053 166
206 3300035691 Ga0373931_0009704 Ga0373931_0009704_418_951 166
207 3300037312 Ga0395899_0002047 Ga0395899_0002047_11647_12183 166
208 3300037312 Ga0395899_0009612 Ga0395899_0009612_1065_1601 166
209 3300037418 Ga0395900_0002186 Ga0395900_0002186_4599_5135 166
210 3300037418 Ga0395900_0164245 Ga0395900_0164245_672_1208 166
211 3300037418 Ga0395900_0217505 Ga0395900_0217505_152_688 166
212 3300037466 Ga0395898_0071146 Ga0395898_0071146_814_1350 166
213 3300037466 Ga0395898_0174523 Ga0395898_0174523_1256_1792 166
214 3300037466 Ga0395898_0251006 Ga0395898_0251006_410_946 166
215 3300037471 Ga0395905_0200968 Ga0395905_0200968_1294_1830 166
216 3300038443 Ga0395901_0009268 Ga0395901_0009268_4599_5135 166
217 3300038443 Ga0395901_0176429 Ga0395901_0176429_847_1383 166
218 3300039447 Ga0436361_0560696 Ga0436361_0560696_1005_1541 166
219 3300041486 Ga0451807_1641279 Ga0451807_1641279_242_775 166
220 3300042007 Ga0439449_0019421 Ga0439449_0019421_1423_1959 166
221 3300042012 Ga0439455_0010147 Ga0439455_0010147_1062_1598 166
222 3300042115 Ga0450911_048007 Ga0450911_048007_21_539 166
223 3300044672 Ga0466982_0056404 Ga0466982_0056404_666_1202 166
224 3300044683 Ga0466965_0039961 Ga0466965_0039961_1379_1915 166
225 3300044684 Ga0466966_0038405 Ga0466966_0038405_41_577 166
226 3300044693 Ga0466961_0402081 Ga0466961_0402081_100_636 166
227 3300044694 Ga0466963_0009383 Ga0466963_0009383_1098_1634 166
228 3300044706 Ga0466964_0001256 Ga0466964_0001256_4570_5106 166
229 3300044842 Ga0466957_0005465 Ga0466957_0005465_2019_2555 166
230 3300044842 Ga0466957_0019951 Ga0466957_0019951_2348_2872 166
231 3300045836 Ga0466958_0283602 Ga0466958_0283602_154_690 166
232 3300045976 Ga0466967_0001817 Ga0466967_0001817_812_1348 166
233 3300045976 Ga0466967_0237218 Ga0466967_0237218_571_1107 166
234 3300046457 Ga0495590_0000002 Ga0495590_0000002_57767_58279 166
235 3300046457 Ga0495590_0001727 Ga0495590_0001727_1152_1688 166
236 3300046460 Ga0495638_0006961 Ga0495638_0006961_2875_3414 166
237 3300046462 Ga0495651_0099989 Ga0495651_0099989_60_596 166
238 3300046463 Ga0495653_0077617 Ga0495653_0077617_1705_2241 166
239 3300046471 Ga0495650_0009555 Ga0495650_0009555_4631_5143 166
240 3300046471 Ga0495650_0037977 Ga0495650_0037977_316_855 166
241 3300046473 Ga0495582_0079824 Ga0495582_0079824_751_1287 166
242 3300046474 Ga0495605_0010710 Ga0495605_0010710_745_1281 166
243 3300046474 Ga0495605_0111151 Ga0495605_0111151_586_1125 166
244 3300046474 Ga0495605_0138725 Ga0495605_0138725_502_1041 166
245 3300046491 Ga0495584_0019749 Ga0495584_0019749_270_809 166
246 3300046491 Ga0495584_0037279 Ga0495584_0037279_1898_2434 166
247 3300046492 Ga0495585_0019406 Ga0495585_0019406_976_1512 166
248 3300046499 Ga0495594_0132236 Ga0495594_0132236_517_1053 166
249 3300046501 Ga0495607_0001356 Ga0495607_0001356_13773_14312 166
250 3300046501 Ga0495607_0061954 Ga0495607_0061954_306_842 166
251 3300046506 Ga0495583_0000741 Ga0495583_0000741_4948_5460 166
252 3300046506 Ga0495583_0003758 Ga0495583_0003758_10572_11108 166
253 3300046507 Ga0495606_0046684 Ga0495606_0046684_759_1295 166
254 3300046507 Ga0495606_0121875 Ga0495606_0121875_163_699 166
