F445909

General Info

Members Datasets Scaffolds Average Seq Length
447 295 894 226

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10234957|Ga0070717_102349572
Length 226
Sequence MRPLTDSCEAGWARALEPVAAQISAMGDFLREEITQGRTYLPSGDNVLRAFKQPFDEVRVLIVGQDPYPTPGHPIGLSFSVAPTVKRIPGSLLNIFKEYTADLGYPRPATGDLTPWAENGVLLLNRVLTVQPGKPGSHRGKGWEAVTEQAIKALAERNDRGNPLVAILWGRDARNLAPLLGGVPKIESAHPSPMVANGDFFGSRPFSRANQLLEAHGGTAVDWKLP

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
265 2508501039 Frankia saprophytica CN3 Isolate Nodule
266 2547132424 Nocardia nova SH22a Isolate Unclassified
267 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
268 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
269 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
270 2643221679 Angustibacter sp. Root456 Isolate Unclassified
271 2643221692 Nocardia sp. Root136 Isolate Unclassified
272 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
273 2687453737 Frankia sp. BMG5.36 Isolate Nodule
274 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
275 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
276 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
277 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
278 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
279 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
280 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
281 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
282 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
283 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
284 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
285 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
286 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
287 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
288 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
289 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
290 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
291 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
292 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
293 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
294 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
295 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.72
Metatranscriptomes 1.34
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0.45
Rhizoplane 6.26
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10234957 3300006028 Bacteria 1615
2 JGI24737J22298_10054851 3300001990 Bacteria 1205
3 rootH2_10078173 3300003320 Bacteria 7058
4 rootH2_10154633 3300003320 Bacteria 2278
5 rootL2_10064882 3300003322 Bacteria 5965
6 rootH1_10000259 3300003323 Bacteria 5285
7 Ga0070658_10273613 3300005327 Bacteria 1437
8 Ga0070658_10315635 3300005327 Bacteria 1334
9 Ga0070676_10090925 3300005328 Bacteria 1869
10 Ga0070676_10284737 3300005328 Bacteria 1115
11 Ga0070683_100349820 3300005329 Bacteria 1407
12 Ga0070683_101152881 3300005329 Bacteria 745
13 Ga0070682_100138817 3300005337 Bacteria 1654
14 Ga0070682_100399074 3300005337 Bacteria 1039
15 Ga0068868_100280413 3300005338 Bacteria 1410
16 Ga0068868_100329627 3300005338 Bacteria 1302
17 Ga0068868_100555549 3300005338 Bacteria 1012
18 Ga0070661_100119207 3300005344 Bacteria 1975
19 Ga0070692_10205648 3300005345 Bacteria 1155
20 Ga0070668_100502719 3300005347 Bacteria 1049
21 Ga0070675_100094864 3300005354 Bacteria 2504
22 Ga0070671_100000412 3300005355 Bacteria 29645
23 Ga0070671_100141970 3300005355 Bacteria 2026
24 Ga0070674_100250145 3300005356 Bacteria 1392
25 Ga0070674_100443684 3300005356 Bacteria 1070
26 Ga0070674_100470224 3300005356 Bacteria 1041
27 Ga0070659_100024271 3300005366 Bacteria 4647
28 Ga0070659_100275667 3300005366 Bacteria 1398
29 Ga0070667_100000063 3300005367 Bacteria 138777
30 Ga0070667_100066231 3300005367 Bacteria 3069
31 Ga0070667_100248145 3300005367 Bacteria 1591
32 Ga0070667_100343974 3300005367 Bacteria 1349
33 Ga0070714_100003703 3300005435 Bacteria 11447
34 Ga0070714_100202674 3300005435 Bacteria 1815
35 Ga0070714_100333367 3300005435 Bacteria 1421
36 Ga0070713_100065734 3300005436 Bacteria 3048
37 Ga0070710_10292177 3300005437 Bacteria 1061
38 Ga0070710_10340458 3300005437 Bacteria 990
39 Ga0070663_100134044 3300005455 Bacteria 1884
40 Ga0070663_100165363 3300005455 Bacteria 1706
41 Ga0070663_100313277 3300005455 Bacteria 1260
42 Ga0070662_100200027 3300005457 Bacteria 1585
