F445964

General Info

Members Datasets Scaffolds Average Seq Length
447 265 894 129

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10010105|Ga0207693_1001010511
Length 123
Sequence VGFGVVRPDELEWTTRPHEPDEPARHVAELSDLAGFAHTRANIWRYEPGAKGRREETFVVLSGTLSMYVGDSAERVDVPAGALIHVEPGTPLQSVNHGDEQLVVYAYGTPPESERAELLGSAV

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
175 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
176 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
177 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 8.05
Rhizosphere 87.92
Stem 0
Stem Tuber 0
Unclassified 21.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10010105 3300025915 Bacteria 7668
2 JGI25407J50210_10009359 3300003373 Bacteria 2482
3 Ga0070658_10142774 3300005327 Bacteria 2001
4 Ga0070658_11333462 3300005327 Bacteria 623
5 Ga0070683_100141478 3300005329 Bacteria 2279
6 Ga0070683_100321845 3300005329 Bacteria 1472
7 Ga0070683_100555373 3300005329 Bacteria 1098
8 Ga0070683_100870942 3300005329 Bacteria 864
9 Ga0070666_10204655 3300005335 Bacteria 1389
10 Ga0070680_100155188 3300005336 Unclassified 1923
11 Ga0070682_100014879 3300005337 Bacteria 4503
12 Ga0070682_100468684 3300005337 Bacteria 969
13 Ga0068868_100278018 3300005338 Unclassified 1416
14 Ga0068868_100432198 3300005338 Unclassified 1142
15 Ga0070660_100143547 3300005339 Bacteria 1917
16 Ga0070660_101538534 3300005339 Unclassified 566
17 Ga0070689_101734542 3300005340 Bacteria 569
18 Ga0070691_10187777 3300005341 Bacteria 1079
19 Ga0070661_100523534 3300005344 Bacteria 951
20 Ga0070668_100068292 3300005347 Bacteria 2763
21 Ga0070688_100049724 3300005365 Bacteria 2610
22 Ga0070659_100119052 3300005366 Bacteria 2137
23 Ga0070709_10575800 3300005434 Archaea 864
24 Ga0070714_100003825 3300005435 Bacteria 11307
25 Ga0070714_101129505 3300005435 Bacteria 764
26 Ga0070713_100204501 3300005436 Unclassified 1785
27 Ga0070713_100809867 3300005436 Bacteria 898
28 Ga0070713_101843414 3300005436 Bacteria 587
29 Ga0070710_10145509 3300005437 Bacteria 1457
30 Ga0070701_10128681 3300005438 Unclassified 1436
31 Ga0070711_100184469 3300005439 Bacteria 1599
32 Ga0070705_100166156 3300005440 Bacteria 1480
33 Ga0070700_100076836 3300005441 Bacteria 2145
34 Ga0070700_100707270 3300005441 Unclassified 802
35 Ga0070694_100368018 3300005444 Bacteria 1118
36 Ga0070708_100416708 3300005445 Bacteria 1267
37 Ga0070663_100265841 3300005455 Bacteria 1362
38 Ga0070678_100125658 3300005456 Bacteria 2030
39 Ga0068867_100147604 3300005459 Bacteria 1845
40 Ga0070685_10691175 3300005466 Bacteria 743
41 Ga0070706_100152512 3300005467 Unclassified 2157
42 Ga0070707_100001145 3300005468 Bacteria 26109
43 Ga0070699_100162659 3300005518 Unclassified 1976
44 Ga0070699_100396656 3300005518 Bacteria 1247
45 Ga0070699_100603649 3300005518 Bacteria 1001
46 Ga0070679_100210465 3300005530 Bacteria 1908
47 Ga0070679_100526639 3300005530 Unclassified 1126
48 Ga0070686_100018657 3300005544 Bacteria 4077
49 Ga0070686_100816474 3300005544 Unclassified 753
50 Ga0070696_100560303 3300005546 Bacteria 917
51 Ga0070693_100263973 3300005547 Unclassified 1146
52 Ga0070704_100157445 3300005549 Bacteria 1793
53 Ga0070704_100746840 3300005549 Bacteria 871
54 Ga0068855_100072581 3300005563 Bacteria 4000
55 Ga0068855_100478489 3300005563 Unclassified 1356
56 Ga0070664_100367518 3300005564 Unclassified 1311
57 Ga0068857_100139768 3300005577 Bacteria 2188
58 Ga0068854_100597275 3300005578 Unclassified 942
59 Ga0068854_101097573 3300005578 Unclassified 709
60 Ga0068856_100828439 3300005614 Unclassified 945
61 Ga0070702_100039631 3300005615 Bacteria 2630
62 Ga0070702_100232878 3300005615 Unclassified 1239
63 Ga0068852_100151880 3300005616 Bacteria 2154
64 Ga0068852_100715873 3300005616 Bacteria 1012
65 Ga0068864_101636854 3300005618 Bacteria 648
66 Ga0068866_10098702 3300005718 Unclassified 1607
67 Ga0068866_10251024 3300005718 Bacteria 1082
68 Ga0068866_10329542 3300005718 Bacteria 963
69 Ga0068861_100013913 3300005719 Bacteria 5640
70 Ga0068851_10073810 3300005834 Bacteria 1770
71 Ga0068851_10668952 3300005834 Bacteria 637
72 Ga0068870_10257007 3300005840 Bacteria 1085
73 Ga0068870_10835480 3300005840 Bacteria 646
74 Ga0068870_10903094 3300005840 Bacteria 624