255 3300046507 Ga0495606_0297211 Ga0495606_0297211_199_735 166
256 3300046511 Ga0495608_0054992 Ga0495608_0054992_1036_1572 166
257 3300046512 Ga0495610_0002587 Ga0495610_0002587_12037_12576 166
258 3300046512 Ga0495610_0023783 Ga0495610_0023783_505_1044 166
259 3300046512 Ga0495610_0150526 Ga0495610_0150526_23_559 166
260 3300046513 Ga0495616_0010712 Ga0495616_0010712_1380_1916 166
261 3300046513 Ga0495616_0130604 Ga0495616_0130604_344_856 166
262 3300046515 Ga0495620_0109596 Ga0495620_0109596_436_972 166
263 3300046516 Ga0495628_0000929 Ga0495628_0000929_7869_8405 166
264 3300046517 Ga0495630_0069090 Ga0495630_0069090_2120_2638 166
265 3300046517 Ga0495630_0298801 Ga0495630_0298801_231_767 166
266 3300046518 Ga0495631_0009695 Ga0495631_0009695_3472_4008 166
267 3300046519 Ga0495632_0021509 Ga0495632_0021509_2827_3363 166
268 3300046520 Ga0495637_0011956 Ga0495637_0011956_2192_2731 166
269 3300046520 Ga0495637_0014428 Ga0495637_0014428_1706_2245 166
270 3300046520 Ga0495637_0031328 Ga0495637_0031328_1282_1818 166
271 3300046522 Ga0495643_0000643 Ga0495643_0000643_36260_36772 166
272 3300046522 Ga0495643_0020951 Ga0495643_0020951_2603_3139 166
273 3300046523 Ga0495644_0011213 Ga0495644_0011213_2726_3262 166
274 3300046523 Ga0495644_0197682 Ga0495644_0197682_11_529 166
275 3300046524 Ga0495648_0002410 Ga0495648_0002410_6636_7172 166
276 3300046524 Ga0495648_0045016 Ga0495648_0045016_672_1184 166
277 3300046526 Ga0495666_0036015 Ga0495666_0036015_1580_2116 166
278 3300046528 Ga0495642_0004947 Ga0495642_0004947_87_599 166
279 3300046528 Ga0495642_0383139 Ga0495642_0383139_69_605 166
280 3300046529 Ga0495652_0002952 Ga0495652_0002952_11686_12222 166
281 3300046529 Ga0495652_0009247 Ga0495652_0009247_2870_3406 166
282 3300046529 Ga0495652_0010677 Ga0495652_0010677_4696_5232 166
283 3300046531 Ga0495665_0033730 Ga0495665_0033730_1348_1884 166
284 3300046536 Ga0495587_0321883 Ga0495587_0321883_20_556 166
285 3300046538 Ga0495609_0280427 Ga0495609_0280427_67_603 166
286 3300046542 Ga0495597_0000874 Ga0495597_0000874_18387_18899 166
287 3300046542 Ga0495597_0061505 Ga0495597_0061505_396_935 166
288 3300046543 Ga0495645_0008074 Ga0495645_0008074_4953_5489 166
289 3300046543 Ga0495645_0261783 Ga0495645_0261783_53_592 166
290 3300046642 Ga0495634_0022173 Ga0495634_0022173_2430_2966 166
291 3300046648 Ga0495611_0113926 Ga0495611_0113926_645_1181 166
292 3300046660 Ga0495625_0595339 Ga0495625_0595339_113_649 166
293 3300046665 Ga0495661_0020196 Ga0495661_0020196_2725_3261 166
294 3300046679 Ga0495623_0006164 Ga0495623_0006164_1705_2241 166
295 3300046679 Ga0495623_0008650 Ga0495623_0008650_5393_5929 166
296 3300046680 Ga0495646_0012297 Ga0495646_0012297_2051_2587 166
297 3300046680 Ga0495646_0103756 Ga0495646_0103756_561_1097 166
298 3300046684 Ga0495669_0159024 Ga0495669_0159024_149_685 166
299 3300046794 Ga0495589_0006804 Ga0495589_0006804_193_729 166
300 3300046809 Ga0495600_0124297 Ga0495600_0124297_634_1170 166
301 3300046810 Ga0495660_0035872 Ga0495660_0035872_192_728 166
302 3300046810 Ga0495660_0064123 Ga0495660_0064123_414_950 166
303 3300046810 Ga0495660_0068743 Ga0495660_0068743_730_1242 166