43 Ga0070681_10313913 3300005458 Bacteria 1477
44 Ga0068867_100093300 3300005459 Bacteria 2288
45 Ga0068867_100393851 3300005459 Bacteria 1167
46 Ga0070685_10065308 3300005466 Bacteria 2141
47 Ga0070698_100059764 3300005471 Bacteria 3849
48 Ga0070684_100308254 3300005535 Bacteria 1453
49 Ga0068853_100091299 3300005539 Bacteria 2678
50 Ga0070672_100372170 3300005543 Bacteria 1221
51 Ga0070696_100006628 3300005546 Bacteria 7736
52 Ga0070665_100099962 3300005548 Bacteria 2905
53 Ga0070665_100349692 3300005548 Bacteria 1483
54 Ga0068855_100102803 3300005563 Bacteria 3288
55 Ga0070664_100042117 3300005564 Bacteria 3855
56 Ga0068857_100268183 3300005577 Bacteria 1568
57 Ga0068854_100048597 3300005578 Bacteria 3027
58 Ga0068856_100498678 3300005614 Bacteria 1238
59 Ga0070702_100172161 3300005615 Bacteria 1409
60 Ga0068852_100634905 3300005616 Bacteria 1074
61 Ga0068859_100000777 3300005617 Bacteria 32236
62 Ga0068859_100000944 3300005617 Bacteria 29749
63 Ga0068859_100682276 3300005617 Bacteria 1119
64 Ga0068864_100661970 3300005618 Bacteria 1017
65 Ga0068866_10499300 3300005718 Bacteria 805
66 Ga0068851_10052054 3300005834 Bacteria 2082
67 Ga0068851_10095684 3300005834 Bacteria 1569
68 Ga0068870_10356105 3300005840 Bacteria 940
69 Ga0068863_100000159 3300005841 Bacteria 71831
70 Ga0068863_100000648 3300005841 Bacteria 35309
71 Ga0068863_100007113 3300005841 Bacteria 10973
72 Ga0068863_100035863 3300005841 Bacteria 4723
73 Ga0068858_100009162 3300005842 Bacteria 9462
74 Ga0068858_100051255 3300005842 Bacteria 3818
75 Ga0068858_100056127 3300005842 Bacteria 3641
76 Ga0068860_100000065 3300005843 Bacteria 186634
77 Ga0068862_100000028 3300005844 Bacteria 184197
78 Ga0068862_100583839 3300005844 Bacteria 1071
79 Ga0081540_1005051 3300005983 Bacteria 9898
80 Ga0070717_10205762 3300006028 Bacteria 1725
81 Ga0070717_10543512 3300006028 Bacteria 1052
82 Ga0075365_10091417 3300006038 Bacteria 2074
83 Ga0075364_10130295 3300006051 Bacteria 1688
84 Ga0075370_10117767 3300006353 Bacteria 1545
85 Ga0075428_100006048 3300006844 Bacteria 13445
86 Ga0075428_100293330 3300006844 Bacteria 1749
87 Ga0075430_100019963 3300006846 Bacteria 5702
88 Ga0097620_100000777 3300006931 Bacteria 32236
89 Ga0097620_100000944 3300006931 Bacteria 29749
90 Ga0097620_100016788 3300006931 Bacteria 7351
91 Ga0097620_100682290 3300006931 Bacteria 1119
92 Ga0099794_10239930 3300007265 Bacteria 934
93 Ga0111539_10587084 3300009094 Bacteria 1297
94 Ga0111539_10885408 3300009094 Bacteria 1038
95 Ga0111539_11266795 3300009094 Bacteria 856
96 Ga0105245_10172177 3300009098 Bacteria 2062
97 Ga0105245_10554059 3300009098 Bacteria 1172
98 Ga0105247_10254600 3300009101 Bacteria 1201
99 Ga0114129_10001766 3300009147 Bacteria 29481
100 Ga0105243_10017906 3300009148 Bacteria 5361
101 Ga0105243_10998772 3300009148 Bacteria 839
102 Ga0105241_10118131 3300009174 Bacteria 2132
103 Ga0105242_10267051 3300009176 Bacteria 1548
104 Ga0105242_10632539 3300009176 Bacteria 1038
105 Ga0105248_10050782 3300009177 Bacteria 4652
106 Ga0105237_10351936 3300009545 Bacteria 1477
107 Ga0105237_10808241 3300009545 Bacteria 944
108 Ga0105238_10979354 3300009551 Bacteria 866
109 Ga0105249_10080852 3300009553 Bacteria 3020
110 Ga0105249_10108052 3300009553 Bacteria 2626
111 Ga0105249_11123445 3300009553 Bacteria 856
112 Ga0105239_10454534 3300010375 Bacteria 1453
113 Ga0105239_10673605 3300010375 Bacteria 1182
114 Ga0105239_11197895 3300010375 Bacteria 875
115 Ga0105246_10069559 3300011119 Bacteria 2473
116 Ga0105246_10526913 3300011119 Bacteria 1008
117 Ga0157369_10721866 3300013105 Bacteria 1026
118 Ga0157374_10922242 3300013296 Bacteria 891
119 Ga0157374_11124584 3300013296 Bacteria 806
120 Ga0157378_10205516 3300013297 Bacteria 1865
121 Ga0163162_11193323 3300013306 Bacteria 863
122 Ga0157372_10634128 3300013307 Bacteria 1245
123 Ga0157375_10361858 3300013308 Bacteria 1617
124 Ga0163163_10567906 3300014325 Bacteria 1197
125 Ga0163163_10744957 3300014325 Bacteria 1043
126 Ga0163163_10834937 3300014325 Bacteria 985
127 Ga0157377_10187800 3300014745 Bacteria 1304
128 Ga0157379_10001387 3300014968 Bacteria 19820
129 Ga0157379_10473616 3300014968 Bacteria 1158
130 Ga0206356_11257196 3300020070 Bacteria 758
131 Ga0206354_10127114 3300020081 Bacteria 1097
132 Ga0206354_10547656 3300020081 Bacteria 1366
133 Ga0206354_11585944 3300020081 Bacteria 2151
