F445887

General Info

Members Datasets Scaffolds Average Seq Length
447 223 447 89

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100986976|Ga0070673_1009869762
Length 88
Sequence MATEVCVHIDSITDIKPEGESVRRVREDRSKLGSLAYVSTVRDDSMLRQFAEQACVEAARASGHPVIASAEVGERWLYCYPDDAFAEY

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
194 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
195 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
200 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
201 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
204 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
209 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
210 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
211 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
212 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 4.25
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10184660 3300003316 Bacteria 1607
2 Ga0065712_10075630 3300005290 Bacteria 3821
3 Ga0065715_10365936 3300005293 Unclassified 920
4 Ga0065715_10990515 3300005293 Bacteria 548
5 Ga0065707_10114898 3300005295 Bacteria 2283
6 Ga0065707_10147827 3300005295 Bacteria 1690
7 Ga0070658_10095219 3300005327 Bacteria 2458
8 Ga0070690_100075831 3300005330 Bacteria 2192
9 Ga0070690_100178164 3300005330 Bacteria 1467
10 Ga0070690_100199227 3300005330 Bacteria 1392
11 Ga0070670_100005863 3300005331 Bacteria 10383
12 Ga0070670_100327072 3300005331 Bacteria 1344
13 Ga0070677_10258096 3300005333 Bacteria 868
14 Ga0070677_10613818 3300005333 Bacteria 604
15 Ga0068869_100021294 3300005334 Bacteria 4459
16 Ga0068869_100064219 3300005334 Bacteria 2700
17 Ga0068869_100190783 3300005334 Unclassified 1611
18 Ga0070666_10127472 3300005335 Bacteria 1767
19 Ga0070666_10155212 3300005335 Bacteria 1598
20 Ga0070680_100543970 3300005336 Bacteria 995
21 Ga0070680_100644179 3300005336 Unclassified 910
22 Ga0070689_100001677 3300005340 Bacteria 14142
23 Ga0070689_100333964 3300005340 Bacteria 1268
24 Ga0070691_10341462 3300005341 Unclassified 829
25 Ga0070687_100083494 3300005343 Bacteria 1749
26 Ga0070687_100220547 3300005343 Bacteria 1161
27 Ga0070687_100600041 3300005343 Bacteria 756
28 Ga0070661_100007860 3300005344 Bacteria 7362
29 Ga0070661_100325705 3300005344 Bacteria 1201
30 Ga0070661_100612272 3300005344 Unclassified 881
31 Ga0070661_101775000 3300005344 Unclassified 523
32 Ga0070692_10098800 3300005345 Bacteria 1597
33 Ga0070692_10702503 3300005345 Bacteria 681
34 Ga0070692_10852811 3300005345 Unclassified 626
35 Ga0070668_100038491 3300005347 Bacteria 3655
36 Ga0070668_100265106 3300005347 Bacteria 1430
37 Ga0070668_100458588 3300005347 Bacteria 1097
38 Ga0070668_101227131 3300005347 Bacteria 680
39 Ga0070669_100003009 3300005353 Bacteria 12139
40 Ga0070669_100013543 3300005353 Bacteria 5797
41 Ga0070669_100236427 3300005353 Bacteria 1450
42 Ga0070675_100000581 3300005354 Bacteria 25079
43 Ga0070671_100018896 3300005355 Bacteria 5602
44 Ga0070671_100675716 3300005355 Bacteria 895
45 Ga0070674_100076649 3300005356 Bacteria 2377
46 Ga0070674_100082355 3300005356 Bacteria 2302
47 Ga0070674_100414906 3300005356 Unclassified 1103
48 Ga0070674_102085638 3300005356 Bacteria 517
49 Ga0070673_100009576 3300005364 Bacteria 6510
50 Ga0070673_100037311 3300005364 Bacteria 3702
51 Ga0070673_100560093 3300005364 Bacteria 1039
52 Ga0070673_100986976 3300005364 Unclassified 784
53 Ga0070688_100016244 3300005365 Bacteria 4252
54 Ga0070688_100268346 3300005365 Bacteria 1222
55 Ga0070688_100639767 3300005365 Unclassified 818
56 Ga0070659_100400801 3300005366 Bacteria 1158
57 Ga0070667_100034154 3300005367 Bacteria 4253
58 Ga0070701_10032840 3300005438 Bacteria 2588
59 Ga0070701_10368431 3300005438 Bacteria 902
60 Ga0070705_100194304 3300005440 Bacteria 1386
61 Ga0070700_100055550 3300005441 Unclassified 2479
62 Ga0070700_100564822 3300005441 Unclassified 886
63 Ga0070700_101388592 3300005441 Bacteria 593
64 Ga0070694_100356191 3300005444 Unclassified 1135
65 Ga0070694_100799395 3300005444 Bacteria 773
66 Ga0070708_100042563 3300005445 Bacteria 3987
67 Ga0070663_102009222 3300005455 Bacteria 520
68 Ga0070678_100404997 3300005456 Bacteria 1186
69 Ga0070662_100049021 3300005457 Bacteria 3045