75 Ga0068858_100144879 3300005842 Bacteria 2231
76 Ga0068860_101378566 3300005843 Unclassified 726
77 Ga0081455_10049149 3300005937 Bacteria 3638
78 Ga0070717_10002526 3300006028 Bacteria 12887
79 Ga0070717_10664630 3300006028 Bacteria 946
80 Ga0070717_11238880 3300006028 Bacteria 679
81 Ga0075432_10002617 3300006058 Bacteria 6011
82 Ga0070712_100673679 3300006175 Bacteria 880
83 Ga0070712_100998756 3300006175 Unclassified 724
84 Ga0070712_101168656 3300006175 Bacteria 669
85 Ga0070712_101562361 3300006175 Bacteria 577
86 Ga0075433_10127258 3300006852 Bacteria 2262
87 Ga0075434_100022851 3300006871 Bacteria 6088
88 Ga0075434_100266489 3300006871 Bacteria 1732
89 Ga0075434_100356512 3300006871 Bacteria 1484
90 Ga0075434_100476079 3300006871 Bacteria 1270
91 Ga0075429_100328197 3300006880 Bacteria 1339
92 Ga0068865_100232490 3300006881 Bacteria 1447
93 Ga0068865_101515829 3300006881 Unclassified 601
94 Ga0075435_100581171 3300007076 Bacteria 971
95 Ga0075435_101017939 3300007076 Unclassified 723
96 Ga0111539_10007873 3300009094 Bacteria 13602
97 Ga0111539_10008062 3300009094 Bacteria 13425
98 Ga0111539_11158276 3300009094 Unclassified 898
99 Ga0111539_12259297 3300009094 Bacteria 631
100 Ga0105245_10043144 3300009098 Bacteria 4023
101 Ga0105245_10382692 3300009098 Unclassified 1401
102 Ga0105245_10617959 3300009098 Bacteria 1111
103 Ga0114129_10342032 3300009147 Bacteria 1984
104 Ga0114129_11571789 3300009147 Bacteria 806
105 Ga0105243_10074270 3300009148 Bacteria 2757
106 Ga0105243_10234950 3300009148 Bacteria 1628
107 Ga0105243_10529837 3300009148 Bacteria 1122
108 Ga0105243_11769408 3300009148 Bacteria 648
109 Ga0105242_10099596 3300009176 Bacteria 2460
110 Ga0105242_10541522 3300009176 Bacteria 1114
111 Ga0105242_10919207 3300009176 Unclassified 876
112 Ga0105242_11694171 3300009176 Bacteria 668
113 Ga0105237_12256100 3300009545 Unclassified 554
114 Ga0105238_10188119 3300009551 Bacteria 2041
115 Ga0105249_10008924 3300009553 Bacteria 8758
116 Ga0105249_10698509 3300009553 Bacteria 1074
117 Ga0105249_11774442 3300009553 Bacteria 690
118 Ga0105030_119291 3300009987 Bacteria 615
119 Ga0099796_10585543 3300010159 Unclassified 502
120 Ga0105239_10095458 3300010375 Bacteria 3285
121 Ga0105239_10179847 3300010375 Bacteria 2366
122 Ga0105239_10675707 3300010375 Bacteria 1180
123 Ga0105246_10880837 3300011119 Unclassified 801
124 Ga0105246_10941672 3300011119 Bacteria 778
125 Ga0105246_11275230 3300011119 Bacteria 680
126 Ga0105246_11407009 3300011119 Bacteria 651
127 Ga0157329_1003842 3300012491 Bacteria 943
128 Ga0157371_10560082 3300013102 Unclassified 848
129 Ga0157369_10074583 3300013105 Bacteria 3638
130 Ga0157378_10947925 3300013297 Unclassified 893
131 Ga0163162_10200512 3300013306 Unclassified 2124
132 Ga0157372_10736014 3300013307 Bacteria 1147
133 Ga0157372_11309220 3300013307 Unclassified 836
134 Ga0157372_11464499 3300013307 Bacteria 787
135 Ga0157372_12082581 3300013307 Unclassified 652
136 Ga0157372_12361988 3300013307 Unclassified 611
137 Ga0157375_10791766 3300013308 Unclassified 1097
138 Ga0163163_10405898 3300014325 Bacteria 1421
139 Ga0163163_10475934 3300014325 Unclassified 1310
140 Ga0163163_10651397 3300014325 Bacteria 1117
141 Ga0157380_11838157 3300014326 Bacteria 665
142 Ga0182008_10415440 3300014497 Bacteria 725
143 Ga0157377_10187713 3300014745 Bacteria 1304
144 Ga0157379_10913922 3300014968 Unclassified 833
145 Ga0157376_10035164 3300014969 Bacteria 4052
146 Ga0163161_10035374 3300017792 Bacteria 3575
147 Ga0206354_11015452 3300020081 Bacteria 1035
148 Ga0206353_12005706 3300020082 Bacteria 1025
149 Ga0213873_10020496 3300021358 Bacteria 1545
150 Ga0213874_10167119 3300021377 Bacteria 776
151 Ga0213876_10021199 3300021384 Bacteria 3436
152 Ga0213875_10005155 3300021388 Bacteria 7070
153 Ga0207656_10121391 3300025321 Unclassified 1217
154 Ga0207642_10055865 3300025899 Bacteria 1808
155 Ga0207642_10085897 3300025899 Unclassified 1541
156 Ga0207680_10366193 3300025903 Bacteria 1014
157 Ga0207699_10800472 3300025906 Archaea 693
158 Ga0207643_10331397 3300025908 Bacteria 952
159 Ga0207705_11182516 3300025909 Bacteria 587
160 Ga0207705_11415306 3300025909 Unclassified 528
161 Ga0207684_10836894 3300025910 Bacteria 776