134 Ga0206353_11490006 3300020082 Bacteria 5780
135 Ga0213876_10140919 3300021384 Bacteria 1282
136 Ga0224712_10001633 3300022467 Bacteria 5269
137 Ga0207656_10056297 3300025321 Bacteria 1714
138 Ga0207692_10191226 3300025898 Bacteria 1198
139 Ga0207710_10000014 3300025900 Bacteria 408072
140 Ga0207680_10083273 3300025903 Bacteria 2016
141 Ga0207647_10010162 3300025904 Bacteria 6652
142 Ga0207647_10029890 3300025904 Bacteria 3520
143 Ga0207645_10005431 3300025907 Bacteria 9240
144 Ga0207643_10022720 3300025908 Bacteria 3456
145 Ga0207705_10511636 3300025909 Bacteria 933
146 Ga0207684_10040070 3300025910 Bacteria 3971
147 Ga0207654_10275731 3300025911 Bacteria 1136
148 Ga0207707_10153234 3300025912 Bacteria 2015
149 Ga0207671_10201562 3300025914 Bacteria 1554
150 Ga0207662_10077997 3300025918 Bacteria 2016
151 Ga0207657_10038410 3300025919 Bacteria 4262
152 Ga0207657_10165552 3300025919 Bacteria 1794
153 Ga0207646_10007353 3300025922 Bacteria 11218
154 Ga0207681_10008158 3300025923 Bacteria 6403
155 Ga0207681_10052825 3300025923 Bacteria 2757
156 Ga0207694_10280498 3300025924 Bacteria 1368
157 Ga0207700_10040749 3300025928 Bacteria 3392
158 Ga0207700_10759554 3300025928 Bacteria 866
159 Ga0207664_10019741 3300025929 Bacteria 4988
160 Ga0207664_10021809 3300025929 Bacteria 4772
161 Ga0207644_10000973 3300025931 Bacteria 18301
162 Ga0207690_10397641 3300025932 Bacteria 1098
163 Ga0207706_10028187 3300025933 Bacteria 5017
164 Ga0207709_10018663 3300025935 Bacteria 3888
165 Ga0207711_10000373 3300025941 Bacteria 47596
166 Ga0207661_10212631 3300025944 Bacteria 1705
167 Ga0207661_10442651 3300025944 Bacteria 1183
168 Ga0207661_10614303 3300025944 Bacteria 998
169 Ga0207661_11036715 3300025944 Bacteria 755
170 Ga0207679_10853935 3300025945 Bacteria 831
171 Ga0207712_10000020 3300025961 Bacteria 292796
172 Ga0207712_10156740 3300025961 Bacteria 1765
173 Ga0207640_10021935 3300025981 Bacteria 3814
174 Ga0207658_10002515 3300025986 Bacteria 13345
175 Ga0207658_10468518 3300025986 Bacteria 1118
176 Ga0207677_10362973 3300026023 Bacteria 1217
177 Ga0207677_10412387 3300026023 Bacteria 1148
178 Ga0207677_10422772 3300026023 Bacteria 1135
179 Ga0207678_10042928 3300026067 Bacteria 3914
180 Ga0207678_10209556 3300026067 Bacteria 1667
181 Ga0207678_10351524 3300026067 Bacteria 1271
182 Ga0207702_10519405 3300026078 Bacteria 1162
183 Ga0207702_10533345 3300026078 Bacteria 1147
184 Ga0207641_10000156 3300026088 Bacteria 97171
185 Ga0207641_10006370 3300026088 Bacteria 9964
186 Ga0207641_10010166 3300026088 Bacteria 7738
187 Ga0207641_10452737 3300026088 Bacteria 1241
188 Ga0207641_10563431 3300026088 Bacteria 1112
189 Ga0207648_10028113 3300026089 Bacteria 4988
190 Ga0207674_10140376 3300026116 Bacteria 2375
191 Ga0207674_10248874 3300026116 Bacteria 1724
192 Ga0207674_10271064 3300026116 Bacteria 1645
193 Ga0207674_10273547 3300026116 Bacteria 1637
194 Ga0207675_100096500 3300026118 Bacteria 2783
195 Ga0207683_10058309 3300026121 Bacteria 3390
196 Ga0207683_10119659 3300026121 Bacteria 2363
197 Ga0207683_10683255 3300026121 Bacteria 951
198 Ga0207698_10174278 3300026142 Bacteria 1898
199 Ga0207698_10378080 3300026142 Bacteria 1346
200 Ga0207698_10525772 3300026142 Bacteria 1155
201 Ga0207428_10078385 3300027907 Bacteria 2585
202 Ga0268266_10021318 3300028379 Bacteria 5521
203 Ga0268265_10000004 3300028380 Bacteria 648376
204 Ga0268264_10000024 3300028381 Bacteria 470081
205 Ga0268264_10127816 3300028381 Bacteria 2249
206 Ga0268264_10628197 3300028381 Bacteria 1061
207 Ga0265319_1000773 3300028563 Bacteria 20790
208 Ga0265334_10005961 3300028573 Bacteria 5301
209 Ga0265318_10050946 3300028577 Bacteria 1555
210 Ga0265323_10005739 3300028653 Bacteria 5259
211 Ga0265322_10002763 3300028654 Bacteria 5366
212 Ga0265338_10000755 3300028800 Bacteria 55199
213 Ga0265338_10002435 3300028800 Bacteria 27969
214 Ga0265338_10563380 3300028800 Bacteria 797
215 Ga0265324_10000222 3300029957 Bacteria 43679
216 Ga0265324_10005107 3300029957 Bacteria 5745
217 Ga0316182_1326249 3300030745 Bacteria 1193
218 Ga0265332_10001370 3300031238 Bacteria 13798
219 Ga0265320_10031179 3300031240 Bacteria 2740
220 Ga0265320_10064379 3300031240 Bacteria 1742
221 Ga0265325_10027514 3300031241 Bacteria 3073
222 Ga0307513_10128345 3300031456 Bacteria 2486
223 Ga0307513_10297614 3300031456 Bacteria 1382
224 Ga0307516_10330947 3300031730 Bacteria 1192
225 Ga0307416_100541720 3300032002 Bacteria 1236