304 3300047315 Ga0495581_0255855 Ga0495581_0255855_282_818 166
305 3300047317 Ga0495604_0045818 Ga0495604_0045818_1742_2278 166
306 3300047320 Ga0495672_0000021 Ga0495672_0000021_207730_208266 166
307 3300047320 Ga0495672_0045238 Ga0495672_0045238_1657_2193 166
308 3300047444 Ga0495675_0041172 Ga0495675_0041172_740_1276 166
309 3300047444 Ga0495675_0063595 Ga0495675_0063595_130_666 166
310 3300047447 Ga0495685_015504 Ga0495685_015504_971_1507 166
311 3300047470 Ga0495681_0009303 Ga0495681_0009303_3716_4255 166
312 3300047472 Ga0495686_0003022 Ga0495686_0003022_11938_12477 166
313 3300048088 Ga0495602_0008077 Ga0495602_0008077_2891_3427 166
314 3300048088 Ga0495602_0193909 Ga0495602_0193909_179_715 166
315 3300048089 Ga0495614_0166595 Ga0495614_0166595_132_644 166
316 3300048091 Ga0495626_0030461 Ga0495626_0030461_621_1157 166
317 3300048903 Ga0496100_0259860 Ga0496100_0259860_493_1029 166
318 3300048907 Ga0496104_0476810 Ga0496104_0476810_524_1060 166
319 3300048914 Ga0496111_0012430 Ga0496111_0012430_3557_4093 166
320 3300048917 Ga0496114_0194807 Ga0496114_0194807_769_1305 166
321 3300048919 Ga0496116_0026598 Ga0496116_0026598_3567_4106 166
322 3300048919 Ga0496116_0104553 Ga0496116_0104553_509_1045 166
323 3300048920 Ga0496117_0000094 Ga0496117_0000094_136075_136611 166
324 3300048921 Ga0496118_0000071 Ga0496118_0000071_136075_136611 166
325 3300048925 Ga0496122_0009932 Ga0496122_0009932_1866_2402 166
326 3300048926 Ga0496123_0002403 Ga0496123_0002403_4466_5002 166
327 3300048927 Ga0496124_0111979 Ga0496124_0111979_951_1487 166
328 3300048927 Ga0496124_0246949 Ga0496124_0246949_567_1103 166
329 3300048928 Ga0496125_0038118 Ga0496125_0038118_57_593 166
330 3300049459 Ga0495678_008263 Ga0495678_008263_1317_1829 166
331 3300049459 Ga0495678_119330 Ga0495678_119330_159_695 166
332 3300049460 Ga0495682_0075523 Ga0495682_0075523_206_742 166
333 3300049570 Ga0501033_0001193 Ga0501033_0001193_6710_7243 166
334 3300049572 Ga0501036_0000543 Ga0501036_0000543_19436_19969 166
335 3300049573 Ga0501037_0037385 Ga0501037_0037385_2214_2747 166
336 3300049573 Ga0501037_0175925 Ga0501037_0175925_432_944 166
337 3300049574 Ga0501038_0000909 Ga0501038_0000909_4880_5413 166
338 3300049575 Ga0501039_0000990 Ga0501039_0000990_8210_8743 166
339 3300049576 Ga0501040_0001274 Ga0501040_0001274_6055_6588 166
340 3300049577 Ga0501041_0000405 Ga0501041_0000405_20691_21224 166
341 3300049578 Ga0501042_0002353 Ga0501042_0002353_553_1086 166
342 3300049579 Ga0501043_0008861 Ga0501043_0008861_570_1103 166
343 3300049581 Ga0501047_0152621 Ga0501047_0152621_370_903 166
344 3300049581 Ga0501047_0493765 Ga0501047_0493765_98_634 166
345 3300049582 Ga0501048_0000804 Ga0501048_0000804_12119_12652 166
346 3300049584 Ga0501068_0002016 Ga0501068_0002016_8181_8714 166
347 3300049586 Ga0501070_0058246 Ga0501070_0058246_1623_2156 166
348 3300049586 Ga0501070_0813577 Ga0501070_0813577_121_654 166
349 3300049587 Ga0501071_0028877 Ga0501071_0028877_796_1329 166
350 3300049588 Ga0501072_0000322 Ga0501072_0000322_12810_13343 166
351 3300049589 Ga0501073_0166663 Ga0501073_0166663_79_612 166
352 3300049590 Ga0501074_0008612 Ga0501074_0008612_4236_4769 166