162 Ga0207707_10045291 3300025912 Bacteria 3834
163 Ga0207707_10245674 3300025912 Unclassified 1555
164 Ga0207695_10253931 3300025913 Bacteria 1657
165 Ga0207693_10166647 3300025915 Bacteria 1734
166 Ga0207663_10267541 3300025916 Bacteria 1265
167 Ga0207663_10591978 3300025916 Bacteria 871
168 Ga0207657_10181215 3300025919 Bacteria 1703
169 Ga0207649_10346699 3300025920 Bacteria 1098
170 Ga0207649_10538344 3300025920 Bacteria 892
171 Ga0207646_10000641 3300025922 Bacteria 45529
172 Ga0207681_11056813 3300025923 Unclassified 682
173 Ga0207687_10082995 3300025927 Unclassified 2319
174 Ga0207687_10095459 3300025927 Unclassified 2178
175 Ga0207687_10315616 3300025927 Bacteria 1264
176 Ga0207700_10007847 3300025928 Bacteria 6563
177 Ga0207700_11342330 3300025928 Bacteria 637
178 Ga0207664_10034929 3300025929 Bacteria 3875
179 Ga0207706_10006276 3300025933 Bacteria 11046
180 Ga0207686_10059823 3300025934 Bacteria 2409
181 Ga0207686_11230957 3300025934 Bacteria 613
182 Ga0207709_10007173 3300025935 Bacteria 6218
183 Ga0207709_11020004 3300025935 Bacteria 677
184 Ga0207669_10614905 3300025937 Bacteria 885
185 Ga0207704_10066513 3300025938 Bacteria 2262
186 Ga0207704_11308579 3300025938 Bacteria 620
187 Ga0207665_10342034 3300025939 Bacteria 1128
188 Ga0207689_10142592 3300025942 Bacteria 1974
189 Ga0207661_10036781 3300025944 Bacteria 3824
190 Ga0207661_10112180 3300025944 Bacteria 2308
191 Ga0207661_10549778 3300025944 Bacteria 1058
192 Ga0207661_10751825 3300025944 Bacteria 897
193 Ga0207661_10768137 3300025944 Bacteria 887
194 Ga0207661_11304688 3300025944 Bacteria 667
195 Ga0207679_10252029 3300025945 Unclassified 1501
196 Ga0207667_10101586 3300025949 Unclassified 2966
197 Ga0207667_10824370 3300025949 Bacteria 923
198 Ga0207712_10014733 3300025961 Bacteria 5035
199 Ga0207712_10541452 3300025961 Bacteria 1000
200 Ga0207668_10054962 3300025972 Bacteria 2765
201 Ga0207640_10328398 3300025981 Bacteria 1221
202 Ga0207640_10507608 3300025981 Unclassified 1005
203 Ga0207677_10328822 3300026023 Unclassified 1273
204 Ga0207678_10200417 3300026067 Bacteria 1706
205 Ga0207678_11571790 3300026067 Bacteria 580
206 Ga0207678_11752570 3300026067 Bacteria 544
207 Ga0207708_10303894 3300026075 Unclassified 1298
208 Ga0207708_10909457 3300026075 Bacteria 762
209 Ga0207708_10986467 3300026075 Bacteria 731
210 Ga0207702_10288026 3300026078 Bacteria 1555
211 Ga0207702_10374056 3300026078 Bacteria 1368
212 Ga0207702_10730369 3300026078 Bacteria 977
213 Ga0207648_10292600 3300026089 Unclassified 1459
214 Ga0207676_11572422 3300026095 Bacteria 655
215 Ga0207674_10049723 3300026116 Bacteria 4286
216 Ga0207675_100003181 3300026118 Bacteria 16105
217 Ga0207683_10056641 3300026121 Bacteria 3439
218 Ga0207683_10131594 3300026121 Bacteria 2250
219 Ga0207698_10113205 3300026142 Bacteria 2279
220 Ga0207428_10264701 3300027907 Bacteria 1280
221 Ga0268266_11374548 3300028379 Bacteria 682
222 Ga0268264_11168368 3300028381 Unclassified 779
223 Ga0265326_10033403 3300028558 Bacteria 1464
224 Ga0265318_10116539 3300028577 Bacteria 982
225 Ga0265336_10186426 3300028666 Bacteria 617
226 Ga0265338_10020834 3300028800 Bacteria 6871
227 Ga0265324_10099179 3300029957 Bacteria 990
228 Ga0265328_10090230 3300031239 Bacteria 1132
229 Ga0265320_10219588 3300031240 Unclassified 847
230 Ga0265325_10168788 3300031241 Bacteria 1025
231 Ga0265339_10071404 3300031249 Bacteria 1850
232 Ga0265327_10010204 3300031251 Bacteria 6635
233 Ga0265316_10007432 3300031344 Bacteria 10324
234 Ga0265313_10010297 3300031595 Bacteria 5939
235 Ga0265314_10001460 3300031711 Bacteria 26370
236 Ga0307405_10528477 3300031731 Unclassified 951
237 Ga0307406_10037700 3300031901 Unclassified 2988
238 Ga0307409_100232663 3300031995 Bacteria 1672
239 Ga0307416_101011091 3300032002 Bacteria 935
240 Ga0307415_100364947 3300032126 Bacteria 1221
241 Ga0373926_0037604 3300035083 Bacteria 1722
242 Ga0373945_0021000 3300035116 Bacteria 2240
243 Ga0373960_0233745 3300035121 Bacteria 662
244 Ga0373943_0005289 3300035170 Bacteria 5806
245 Ga0373943_0038252 3300035170 Bacteria 2306
246 Ga0373946_0438183 3300035171 Unclassified 664
247 Ga0373955_0772863 3300035172 Unclassified 590
248 Ga0373962_0156091 3300035242 Bacteria 750