226 Ga0373926_0000330 3300035083 Bacteria 11877
227 Ga0373952_0032421 3300035092 Bacteria 1167
228 Ga0373932_0078812 3300035112 Bacteria 1037
229 Ga0373956_0003565 3300035119 Bacteria 6275
230 Ga0373935_0001562 3300035692 Bacteria 12768
231 Ga0373947_0000002 3300035725 Bacteria 383924
232 Ga0373947_0127998 3300035725 Bacteria 1619
233 Ga0316582_0123477 3300036647 Bacteria 1735
234 Ga0316584_0110382 3300036712 Bacteria 2058
235 Ga0451789_0149872 3300041443 Bacteria 788
236 Ga0451789_0935306 3300041443 Bacteria 1184
237 Ga0451793_0586671 3300041452 Bacteria 2667
238 Ga0439449_0041648 3300042007 Bacteria 1708
239 Ga0439444_0042162 3300042437 Bacteria 900
240 Ga0466969_0000386 3300044656 Bacteria 24220
241 Ga0466969_0044445 3300044656 Bacteria 2209
242 Ga0466965_0035620 3300044683 Bacteria 2438
243 Ga0466965_0047415 3300044683 Bacteria 2127
244 Ga0466966_0106717 3300044684 Bacteria 1728
245 Ga0466961_0015101 3300044693 Bacteria 4958
246 Ga0466963_0124736 3300044694 Bacteria 1775
247 Ga0466963_0187707 3300044694 Bacteria 1444
248 Ga0466963_0405643 3300044694 Bacteria 961
249 Ga0466971_0002410 3300044719 Bacteria 7890
250 Ga0466970_0149293 3300044765 Bacteria 1290
251 Ga0466957_0014665 3300044842 Bacteria 4566
252 Ga0466957_0057863 3300044842 Bacteria 2374
253 Ga0466957_0172952 3300044842 Bacteria 1408
254 Ga0466957_0301215 3300044842 Bacteria 1077
255 Ga0466960_0000108 3300044901 Bacteria 27686
256 Ga0466960_0014121 3300044901 Bacteria 3409
257 Ga0466959_0001180 3300045049 Bacteria 15747
258 Ga0466959_0224221 3300045049 Bacteria 1303
259 Ga0466959_0312294 3300045049 Bacteria 1076
260 Ga0466959_0328691 3300045049 Bacteria 1044
261 Ga0466959_0454727 3300045049 Bacteria 868
262 Ga0466958_0114096 3300045836 Bacteria 1688
263 Ga0466958_0117484 3300045836 Bacteria 1663
264 Ga0466967_0028784 3300045976 Bacteria 4643
265 Ga0466967_0085802 3300045976 Bacteria 2851
266 Ga0466967_0096688 3300045976 Bacteria 2694
267 Ga0466967_0215740 3300045976 Bacteria 1821
268 Ga0466967_0278964 3300045976 Bacteria 1603
269 Ga0495592_0009158 3300046454 Bacteria 7450
270 Ga0495603_0029187 3300046455 Bacteria 3327
271 Ga0495651_0100043 3300046462 Bacteria 2160
272 Ga0495653_0067394 3300046463 Bacteria 2688
273 Ga0495653_0128051 3300046463 Bacteria 1801
274 Ga0495580_0174055 3300046472 Bacteria 1487
275 Ga0495664_0008865 3300046477 Bacteria 5620
276 Ga0495608_0007435 3300046511 Bacteria 7739
277 Ga0495628_0010260 3300046516 Bacteria 7967
278 Ga0495666_0049966 3300046526 Bacteria 2010
279 Ga0495652_0001620 3300046529 Bacteria 24570
280 Ga0495665_0008244 3300046531 Bacteria 5649
281 Ga0495640_0053358 3300046533 Bacteria 2771
282 Ga0495597_0147059 3300046542 Bacteria 969
283 Ga0495667_0056514 3300046559 Bacteria 2580
284 Ga0495667_0369029 3300046559 Bacteria 906
285 Ga0495634_0132515 3300046642 Bacteria 1588
286 Ga0495634_0167054 3300046642 Bacteria 1384
287 Ga0495625_0119933 3300046660 Bacteria 1791
288 Ga0495635_0004216 3300046663 Bacteria 9972
289 Ga0495657_0039313 3300046675 Bacteria 3251
290 Ga0495599_0120302 3300046678 Bacteria 1632
291 Ga0495623_0159350 3300046679 Bacteria 1327
292 Ga0495646_0123080 3300046680 Bacteria 1466
293 Ga0495646_0236636 3300046680 Bacteria 982
294 Ga0495613_0002970 3300046689 Bacteria 12699
295 Ga0495624_0091791 3300046690 Bacteria 1873
296 Ga0495600_0038112 3300046809 Bacteria 3127
297 Ga0495600_0119978 3300046809 Bacteria 1710
298 Ga0495581_0088263 3300047315 Bacteria 1798
299 Ga0495604_0016869 3300047317 Bacteria 5838
300 Ga0495604_0244591 3300047317 Bacteria 1225
301 Ga0495676_0339906 3300047321 Bacteria 1005
302 Ga0495680_0152605 3300047322 Bacteria 1683
303 Ga0495683_0002207 3300047323 Bacteria 11926
304 Ga0495675_0004200 3300047444 Bacteria 8719
305 Ga0495675_0016253 3300047444 Bacteria 4706
306 Ga0495684_0049796 3300047471 Bacteria 3200
307 Ga0495593_0027202 3300047673 Bacteria 3150
308 Ga0495602_0150691 3300048088 Bacteria 1828
309 Ga0496100_0077030 3300048903 Bacteria 2241
310 Ga0496100_0083631 3300048903 Bacteria 2161
311 Ga0496100_0474858 3300048903 Bacteria 961
312 Ga0496101_0003689 3300048904 Bacteria 9558
313 Ga0496101_0359974 3300048904 Bacteria 1144
314 Ga0496101_0362901 3300048904 Bacteria 1139
315 Ga0496102_0000042 3300048905 Bacteria 196538
316 Ga0496102_0000164 3300048905 Bacteria 89355
317 Ga0496103_0000063 3300048906 Bacteria 128503
318 Ga0496103_0000194 3300048906 Bacteria 60666