353 3300049591 Ga0501075_0003775 Ga0501075_0003775_4549_5082 166
354 3300049592 Ga0501076_0000092 Ga0501076_0000092_26967_27500 166
355 3300049593 Ga0501077_0000070 Ga0501077_0000070_18301_18834 166
356 3300049741 Ga0501079_0000005 Ga0501079_0000005_42935_43468 166
357 3300049741 Ga0501079_1087409 Ga0501079_1087409_62_580 166
358 3300049742 Ga0501080_1048826 Ga0501080_1048826_77_610 166
359 3300049743 Ga0501081_0001888 Ga0501081_0001888_6315_6848 166
360 3300049822 Ga0501035_0001495 Ga0501035_0001495_547_1080 166
361 3300049824 Ga0501045_0000596 Ga0501045_0000596_21190_21723 166
362 3300050493 nmdc:mga0k408_2939_c1 nmdc:mga0k408_2939_c1_5874_6386 166
363 3300050510 nmdc:mga06r32_116217_c1 nmdc:mga06r32_116217_c1_143_676 166
364 3300050511 nmdc:mga08y16_124413_c1 nmdc:mga08y16_124413_c1_635_1147 166
365 3300050511 nmdc:mga08y16_613066_c1 nmdc:mga08y16_613066_c1_244_777 166
366 3300053140 Ga0500573_0059208 Ga0500573_0059208_532_1071 166
367 3300054114 Ga0501084_0001577 Ga0501084_0001577_2308_2841 166
368 3300060353 Ga0501082_0000755 Ga0501082_0000755_17462_17995 166
369 3300061734 Ga0530510_0000240 Ga0530510_0000240_12718_13251 166
370 iso_pu_bacteria 2511231004 2511256055 166
371 iso_pu_bacteria 2511231007 2511270049 166
372 iso_pu_bacteria 2511231008 2511280986 166
373 iso_pu_bacteria 2511231010 2511287913 166
374 iso_pu_bacteria 2511231011 2511298558 166
375 iso_pu_bacteria 2511231012 2511301622 166
376 iso_pu_bacteria 2511231014 2511315775 166
377 iso_pu_bacteria 2511231015 2511319124 166
378 iso_pu_bacteria 2511231016 2511326225 166
379 iso_pu_bacteria 2511231017 2511333001 166
380 iso_pu_bacteria 2511231022 2511361615 166
381 iso_pu_bacteria 2511231023 2511369502 166
382 iso_pu_bacteria 2521172590 2521558127 166
383 iso_pu_bacteria 2599185188 2599501424 166
384 iso_pu_bacteria 2599185300 2599931724 166
385 iso_pu_bacteria 2600255318 2601796619 166
386 iso_pu_bacteria 2603880185 2606073769 166
387 iso_pu_bacteria 2603880199 2606126586 166
388 iso_pu_bacteria 2623620443 2624482320 166
389 iso_pu_bacteria 2623620446 2624490636 166
390 iso_pu_bacteria 2643221565 2643841331 166
391 iso_pu_bacteria 2643221633 2644186454 166
392 iso_pu_bacteria 2713897148 2715750320 166
393 iso_pu_bacteria 2713897149 2715755291 166
394 iso_pu_bacteria 2718217725 2718635500 166
395 iso_pu_bacteria 2738541271 2738689272 166
396 iso_pu_bacteria 2738543016 2739264660 166
397 iso_pu_bacteria 2738543025 2739313377 166
398 iso_pu_bacteria 2773857670 2774122329 166
399 iso_pu_bacteria 2773857673 2774133203 166
400 iso_pu_bacteria 2784132063 2784262936 166
401 iso_pu_bacteria 2784132072 2784316167 166
402 iso_pu_bacteria 2791355520 2794594658 166
403 iso_pu_bacteria 2808606382 2808958742 166
404 iso_pu_bacteria 2808606418 2809146794 166
405 iso_pu_bacteria 2808606445 2809219462 166
406 iso_pu_bacteria 2818991449 2819614729 166
407 iso_pu_bacteria 2818991456 2819655996 166
408 iso_pu_bacteria 2842832357 2842837176 166
409 iso_pu_bacteria 2842843487 2842844973 166
410 iso_pu_bacteria 2842854478 2842856988 166
411 iso_pu_bacteria 2852657418 2852660938 166
412 iso_pu_bacteria 2860339153 2860341174 166
413 iso_pu_bacteria 2878029506 2878034245 166