249 Ga0373935_0060671 3300035692 Bacteria 2420
250 Ga0373947_0002185 3300035725 Bacteria 11865
251 Ga0373947_0370037 3300035725 Bacteria 964
252 Ga0373947_0651036 3300035725 Unclassified 718
253 Ga0373937_0171353 3300036401 Bacteria 2037
254 Ga0373925_0004689 3300037068 Bacteria 10314
255 Ga0373925_0092699 3300037068 Bacteria 2311
256 Ga0373925_0336209 3300037068 Bacteria 1224
257 Ga0395899_0018271 3300037312 Bacteria 5332
258 Ga0395899_0023125 3300037312 Bacteria 4710
259 Ga0395899_0027042 3300037312 Bacteria 4326
260 Ga0395900_0001565 3300037418 Bacteria 27145
261 Ga0395900_0003262 3300037418 Bacteria 17574
262 Ga0395900_0012655 3300037418 Bacteria 8625
263 Ga0395900_0016561 3300037418 Bacteria 7520
264 Ga0395900_0513697 3300037418 Unclassified 1147
265 Ga0395900_0733100 3300037418 Unclassified 920
266 Ga0395900_1316829 3300037418 Bacteria 636
267 Ga0395898_0000894 3300037466 Bacteria 48455
268 Ga0395898_0004416 3300037466 Bacteria 15388
269 Ga0395898_0015216 3300037466 Bacteria 7898
270 Ga0395898_0029152 3300037466 Bacteria 5529
271 Ga0395898_1642118 3300037466 Unclassified 566
272 Ga0395898_1767701 3300037466 Unclassified 540
273 Ga0395905_0000939 3300037471 Bacteria 37503
274 Ga0395905_0029213 3300037471 Bacteria 5196
275 Ga0395905_0241247 3300037471 Bacteria 1689
276 Ga0395905_1338249 3300037471 Unclassified 620
277 Ga0436364_0045049 3300037853 Bacteria 87133
278 Ga0395901_0008694 3300038443 Bacteria 10262
279 Ga0395901_0011371 3300038443 Bacteria 9021
280 Ga0395901_0036589 3300038443 Bacteria 5074
281 Ga0395901_0051485 3300038443 Bacteria 4281
282 Ga0395901_0308161 3300038443 Unclassified 1640
283 Ga0395901_1307936 3300038443 Bacteria 686
284 Ga0395901_1794092 3300038443 Bacteria 563
285 Ga0436365_0209010 3300039437 Bacteria 25435
286 Ga0436365_0297668 3300039437 Bacteria 663
287 Ga0436365_0417739 3300039437 Bacteria 5599
288 Ga0436365_0864689 3300039437 Bacteria 8477
289 Ga0436365_1119177 3300039437 Unclassified 719
290 Ga0436363_0436702 3300039450 Bacteria 8639
291 Ga0436363_0492403 3300039450 Bacteria 581
292 Ga0436363_1690174 3300039450 Bacteria 1080
293 Ga0436362_0581738 3300039453 Bacteria 5528
294 Ga0451797_0627214 3300041453 Bacteria 1408
295 Ga0451800_0578449 3300041459 Unclassified 682
296 Ga0451839_0347327 3300041496 Bacteria 3218
297 Ga0451839_0630312 3300041496 Bacteria 948
298 Ga0451843_1743330 3300041509 Bacteria 563
299 Ga0451853_0933528 3300041512 Unclassified 894
300 Ga0451853_2698689 3300041512 Bacteria 552
301 Ga0451577_0632087 3300042876 Unclassified 971
302 Ga0466969_0009170 3300044656 Bacteria 5247
303 Ga0466969_0396740 3300044656 Unclassified 626
304 Ga0466966_0072248 3300044684 Unclassified 2161
305 Ga0466961_0065707 3300044693 Bacteria 2305
306 Ga0466963_0010861 3300044694 Bacteria 5529
307 Ga0466964_0144271 3300044706 Unclassified 1097
308 Ga0466964_0214310 3300044706 Bacteria 932
309 Ga0453684_2281650 3300044712 Unclassified 539
310 Ga0466971_0046623 3300044719 Bacteria 1948
311 Ga0466971_0177322 3300044719 Bacteria 1001
312 Ga0466968_0068634 3300044735 Bacteria 1539
313 Ga0466968_0246271 3300044735 Unclassified 848
314 Ga0466970_0015277 3300044765 Bacteria 3947
315 Ga0466960_0770972 3300044901 Bacteria 581
316 Ga0466959_0031036 3300045049 Bacteria 3955
317 Ga0466958_0452276 3300045836 Unclassified 831
318 Ga0466967_0028087 3300045976 Bacteria 4692
319 Ga0466967_0127846 3300045976 Bacteria 2355
320 Ga0466967_0269383 3300045976 Bacteria 1632
321 Ga0466967_0276300 3300045976 Unclassified 1611
322 Ga0466967_0305402 3300045976 Bacteria 1532
323 Ga0466967_1084992 3300045976 Bacteria 798
324 Ga0495603_0020100 3300046455 Bacteria 4047
325 Ga0495603_0214191 3300046455 Bacteria 1112
326 Ga0495629_0070678 3300046459 Unclassified 2435
327 Ga0495641_0007326 3300046461 Bacteria 6909
328 Ga0495641_0085557 3300046461 Bacteria 1411
329 Ga0495641_0278270 3300046461 Bacteria 753
330 Ga0495651_0140019 3300046462 Bacteria 1756
331 Ga0495653_0221186 3300046463 Bacteria 1273
332 Ga0495580_0032863 3300046472 Unclassified 3739
333 Ga0495582_0006156 3300046473 Bacteria 6681
334 Ga0495639_0000769 3300046475 Bacteria 14591
335 Ga0495639_0301686 3300046475 Unclassified 799
336 Ga0495639_0468376 3300046475 Bacteria 641