319 Ga0496104_0038838 3300048907 Bacteria 4456
320 Ga0496104_0481239 3300048907 Bacteria 1153
321 Ga0496104_0909601 3300048907 Bacteria 785
322 Ga0496105_0026455 3300048908 Bacteria 4732
323 Ga0496107_0233890 3300048910 Bacteria 1367
324 Ga0496107_0438060 3300048910 Bacteria 971
325 Ga0496108_0135393 3300048911 Bacteria 2119
326 Ga0496109_0281969 3300048912 Bacteria 1566
327 Ga0496109_0444941 3300048912 Bacteria 1224
328 Ga0496109_0567241 3300048912 Bacteria 1070
329 Ga0496109_0855132 3300048912 Bacteria 847
330 Ga0496110_0207856 3300048913 Bacteria 1779
331 Ga0496113_0303403 3300048916 Bacteria 1279
332 Ga0496114_0242584 3300048917 Bacteria 1585
333 Ga0496114_0668389 3300048917 Bacteria 913
334 Ga0496116_0024448 3300048919 Bacteria 4468
335 Ga0496117_0000261 3300048920 Bacteria 99625
336 Ga0496118_0000241 3300048921 Bacteria 96484
337 Ga0496118_0006546 3300048921 Bacteria 12745
338 Ga0496118_0161118 3300048921 Bacteria 1387
339 Ga0496119_0000210 3300048922 Bacteria 83492
340 Ga0496119_0039783 3300048922 Bacteria 3019
341 Ga0496120_0019006 3300048923 Bacteria 4411
342 Ga0496121_0068582 3300048924 Bacteria 2868
343 Ga0496121_0092923 3300048924 Bacteria 2350
344 Ga0496123_0219412 3300048926 Bacteria 960
345 Ga0496126_0000255 3300048929 Bacteria 114737
346 Ga0496126_0021449 3300048929 Bacteria 6308
347 Ga0501031_0006742 3300049568 Bacteria 7489
348 Ga0501031_0295865 3300049568 Bacteria 1049
349 Ga0501031_0366968 3300049568 Bacteria 932
350 Ga0501032_0019953 3300049569 Bacteria 4678
351 Ga0501032_0022091 3300049569 Bacteria 4416
352 Ga0501033_0039913 3300049570 Bacteria 3505
353 Ga0501034_0059273 3300049571 Bacteria 3845
354 Ga0501034_0117469 3300049571 Bacteria 2647
355 Ga0501036_0002429 3300049572 Bacteria 14586
356 Ga0501037_0001974 3300049573 Bacteria 14840
357 Ga0501037_0153102 3300049573 Bacteria 1647
358 Ga0501038_0013929 3300049574 Bacteria 7329
359 Ga0501039_0016960 3300049575 Bacteria 5582
360 Ga0501040_0011494 3300049576 Bacteria 5794
361 Ga0501041_0003738 3300049577 Bacteria 8753
362 Ga0501042_0102903 3300049578 Bacteria 2054
363 Ga0501043_0000682 3300049579 Bacteria 29934
364 Ga0501043_0081667 3300049579 Bacteria 2540
365 Ga0501046_0032542 3300049580 Bacteria 4223
366 Ga0501046_0077015 3300049580 Bacteria 2582
367 Ga0501047_0000031 3300049581 Bacteria 215903
368 Ga0501047_0000947 3300049581 Bacteria 29395
369 Ga0501047_0001051 3300049581 Bacteria 27524
370 Ga0501047_0008300 3300049581 Bacteria 9803
371 Ga0501048_0000085 3300049582 Bacteria 48910
372 Ga0501048_0093600 3300049582 Bacteria 2119
373 Ga0501048_0338400 3300049582 Bacteria 1073
374 Ga0501067_0001352 3300049583 Bacteria 13275
375 Ga0501067_0042268 3300049583 Bacteria 2530
376 Ga0501068_0019476 3300049584 Bacteria 3942
377 Ga0501069_0020661 3300049585 Bacteria 3568
378 Ga0501070_0012956 3300049586 Bacteria 7027
379 Ga0501070_0020999 3300049586 Bacteria 5478
380 Ga0501070_0124903 3300049586 Bacteria 2127
381 Ga0501071_0001160 3300049587 Bacteria 14757
382 Ga0501072_0010818 3300049588 Bacteria 6952
383 Ga0501073_0039289 3300049589 Bacteria 3352
384 Ga0501074_0031695 3300049590 Bacteria 3829
385 Ga0501074_0129179 3300049590 Bacteria 1808
386 Ga0501076_0003071 3300049592 Bacteria 11624
387 Ga0501077_0041741 3300049593 Bacteria 2919
388 Ga0501079_0006331 3300049741 Bacteria 8882
389 Ga0501080_0032629 3300049742 Bacteria 4857
390 Ga0501083_0003083 3300049744 Bacteria 11583
391 Ga0501035_0013124 3300049822 Bacteria 7645
392 Ga0501044_0012529 3300049823 Bacteria 9184
393 Ga0501044_0046879 3300049823 Bacteria 4473
394 Ga0501044_0463456 3300049823 Bacteria 1172
395 Ga0501045_0004098 3300049824 Bacteria 10060
396 nmdc:mga00v17_114444_c1 3300050491 Bacteria 1713
397 nmdc:mga0yw44_75362_c1 3300050492 Bacteria 2103
398 nmdc:mga07m45_115896_c1 3300050496 Bacteria 1545
399 nmdc:mga05p37_554887_c1 3300050507 Bacteria 1307
400 nmdc:mga09592_40051_c1 3300050508 Bacteria 3937
401 nmdc:mga0qj67_5984_c1 3300050509 Bacteria 8912
402 nmdc:mga06r32_97529_c1 3300050510 Bacteria 2881
403 nmdc:mga08y16_195828_c1 3300050511 Bacteria 2095
404 nmdc:mga08y16_277452_c1 3300050511 Bacteria 1729
405 Ga0495601_0004422 3300053077 Bacteria 8117
406 Ga0495601_0037885 3300053077 Bacteria 3014
407 Ga0495601_0058957 3300053077 Bacteria 2433
408 Ga0495612_0008859 3300053078 Bacteria 4076
409 Ga0495655_0070294 3300053083 Bacteria 977