414 iso_pu_bacteria 2880230671 2880234873 166
415 iso_pu_bacteria 2885080285 2885084075 166
416 iso_pu_bacteria 2904439833 2904441098 166
417 iso_pu_bacteria 2904518522 2904522275 166
418 iso_pu_bacteria 2904530477 2904531959 166
419 iso_pu_bacteria 2904584206 2904587815 166
420 iso_pu_bacteria 2904589729 2904590025 166
421 iso_pu_bacteria 2904601388 2904602587 166
422 iso_pu_bacteria 2913036834 2913038189 166
423 iso_pu_bacteria 2919046199 2919046591 166
424 iso_pu_bacteria 2919063839 2919066693 166
425 iso_pu_bacteria 2919079590 2919079907 166
426 iso_pu_bacteria 2919385768 2919388322 166
427 iso_pu_bacteria 2919456309 2919459271 166
428 iso_pu_bacteria 2919487758 2919489471 166
429 iso_pu_bacteria 2919697872 2919701832 166
430 iso_pu_bacteria 2923586266 2923590684 166
431 iso_pu_bacteria 2928130867 2928131307 166
432 iso_pu_bacteria 2974289157 2974289604 166
433 iso_pu_bacteria 2998139840 2998144311 166
434 iso_pu_bacteria 3007511990 3007516087 166
435 iso_pu_bacteria 3007614139 3007617746 166
436 iso_pu_bacteria 3007718800 3007721041 166
437 iso_pu_bacteria 3007855910 3007858706 166
438 iso_pu_bacteria 3007861166 3007865766 166
439 iso_pu_bacteria 3007866637 3007871683 166
440 iso_pu_bacteria 8019775933 8019780644 166
441 iso_pu_bacteria 8029995093 8029996570 166
442 iso_pu_bacteria 8056125926 8056130601 166
443 iso_pu_bacteria 8056143049 8056147640 166
444 iso_pu_bacteria 8056155041 8056155292 166
445 iso_pu_bacteria 8056166840 8056166951 166
446 iso_pu_bacteria 8056172158 8056172937 166
447 iso_pu_bacteria 8056177738 8056183212 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

10

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vcp-assembly2.cif.gz_B crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9835 2 158
5vcp-assembly1.cif.gz_C crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9813 2 159
5vcp-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.978 2 158
5cy7-assembly1.cif.gz_A structure of xoo1075, a peptide deformylase from xanthomonas oryze pv oryze, in complex with fragment 275 0.978 2 156
5cx0-assembly1.cif.gz_A-2 structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 0.9759 2 156
ID Description Score Start End Superfamily
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.978 2 158 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9436 2 139 3.90.45.10
1rn5A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.94 2 156 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9356 2 145 3.90.45.10
af_Q9VGY2_49_232_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9354 2 155 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A0S7YYF1-F1-model_v4 Peptide deformylase (Polypeptide deformylase) 0.9966 2 126 GO:0042586
GO:0043686
AF-A0A524K758-F1-model_v4 Peptide deformylase (Polypeptide deformylase) 0.9949 2 147 GO:0042586
GO:0043686
AF-A0A6A5LES4-F1-model_v4 deleted 0.9943 2 140
AF-A0A1G0GP29-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9931 2 157 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A356HEX9-F1-model_v4 deleted 0.991 4 114

Feature Viewer

pLDDT pTM Quality
92.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map