337 Ga0495662_0002272 3300046476 Bacteria 9690
338 Ga0495664_0001174 3300046477 Bacteria 13639
339 Ga0495618_0003361 3300046514 Bacteria 9973
340 Ga0495630_0006298 3300046517 Bacteria 8429
341 Ga0495630_0008480 3300046517 Bacteria 7378
342 Ga0495630_0075476 3300046517 Unclassified 2540
343 Ga0495631_0317597 3300046518 Bacteria 663
344 Ga0495666_0001720 3300046526 Bacteria 10799
345 Ga0495652_0013168 3300046529 Bacteria 7447
346 Ga0495652_0449921 3300046529 Bacteria 902
347 Ga0495665_0001835 3300046531 Bacteria 11470
348 Ga0495640_0031832 3300046533 Unclassified 3762
349 Ga0495586_0006428 3300046535 Bacteria 6277
350 Ga0495667_0287248 3300046559 Bacteria 1044
351 Ga0495667_0531834 3300046559 Bacteria 735
352 Ga0495634_0010198 3300046642 Bacteria 6891
353 Ga0495634_0036248 3300046642 Bacteria 3374
354 Ga0495635_0094524 3300046663 Bacteria 2043
355 Ga0495588_0086754 3300046674 Bacteria 1637
356 Ga0495599_0323449 3300046678 Bacteria 928
357 Ga0495599_0700311 3300046678 Unclassified 584
358 Ga0495647_0010750 3300046681 Unclassified 3123
359 Ga0495658_0003762 3300046683 Bacteria 7509
360 Ga0495658_0066683 3300046683 Bacteria 2080
361 Ga0495613_0004927 3300046689 Bacteria 10032
362 Ga0495624_0003340 3300046690 Bacteria 11930
363 Ga0495581_0001964 3300047315 Bacteria 11525
364 Ga0495604_0216049 3300047317 Bacteria 1323
365 Ga0495674_0102368 3300047319 Bacteria 2435
366 Ga0495674_0208661 3300047319 Bacteria 1619
367 Ga0495676_0004252 3300047321 Bacteria 13069
368 Ga0495676_0067446 3300047321 Bacteria 2768
369 Ga0495676_0085315 3300047321 Unclassified 2379
370 Ga0495676_0175521 3300047321 Bacteria 1505
371 Ga0495676_0180890 3300047321 Bacteria 1478
372 Ga0495680_0032575 3300047322 Bacteria 4228
373 Ga0495680_0135909 3300047322 Bacteria 1803
374 Ga0495684_0005561 3300047471 Bacteria 9819
375 Ga0495593_0002274 3300047673 Bacteria 11516
376 Ga0495614_0000691 3300048089 Bacteria 14197
377 Ga0496100_0277387 3300048903 Bacteria 1248
378 Ga0496101_0470031 3300048904 Bacteria 993
379 Ga0496101_1451250 3300048904 Bacteria 535
380 Ga0496102_0167524 3300048905 Bacteria 2068
381 Ga0496102_0466325 3300048905 Bacteria 1184
382 Ga0496102_1062173 3300048905 Bacteria 730
383 Ga0496103_0246703 3300048906 Unclassified 1149
384 Ga0496104_0180911 3300048907 Bacteria 2019
385 Ga0496104_0434999 3300048907 Unclassified 1224
386 Ga0496104_1076156 3300048907 Bacteria 708
387 Ga0496105_0988524 3300048908 Unclassified 630
388 Ga0496106_0003054 3300048909 Bacteria 12476
389 Ga0496106_0352826 3300048909 Bacteria 1182
390 Ga0496107_0004985 3300048910 Bacteria 9037
391 Ga0496108_0036965 3300048911 Bacteria 4065
392 Ga0496108_0191984 3300048911 Bacteria 1770
393 Ga0496108_0561570 3300048911 Unclassified 995
394 Ga0496109_0017780 3300048912 Bacteria 6236
395 Ga0496109_0191448 3300048912 Bacteria 1922
396 Ga0496109_0490732 3300048912 Bacteria 1159
397 Ga0496109_0729145 3300048912 Unclassified 929
398 Ga0496110_0067137 3300048913 Bacteria 3173
399 Ga0496110_0239828 3300048913 Bacteria 1650
400 Ga0496110_0323441 3300048913 Bacteria 1405
401 Ga0496110_0377158 3300048913 Bacteria 1292
402 Ga0496110_0633496 3300048913 Bacteria 968
403 Ga0496110_0869493 3300048913 Bacteria 807
404 Ga0496110_1009668 3300048913 Unclassified 739
405 Ga0496110_1809399 3300048913 Unclassified 521
406 Ga0496111_0021080 3300048914 Bacteria 4546
407 Ga0496112_0455394 3300048915 Bacteria 1217
408 Ga0496112_0505227 3300048915 Bacteria 1144
409 Ga0496114_0409705 3300048917 Bacteria 1200
410 Ga0496115_0420457 3300048918 Unclassified 1083
411 Ga0501041_0540729 3300049577 Bacteria 742
412 Ga0501067_0000814 3300049583 Bacteria 16819
413 Ga0501068_0000272 3300049584 Bacteria 25560
414 Ga0501069_0000097 3300049585 Bacteria 41382
415 Ga0501069_0007903 3300049585 Bacteria 5584
416 Ga0501070_0380374 3300049586 Bacteria 1144
417 Ga0501070_0960765 3300049586 Bacteria 664
418 Ga0501071_0122462 3300049587 Bacteria 1928
419 Ga0501080_0764523 3300049742 Bacteria 849
420 Ga0501083_0625573 3300049744 Bacteria 700
421 nmdc:mga05p37_371831_c1 3300050507 Bacteria 1677
422 nmdc:mga05p37_422856_c1 3300050507 Bacteria 1550
423 nmdc:mga09592_133502_c1 3300050508 Bacteria 2137
424 nmdc:mga06r32_217683_c1 3300050510 Bacteria 1897