410 Ga0495619_0176446 3300053085 Bacteria 1478
411 Ga0495619_0407797 3300053085 Bacteria 938
412 Ga0500645_000075 3300053730 Bacteria 78736
413 Ga0501084_0013503 3300054114 Bacteria 6759
414 Ga0501082_0027263 3300060353 Bacteria 4919
415 Ga0466962_0084125 3300061719 Bacteria 1522
416 Ga0530510_0117686 3300061734 Bacteria 1949
417 2508674091 2508501039 Bacteria 9978592
418 2548697922 2547132424 Bacteria 8348532
419 2552109590 2551306166 Bacteria 9731570
420 2644017958 2643221601 Bacteria 7493239
421 2644180754 2643221631 Bacteria 8168043
422 2644444900 2643221679 Bacteria 3839507
423 2644513071 2643221692 Bacteria 7282860
424 2645725371 2643221962 Bacteria 3874254
425 2689960108 2687453737 Bacteria 11203906
426 2739203234 2738543005 Bacteria 5278128
427 2739239694 2738543011 Bacteria 5731169
428 2753038336 2751185725 Bacteria 5740550
429 2753326847 2751185792 Bacteria 5739090
430 2816423517 2816332119 Bacteria 8120218
431 2819698625 2818991463 Bacteria 7948711
432 2868093527 2868088558 Bacteria 7609351
433 2889300929 2889300758 Bacteria 5690814
434 2904771012 2904770941 Bacteria 5580202
435 2908815055 2908811453 Bacteria 5478616
436 2919424461 2919420072 Bacteria 5390363
437 2919436854 2919432681 Bacteria 5390474
438 2919715902 2919713450 Bacteria 7431245
439 2928142542 2928142448 Bacteria 5288925
440 2935391360 2935390628 Bacteria 7043367
441 2939744443 2939743619 Bacteria 5762299
442 2956939415 2956939328 Bacteria 3474458
443 3001122199 3001119090 Bacteria 3449530
444 3006428512 3006425503 Bacteria 6491253
445 3006486746 3006486233 Bacteria 8157040
446 8054474342 8054472261 Bacteria 7464355
447 8056058581 8056054917 Bacteria 5736694
448 Ga0070717_10234957
449 JGI24737J22298_10054851
450 rootH2_10078173
451 rootH2_10154633
452 rootL2_10064882
453 rootH1_10000259
454 Ga0070658_10273613
455 Ga0070658_10315635
456 Ga0070676_10090925
457 Ga0070676_10284737
458 Ga0070683_100349820
459 Ga0070683_101152881
460 Ga0070682_100138817
461 Ga0070682_100399074
462 Ga0068868_100280413
463 Ga0068868_100329627
464 Ga0068868_100555549
465 Ga0070661_100119207
466 Ga0070692_10205648
467 Ga0070668_100502719
468 Ga0070675_100094864
469 Ga0070671_100000412
470 Ga0070671_100141970
471 Ga0070674_100250145
472 Ga0070674_100443684
473 Ga0070674_100470224
474 Ga0070659_100024271
475 Ga0070659_100275667
476 Ga0070667_100000063
477 Ga0070667_100066231
478 Ga0070667_100248145
479 Ga0070667_100343974
480 Ga0070714_100003703
481 Ga0070714_100202674
482 Ga0070714_100333367
483 Ga0070713_100065734
484 Ga0070710_10292177
485 Ga0070710_10340458
486 Ga0070663_100134044
487 Ga0070663_100165363
488 Ga0070663_100313277
489 Ga0070662_100200027
490 Ga0070681_10313913
491 Ga0068867_100093300
492 Ga0068867_100393851
493 Ga0070685_10065308
494 Ga0070698_100059764
495 Ga0070684_100308254
496 Ga0068853_100091299
497 Ga0070672_100372170
498 Ga0070696_100006628
499 Ga0070665_100099962
500 Ga0070665_100349692
501 Ga0068855_100102803
502 Ga0070664_100042117
503 Ga0068857_100268183
504 Ga0068854_100048597
505 Ga0068856_100498678
506 Ga0070702_100172161
507 Ga0068852_100634905
508 Ga0068859_100000777
509 Ga0068859_100000944
510 Ga0068859_100682276
511 Ga0068864_100661970
512 Ga0068866_10499300
513 Ga0068851_10052054
514 Ga0068851_10095684
515 Ga0068870_10356105
516 Ga0068863_100000159
517 Ga0068863_100000648
518 Ga0068863_100007113
519 Ga0068863_100035863
520 Ga0068858_100009162
521 Ga0068858_100051255
522 Ga0068858_100056127
523 Ga0068860_100000065
524 Ga0068862_100000028
525 Ga0068862_100583839
526 Ga0081540_1005051
527 Ga0070717_10205762
528 Ga0070717_10543512
529 Ga0075365_10091417
530 Ga0075364_10130295
531 Ga0075370_10117767
532 Ga0075428_100006048
533 Ga0075428_100293330
534 Ga0075430_100019963
535 Ga0097620_100000777
536 Ga0097620_100000944
537 Ga0097620_100016788
538 Ga0097620_100682290
539 Ga0099794_10239930
540 Ga0111539_10587084
541 Ga0111539_10885408
542 Ga0111539_11266795
543 Ga0105245_10172177
544 Ga0105245_10554059
545 Ga0105247_10254600
546 Ga0114129_10001766
547 Ga0105243_10017906
548 Ga0105243_10998772
549 Ga0105241_10118131
550 Ga0105242_10267051
551 Ga0105242_10632539
552 Ga0105248_10050782
553 Ga0105237_10351936
554 Ga0105237_10808241
555 Ga0105238_10979354
556 Ga0105249_10080852
557 Ga0105249_10108052
558 Ga0105249_11123445
559 Ga0105239_10454534
560 Ga0105239_10673605
561 Ga0105239_11197895
562 Ga0105246_10069559
563 Ga0105246_10526913
564 Ga0157369_10721866
565 Ga0157374_10922242
566 Ga0157374_11124584
567 Ga0157378_10205516
568 Ga0163162_11193323
569 Ga0157372_10634128
570 Ga0157375_10361858
571 Ga0163163_10567906
572 Ga0163163_10744957
573 Ga0163163_10834937
574 Ga0157377_10187800
575 Ga0157379_10001387
576 Ga0157379_10473616
577 Ga0206356_11257196
578 Ga0206354_10127114
579 Ga0206354_10547656
580 Ga0206354_11585944
581 Ga0206353_11490006
582 Ga0213876_10140919
583 Ga0224712_10001633
584 Ga0207656_10056297
585 Ga0207692_10191226
586 Ga0207710_10000014
587 Ga0207680_10083273
588 Ga0207647_10010162
589 Ga0207647_10029890
590 Ga0207645_10005431
591 Ga0207643_10022720
592 Ga0207705_10511636
593 Ga0207684_10040070
594 Ga0207654_10275731
595 Ga0207707_10153234
596 Ga0207671_10201562
597 Ga0207662_10077997
598 Ga0207657_10038410
599 Ga0207657_10165552
600 Ga0207646_10007353
601 Ga0207681_10008158
602 Ga0207681_10052825
603 Ga0207694_10280498
604 Ga0207700_10040749
605 Ga0207700_10759554
606 Ga0207664_10019741
607 Ga0207664_10021809
608 Ga0207644_10000973
609 Ga0207690_10397641
610 Ga0207706_10028187
611 Ga0207709_10018663
612 Ga0207711_10000373
613 Ga0207661_10212631
614 Ga0207661_10442651
615 Ga0207661_10614303
616 Ga0207661_11036715
617 Ga0207679_10853935
618 Ga0207712_10000020
619 Ga0207712_10156740
620 Ga0207640_10021935
621 Ga0207658_10002515
622 Ga0207658_10468518
623 Ga0207677_10362973
624 Ga0207677_10412387
625 Ga0207677_10422772
626 Ga0207678_10042928
627 Ga0207678_10209556
628 Ga0207678_10351524
629 Ga0207702_10519405
630 Ga0207702_10533345
631 Ga0207641_10000156
632 Ga0207641_10006370
633 Ga0207641_10010166
634 Ga0207641_10452737
635 Ga0207641_10563431
636 Ga0207648_10028113
637 Ga0207674_10140376
638 Ga0207674_10248874
639 Ga0207674_10271064
640 Ga0207674_10273547
641 Ga0207675_100096500
642 Ga0207683_10058309
643 Ga0207683_10119659
644 Ga0207683_10683255
645 Ga0207698_10174278
646 Ga0207698_10378080
647 Ga0207698_10525772
648 Ga0207428_10078385
649 Ga0268266_10021318
650 Ga0268265_10000004
651 Ga0268264_10000024
652 Ga0268264_10127816
653 Ga0268264_10628197
654 Ga0265319_1000773
655 Ga0265334_10005961
656 Ga0265318_10050946
657 Ga0265323_10005739
658 Ga0265322_10002763
659 Ga0265338_10000755
660 Ga0265338_10002435
661 Ga0265338_10563380
662 Ga0265324_10000222
663 Ga0265324_10005107
664 Ga0316182_1326249
665 Ga0265332_10001370
666 Ga0265320_10031179
667 Ga0265320_10064379
668 Ga0265325_10027514
669 Ga0307513_10128345
670 Ga0307513_10297614
671 Ga0307516_10330947
672 Ga0307416_100541720
673 Ga0373926_0000330
674 Ga0373952_0032421
675 Ga0373932_0078812
676 Ga0373956_0003565
677 Ga0373935_0001562
678 Ga0373947_0000002
679 Ga0373947_0127998
680 Ga0316582_0123477
681 Ga0316584_0110382
682 Ga0451789_0149872
683 Ga0451789_0935306
684 Ga0451793_0586671
685 Ga0439449_0041648
686 Ga0439444_0042162
687 Ga0466969_0000386
688 Ga0466969_0044445
689 Ga0466965_0035620
690 Ga0466965_0047415
691 Ga0466966_0106717
692 Ga0466961_0015101
693 Ga0466963_0124736
694 Ga0466963_0187707
695 Ga0466963_0405643
696 Ga0466971_0002410
697 Ga0466970_0149293
698 Ga0466957_0014665
699 Ga0466957_0057863
700 Ga0466957_0172952
701 Ga0466957_0301215
702 Ga0466960_0000108
703 Ga0466960_0014121
704 Ga0466959_0001180
705 Ga0466959_0224221
706 Ga0466959_0312294
707 Ga0466959_0328691
708 Ga0466959_0454727
709 Ga0466958_0114096
710 Ga0466958_0117484
711 Ga0466967_0028784
712 Ga0466967_0085802
713 Ga0466967_0096688
714 Ga0466967_0215740
715 Ga0466967_0278964
716 Ga0495592_0009158
717 Ga0495603_0029187
718 Ga0495651_0100043
719 Ga0495653_0067394
720 Ga0495653_0128051
721 Ga0495580_0174055
722 Ga0495664_0008865
723 Ga0495608_0007435
724 Ga0495628_0010260
725 Ga0495666_0049966
726 Ga0495652_0001620
727 Ga0495665_0008244
728 Ga0495640_0053358
729 Ga0495597_0147059
730 Ga0495667_0056514
731 Ga0495667_0369029
732 Ga0495634_0132515
733 Ga0495634_0167054
734 Ga0495625_0119933
735 Ga0495635_0004216
736 Ga0495657_0039313
737 Ga0495599_0120302
738 Ga0495623_0159350
739 Ga0495646_0123080
740 Ga0495646_0236636
741 Ga0495613_0002970
742 Ga0495624_0091791
743 Ga0495600_0038112
744 Ga0495600_0119978
745 Ga0495581_0088263
746 Ga0495604_0016869
747 Ga0495604_0244591
748 Ga0495676_0339906
749 Ga0495680_0152605
750 Ga0495683_0002207
751 Ga0495675_0004200
752 Ga0495675_0016253
753 Ga0495684_0049796
754 Ga0495593_0027202
755 Ga0495602_0150691
756 Ga0496100_0077030
757 Ga0496100_0083631
758 Ga0496100_0474858