425 nmdc:mga08y16_1617851_c1 3300050511 Bacteria 605
426 nmdc:mga08y16_652166_c1 3300050511 Bacteria 1057
427 nmdc:mga08y16_94396_c1 3300050511 Bacteria 3116
428 nmdc:mga0n895_194319_c1 3300050512 Bacteria 2060
429 nmdc:mga0n895_501054_c1 3300050512 Bacteria 1223
430 nmdc:mga0n895_5121_c1 3300050512 Bacteria 10895
431 nmdc:mga0rr50_1183879_c1 3300050513 Unclassified 649
432 nmdc:mga0rr50_310275_c1 3300050513 Unclassified 1321
433 nmdc:mga0a205_146536_c1 3300050515 Bacteria 2261
434 nmdc:mga0a205_169798_c1 3300050515 Unclassified 2077
435 nmdc:mga0a205_285336_c1 3300050515 Archaea 1526
436 Ga0495601_0022351 3300053077 Unclassified 3881
437 Ga0495601_0083683 3300053077 Bacteria 2049
438 Ga0495601_0433610 3300053077 Bacteria 851
439 Ga0495612_0028722 3300053078 Bacteria 2239
440 Ga0495595_0256403 3300053084 Bacteria 876
441 Ga0500566_0030254 3300053094 Unclassified 3158
442 Ga0501084_0029274 3300054114 Bacteria 4607
443 Ga0501082_0569480 3300060353 Bacteria 991
444 Ga0466962_0129552 3300061719 Bacteria 1219
445 Ga0466962_0252830 3300061719 Unclassified 866
446 Ga0530510_0027260 3300061734 Bacteria 4094
447 Ga0530510_0113106 3300061734 Bacteria 1989
448 Ga0207693_10010105
449 JGI25407J50210_10009359
450 Ga0070658_10142774
451 Ga0070658_11333462
452 Ga0070683_100141478
453 Ga0070683_100321845
454 Ga0070683_100555373
455 Ga0070683_100870942
456 Ga0070666_10204655
457 Ga0070680_100155188
458 Ga0070682_100014879
459 Ga0070682_100468684
460 Ga0068868_100278018
461 Ga0068868_100432198
462 Ga0070660_100143547
463 Ga0070660_101538534
464 Ga0070689_101734542
465 Ga0070691_10187777
466 Ga0070661_100523534
467 Ga0070668_100068292
468 Ga0070688_100049724
469 Ga0070659_100119052
470 Ga0070709_10575800
471 Ga0070714_100003825
472 Ga0070714_101129505
473 Ga0070713_100204501
474 Ga0070713_100809867
475 Ga0070713_101843414
476 Ga0070710_10145509
477 Ga0070701_10128681
478 Ga0070711_100184469
479 Ga0070705_100166156
480 Ga0070700_100076836
481 Ga0070700_100707270
482 Ga0070694_100368018
483 Ga0070708_100416708
484 Ga0070663_100265841
485 Ga0070678_100125658
486 Ga0068867_100147604
487 Ga0070685_10691175
488 Ga0070706_100152512
489 Ga0070707_100001145
490 Ga0070699_100162659
491 Ga0070699_100396656
492 Ga0070699_100603649
493 Ga0070679_100210465
494 Ga0070679_100526639
495 Ga0070686_100018657
496 Ga0070686_100816474
497 Ga0070696_100560303
498 Ga0070693_100263973
499 Ga0070704_100157445
500 Ga0070704_100746840
501 Ga0068855_100072581
502 Ga0068855_100478489
503 Ga0070664_100367518
504 Ga0068857_100139768
505 Ga0068854_100597275
506 Ga0068854_101097573
507 Ga0068856_100828439
508 Ga0070702_100039631
509 Ga0070702_100232878
510 Ga0068852_100151880
511 Ga0068852_100715873
512 Ga0068864_101636854
513 Ga0068866_10098702
514 Ga0068866_10251024
515 Ga0068866_10329542
516 Ga0068861_100013913
517 Ga0068851_10073810
518 Ga0068851_10668952
519 Ga0068870_10257007
520 Ga0068870_10835480
521 Ga0068870_10903094
522 Ga0068858_100144879
523 Ga0068860_101378566
524 Ga0081455_10049149
525 Ga0070717_10002526
526 Ga0070717_10664630
527 Ga0070717_11238880
528 Ga0075432_10002617
529 Ga0070712_100673679
530 Ga0070712_100998756
531 Ga0070712_101168656
532 Ga0070712_101562361
533 Ga0075433_10127258
534 Ga0075434_100022851
535 Ga0075434_100266489
536 Ga0075434_100356512
537 Ga0075434_100476079
538 Ga0075429_100328197
539 Ga0068865_100232490
540 Ga0068865_101515829
541 Ga0075435_100581171
542 Ga0075435_101017939
543 Ga0111539_10007873
544 Ga0111539_10008062
545 Ga0111539_11158276
546 Ga0111539_12259297
547 Ga0105245_10043144
548 Ga0105245_10382692
549 Ga0105245_10617959
550 Ga0114129_10342032
551 Ga0114129_11571789
552 Ga0105243_10074270
553 Ga0105243_10234950
554 Ga0105243_10529837
555 Ga0105243_11769408
556 Ga0105242_10099596
557 Ga0105242_10541522
558 Ga0105242_10919207
559 Ga0105242_11694171
560 Ga0105237_12256100
561 Ga0105238_10188119
562 Ga0105249_10008924
563 Ga0105249_10698509
564 Ga0105249_11774442
565 Ga0105030_119291
566 Ga0099796_10585543
567 Ga0105239_10095458
568 Ga0105239_10179847
569 Ga0105239_10675707
570 Ga0105246_10880837
571 Ga0105246_10941672
572 Ga0105246_11275230
573 Ga0105246_11407009
574 Ga0157329_1003842
575 Ga0157371_10560082
576 Ga0157369_10074583
577 Ga0157378_10947925
578 Ga0163162_10200512
579 Ga0157372_10736014
580 Ga0157372_11309220
581 Ga0157372_11464499
582 Ga0157372_12082581
583 Ga0157372_12361988
584 Ga0157375_10791766
585 Ga0163163_10405898
586 Ga0163163_10475934
587 Ga0163163_10651397
588 Ga0157380_11838157
589 Ga0182008_10415440
590 Ga0157377_10187713
591 Ga0157379_10913922
592 Ga0157376_10035164
593 Ga0163161_10035374
594 Ga0206354_11015452
595 Ga0206353_12005706
596 Ga0213873_10020496
597 Ga0213874_10167119
598 Ga0213876_10021199
599 Ga0213875_10005155
600 Ga0207656_10121391
601 Ga0207642_10055865
602 Ga0207642_10085897
603 Ga0207680_10366193
604 Ga0207699_10800472
605 Ga0207643_10331397
606 Ga0207705_11182516
607 Ga0207705_11415306
608 Ga0207684_10836894
609 Ga0207707_10045291
610 Ga0207707_10245674
611 Ga0207695_10253931
612 Ga0207693_10166647
613 Ga0207663_10267541
614 Ga0207663_10591978
615 Ga0207657_10181215
616 Ga0207649_10346699
617 Ga0207649_10538344
618 Ga0207646_10000641
619 Ga0207681_11056813
620 Ga0207687_10082995
621 Ga0207687_10095459
622 Ga0207687_10315616
623 Ga0207700_10007847
624 Ga0207700_11342330
625 Ga0207664_10034929
626 Ga0207706_10006276
627 Ga0207686_10059823
628 Ga0207686_11230957
629 Ga0207709_10007173
630 Ga0207709_11020004
631 Ga0207669_10614905
632 Ga0207704_10066513
633 Ga0207704_11308579
634 Ga0207665_10342034
635 Ga0207689_10142592
636 Ga0207661_10036781
637 Ga0207661_10112180
638 Ga0207661_10549778
639 Ga0207661_10751825
640 Ga0207661_10768137
641 Ga0207661_11304688
642 Ga0207679_10252029
643 Ga0207667_10101586
644 Ga0207667_10824370
645 Ga0207712_10014733
646 Ga0207712_10541452
647 Ga0207668_10054962
648 Ga0207640_10328398
649 Ga0207640_10507608
650 Ga0207677_10328822
651 Ga0207678_10200417
652 Ga0207678_11571790
653 Ga0207678_11752570
654 Ga0207708_10303894
655 Ga0207708_10909457
656 Ga0207708_10986467
657 Ga0207702_10288026
658 Ga0207702_10374056
659 Ga0207702_10730369
660 Ga0207648_10292600
661 Ga0207676_11572422
662 Ga0207674_10049723
663 Ga0207675_100003181
664 Ga0207683_10056641
665 Ga0207683_10131594
666 Ga0207698_10113205
667 Ga0207428_10264701
668 Ga0268266_11374548
669 Ga0268264_11168368
670 Ga0265326_10033403
671 Ga0265318_10116539
672 Ga0265336_10186426
673 Ga0265338_10020834
674 Ga0265324_10099179
675 Ga0265328_10090230
676 Ga0265320_10219588
677 Ga0265325_10168788
678 Ga0265339_10071404
679 Ga0265327_10010204
680 Ga0265316_10007432
681 Ga0265313_10010297
682 Ga0265314_10001460
683 Ga0307405_10528477
684 Ga0307406_10037700
685 Ga0307409_100232663
686 Ga0307416_101011091
687 Ga0307415_100364947
688 Ga0373926_0037604
689 Ga0373945_0021000
690 Ga0373960_0233745
691 Ga0373943_0005289
692 Ga0373943_0038252
693 Ga0373946_0438183
694 Ga0373955_0772863
695 Ga0373962_0156091
696 Ga0373935_0060671
697 Ga0373947_0002185
698 Ga0373947_0370037
699 Ga0373947_0651036
700 Ga0373937_0171353
701 Ga0373925_0004689
702 Ga0373925_0092699
703 Ga0373925_0336209
704 Ga0395899_0018271
705 Ga0395899_0023125
706 Ga0395899_0027042
707 Ga0395900_0001565
708 Ga0395900_0003262
709 Ga0395900_0012655
710 Ga0395900_0016561
711 Ga0395900_0513697
712 Ga0395900_0733100
713 Ga0395900_1316829
714 Ga0395898_0000894
715 Ga0395898_0004416
716 Ga0395898_0015216
717 Ga0395898_0029152
718 Ga0395898_1642118
719 Ga0395898_1767701
720 Ga0395905_0000939
721 Ga0395905_0029213
722 Ga0395905_0241247
723 Ga0395905_1338249
724 Ga0436364_0045049
725 Ga0395901_0008694
726 Ga0395901_0011371
727 Ga0395901_0036589
728 Ga0395901_0051485
729 Ga0395901_0308161
730 Ga0395901_1307936
731 Ga0395901_1794092
732 Ga0436365_0209010
733 Ga0436365_0297668
734 Ga0436365_0417739
735 Ga0436365_0864689
736 Ga0436365_1119177
737 Ga0436363_0436702
738 Ga0436363_0492403
739 Ga0436363_1690174
740 Ga0436362_0581738
741 Ga0451797_0627214
742 Ga0451800_0578449
743 Ga0451839_0347327
744 Ga0451839_0630312
745 Ga0451843_1743330
746 Ga0451853_0933528
747 Ga0451853_2698689
748 Ga0451577_0632087
749 Ga0466969_0009170
750 Ga0466969_0396740
751 Ga0466966_0072248
752 Ga0466961_0065707
753 Ga0466963_0010861
754 Ga0466964_0144271
755 Ga0466964_0214310
756 Ga0453684_2281650
757 Ga0466971_0046623
758 Ga0466971_0177322
759 Ga0466968_0068634
760 Ga0466968_0246271
761 Ga0466970_0015277
762 Ga0466960_0770972