759 Ga0496101_0003689
760 Ga0496101_0359974
761 Ga0496101_0362901
762 Ga0496102_0000042
763 Ga0496102_0000164
764 Ga0496103_0000063
765 Ga0496103_0000194
766 Ga0496104_0038838
767 Ga0496104_0481239
768 Ga0496104_0909601
769 Ga0496105_0026455
770 Ga0496107_0233890
771 Ga0496107_0438060
772 Ga0496108_0135393
773 Ga0496109_0281969
774 Ga0496109_0444941
775 Ga0496109_0567241
776 Ga0496109_0855132
777 Ga0496110_0207856
778 Ga0496113_0303403
779 Ga0496114_0242584
780 Ga0496114_0668389
781 Ga0496116_0024448
782 Ga0496117_0000261
783 Ga0496118_0000241
784 Ga0496118_0006546
785 Ga0496118_0161118
786 Ga0496119_0000210
787 Ga0496119_0039783
788 Ga0496120_0019006
789 Ga0496121_0068582
790 Ga0496121_0092923
791 Ga0496123_0219412
792 Ga0496126_0000255
793 Ga0496126_0021449
794 Ga0501031_0006742
795 Ga0501031_0295865
796 Ga0501031_0366968
797 Ga0501032_0019953
798 Ga0501032_0022091
799 Ga0501033_0039913
800 Ga0501034_0059273
801 Ga0501034_0117469
802 Ga0501036_0002429
803 Ga0501037_0001974
804 Ga0501037_0153102
805 Ga0501038_0013929
806 Ga0501039_0016960
807 Ga0501040_0011494
808 Ga0501041_0003738
809 Ga0501042_0102903
810 Ga0501043_0000682
811 Ga0501043_0081667
812 Ga0501046_0032542
813 Ga0501046_0077015
814 Ga0501047_0000031
815 Ga0501047_0000947
816 Ga0501047_0001051
817 Ga0501047_0008300
818 Ga0501048_0000085
819 Ga0501048_0093600
820 Ga0501048_0338400
821 Ga0501067_0001352
822 Ga0501067_0042268
823 Ga0501068_0019476
824 Ga0501069_0020661
825 Ga0501070_0012956
826 Ga0501070_0020999
827 Ga0501070_0124903
828 Ga0501071_0001160
829 Ga0501072_0010818
830 Ga0501073_0039289
831 Ga0501074_0031695
832 Ga0501074_0129179
833 Ga0501076_0003071
834 Ga0501077_0041741
835 Ga0501079_0006331
836 Ga0501080_0032629
837 Ga0501083_0003083
838 Ga0501035_0013124
839 Ga0501044_0012529
840 Ga0501044_0046879
841 Ga0501044_0463456
842 Ga0501045_0004098
843 nmdc:mga00v17_114444_c1
844 nmdc:mga0yw44_75362_c1
845 nmdc:mga07m45_115896_c1
846 nmdc:mga05p37_554887_c1
847 nmdc:mga09592_40051_c1
848 nmdc:mga0qj67_5984_c1
849 nmdc:mga06r32_97529_c1
850 nmdc:mga08y16_195828_c1
851 nmdc:mga08y16_277452_c1
852 Ga0495601_0004422
853 Ga0495601_0037885
854 Ga0495601_0058957
855 Ga0495612_0008859
856 Ga0495655_0070294
857 Ga0495619_0176446
858 Ga0495619_0407797
859 Ga0500645_000075
860 Ga0501084_0013503
861 Ga0501082_0027263
862 Ga0466962_0084125
863 Ga0530510_0117686
864 2508674091
865 2548697922
866 2552109590
867 2644017958
868 2644180754
869 2644444900
870 2644513071
871 2645725371
872 2689960108
873 2739203234
874 2739239694
875 2753038336
876 2753326847
877 2816423517
878 2819698625
879 2868093527
880 2889300929
881 2904771012
882 2908815055
883 2919424461
884 2919436854
885 2919715902
886 2928142542
887 2935391360
888 2939744443
889 2956939415
890 3001122199
891 3006428512
892 3006486746
893 8054474342
894 8056058581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

51

214

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i6d-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-hydroxy-2,4(1h,3h)-pyrimidinedione, form vi 0.9552 3 222
8i63-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with barbituric acid, form iii 0.9317 3 222
3tr7-assembly1.cif.gz_A structure of a uracil-dna glycosylase (ung) from coxiella burnetii 0.9246 11 222
8i63-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with barbituric acid, form iii 0.9236 3 222
1eug-assembly1.cif.gz_A crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited 0.9192 11 220
ID Description Score Start End Superfamily
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9546 2 222 3.40.470.10
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9464 2 222 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9117 5 222 3.40.470.10
af_Q1ZXM2_175_429_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.907 4 221 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8924 5 222 3.40.470.10
ID Description Score Start End GO Terms
AF-W1VK98-F1-model_v4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9813 88 222 GO:0004844
GO:0097510
AF-A0A251XHV8-F1-model_v4 Uracil-DNA glycosylase 0.9765 128 221 GO:0004844
GO:0097510
AF-A0A7K1A052-F1-model_v4 Uracil-DNA glycosylase (EC 3.2.2.27) 0.9731 101 222 GO:0004844
GO:0097510
AF-A0A7I8ANC8-F1-model_v4 deleted 0.9663 75 221
AF-A0A7J9YAY4-F1-model_v4 Uracil-DNA glycosylase (EC 3.2.2.27) 0.9647 1 222 GO:0004844
GO:0005737
GO:0097510

Map