763 Ga0466959_0031036
764 Ga0466958_0452276
765 Ga0466967_0028087
766 Ga0466967_0127846
767 Ga0466967_0269383
768 Ga0466967_0276300
769 Ga0466967_0305402
770 Ga0466967_1084992
771 Ga0495603_0020100
772 Ga0495603_0214191
773 Ga0495629_0070678
774 Ga0495641_0007326
775 Ga0495641_0085557
776 Ga0495641_0278270
777 Ga0495651_0140019
778 Ga0495653_0221186
779 Ga0495580_0032863
780 Ga0495582_0006156
781 Ga0495639_0000769
782 Ga0495639_0301686
783 Ga0495639_0468376
784 Ga0495662_0002272
785 Ga0495664_0001174
786 Ga0495618_0003361
787 Ga0495630_0006298
788 Ga0495630_0008480
789 Ga0495630_0075476
790 Ga0495631_0317597
791 Ga0495666_0001720
792 Ga0495652_0013168
793 Ga0495652_0449921
794 Ga0495665_0001835
795 Ga0495640_0031832
796 Ga0495586_0006428
797 Ga0495667_0287248
798 Ga0495667_0531834
799 Ga0495634_0010198
800 Ga0495634_0036248
801 Ga0495635_0094524
802 Ga0495588_0086754
803 Ga0495599_0323449
804 Ga0495599_0700311
805 Ga0495647_0010750
806 Ga0495658_0003762
807 Ga0495658_0066683
808 Ga0495613_0004927
809 Ga0495624_0003340
810 Ga0495581_0001964
811 Ga0495604_0216049
812 Ga0495674_0102368
813 Ga0495674_0208661
814 Ga0495676_0004252
815 Ga0495676_0067446
816 Ga0495676_0085315
817 Ga0495676_0175521
818 Ga0495676_0180890
819 Ga0495680_0032575
820 Ga0495680_0135909
821 Ga0495684_0005561
822 Ga0495593_0002274
823 Ga0495614_0000691
824 Ga0496100_0277387
825 Ga0496101_0470031
826 Ga0496101_1451250
827 Ga0496102_0167524
828 Ga0496102_0466325
829 Ga0496102_1062173
830 Ga0496103_0246703
831 Ga0496104_0180911
832 Ga0496104_0434999
833 Ga0496104_1076156
834 Ga0496105_0988524
835 Ga0496106_0003054
836 Ga0496106_0352826
837 Ga0496107_0004985
838 Ga0496108_0036965
839 Ga0496108_0191984
840 Ga0496108_0561570
841 Ga0496109_0017780
842 Ga0496109_0191448
843 Ga0496109_0490732
844 Ga0496109_0729145
845 Ga0496110_0067137
846 Ga0496110_0239828
847 Ga0496110_0323441
848 Ga0496110_0377158
849 Ga0496110_0633496
850 Ga0496110_0869493
851 Ga0496110_1009668
852 Ga0496110_1809399
853 Ga0496111_0021080
854 Ga0496112_0455394
855 Ga0496112_0505227
856 Ga0496114_0409705
857 Ga0496115_0420457
858 Ga0501041_0540729
859 Ga0501067_0000814
860 Ga0501068_0000272
861 Ga0501069_0000097
862 Ga0501069_0007903
863 Ga0501070_0380374
864 Ga0501070_0960765
865 Ga0501071_0122462
866 Ga0501080_0764523
867 Ga0501083_0625573
868 nmdc:mga05p37_371831_c1
869 nmdc:mga05p37_422856_c1
870 nmdc:mga09592_133502_c1
871 nmdc:mga06r32_217683_c1
872 nmdc:mga08y16_1617851_c1
873 nmdc:mga08y16_652166_c1
874 nmdc:mga08y16_94396_c1
875 nmdc:mga0n895_194319_c1
876 nmdc:mga0n895_501054_c1
877 nmdc:mga0n895_5121_c1
878 nmdc:mga0rr50_1183879_c1
879 nmdc:mga0rr50_310275_c1
880 nmdc:mga0a205_146536_c1
881 nmdc:mga0a205_169798_c1
882 nmdc:mga0a205_285336_c1
883 Ga0495601_0022351
884 Ga0495601_0083683
885 Ga0495601_0433610
886 Ga0495612_0028722
887 Ga0495595_0256403
888 Ga0500566_0030254
889 Ga0501084_0029274
890 Ga0501082_0569480
891 Ga0466962_0129552
892 Ga0466962_0252830
893 Ga0530510_0027260
894 Ga0530510_0113106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

42

107

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9285 39 115
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.9106 39 113
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.9102 5 115
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.9079 39 113
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.8977 38 117
ID Description Score Start End Superfamily
af_A0A0P0W8K1_101_248_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9002 39 114 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8977 38 117 2.60.120.10
af_A0A1D6PR44_1_254_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.888 79 125 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8852 38 120 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8816 25 115 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538ID37-F1-model_v4 Cupin domain-containing protein 0.9733 40 129
AF-A0A7W0Q0T2-F1-model_v4 Cupin domain-containing protein 0.9611 31 129
AF-A0A538CH66-F1-model_v4 Cupin domain-containing protein 0.9486 1 129
AF-A0A1Q7WFP9-F1-model_v4 Cupin type-2 domain-containing protein 0.9477 12 127
AF-A0A538DHL2-F1-model_v4 Cupin domain-containing protein 0.9455 1 128

Map