70 Ga0068867_100057517 3300005459 Bacteria 2880
71 Ga0068867_101166693 3300005459 Unclassified 706
72 Ga0068867_101660466 3300005459 Bacteria 598
73 Ga0070706_100008279 3300005467 Bacteria 9692
74 Ga0070707_100039383 3300005468 Bacteria 4517
75 Ga0070698_100134106 3300005471 Bacteria 2431
76 Ga0070698_100223853 3300005471 Bacteria 1814
77 Ga0070699_100045302 3300005518 Bacteria 3807
78 Ga0070699_100679811 3300005518 Unclassified 940
79 Ga0070699_100938214 3300005518 Unclassified 793
80 Ga0070684_100001825 3300005535 Bacteria 15598
81 Ga0070684_101253388 3300005535 Bacteria 698
82 Ga0070697_100518671 3300005536 Bacteria 1043
83 Ga0070697_100551222 3300005536 Bacteria 1011
84 Ga0070697_100911677 3300005536 Bacteria 780
85 Ga0070697_101977745 3300005536 Unclassified 522
86 Ga0068853_100478281 3300005539 Bacteria 1174
87 Ga0070672_100035347 3300005543 Bacteria 3798
88 Ga0070672_100174265 3300005543 Bacteria 1790
89 Ga0070672_100228527 3300005543 Bacteria 1562
90 Ga0070686_100031166 3300005544 Bacteria 3258
91 Ga0070686_100039149 3300005544 Bacteria 2952
92 Ga0070686_101186300 3300005544 Bacteria 634
93 Ga0070695_100242103 3300005545 Bacteria 1309
94 Ga0070696_100427825 3300005546 Unclassified 1041
95 Ga0070696_100477767 3300005546 Bacteria 988
96 Ga0070696_101050442 3300005546 Unclassified 683
97 Ga0070693_100435219 3300005547 Bacteria 917
98 Ga0070665_100780473 3300005548 Bacteria 968
99 Ga0070704_100738394 3300005549 Bacteria 876
100 Ga0070664_100002455 3300005564 Bacteria 14929
101 Ga0068857_100014904 3300005577 Bacteria 6780
102 Ga0068854_100443117 3300005578 Bacteria 1083
103 Ga0068854_101342561 3300005578 Unclassified 645
104 Ga0068856_100169409 3300005614 Bacteria 2196
105 Ga0070702_100004977 3300005615 Bacteria 6136
106 Ga0070702_100079183 3300005615 Bacteria 1963
107 Ga0070702_100136851 3300005615 Bacteria 1555
108 Ga0068859_100004037 3300005617 Bacteria 14965
109 Ga0068859_100076888 3300005617 Bacteria 3378
110 Ga0068859_100881185 3300005617 Bacteria 980
111 Ga0068859_102117879 3300005617 Bacteria 621
112 Ga0068864_101539104 3300005618 Unclassified 668
113 Ga0068866_10019016 3300005718 Bacteria 3118
114 Ga0068866_10057911 3300005718 Bacteria 1999
115 Ga0068866_10522648 3300005718 Bacteria 789
116 Ga0068861_100035653 3300005719 Bacteria 3686
117 Ga0068861_100162808 3300005719 Bacteria 1842
118 Ga0068861_100646452 3300005719 Bacteria 976
119 Ga0068870_10013060 3300005840 Bacteria 3893
120 Ga0068870_10217385 3300005840 Bacteria 1168
121 Ga0068870_10420447 3300005840 Bacteria 874
122 Ga0068870_10805465 3300005840 Unclassified 657
123 Ga0068863_100067911 3300005841 Unclassified 3372
124 Ga0068863_100098183 3300005841 Bacteria 2781
125 Ga0068858_100022837 3300005842 Bacteria 5835
126 Ga0068858_100438422 3300005842 Bacteria 1258
127 Ga0068858_100679898 3300005842 Bacteria 1001
128 Ga0068858_100872582 3300005842 Bacteria 879
129 Ga0068860_100023002 3300005843 Bacteria 6027
130 Ga0068862_100004536 3300005844 Bacteria 11708
131 Ga0068862_100006355 3300005844 Bacteria 9825
132 Ga0068862_100027991 3300005844 Bacteria 4746
133 Ga0068862_100248466 3300005844 Bacteria 1620
134 Ga0068862_100652000 3300005844 Bacteria 1015
135 Ga0068862_100886379 3300005844 Unclassified 876
136 Ga0068862_100916144 3300005844 Bacteria 862
137 Ga0081539_10348996 3300005985 Unclassified 622
138 Ga0070716_100089278 3300006173 Bacteria 1861
139 Ga0070712_100257888 3300006175 Bacteria 1396
140 Ga0075366_10551863 3300006195 Bacteria 713
141 Ga0097621_100177480 3300006237 Bacteria 1839
142 Ga0075428_100168993 3300006844 Bacteria 2371
143 Ga0075428_100304589 3300006844 Bacteria 1713
144 Ga0075430_100042601 3300006846 Bacteria 3839
145 Ga0075430_100302308 3300006846 Bacteria 1323
146 Ga0075430_100372216 3300006846 Unclassified 1179
147 Ga0075430_100596527 3300006846 Unclassified 911
148 Ga0075430_101297628 3300006846 Bacteria 599
149 Ga0075431_100238240 3300006847 Bacteria 1852
150 Ga0075433_10011834 3300006852 Bacteria 7028
151 Ga0075433_10044859 3300006852 Bacteria 3842
152 Ga0075433_10191309 3300006852 Bacteria 1820
153 Ga0075433_10588921 3300006852 Bacteria 977
154 Ga0075433_10910354 3300006852 Unclassified 767
155 Ga0075434_100049532 3300006871 Bacteria 4171
156 Ga0075434_100163089 3300006871 Unclassified 2248
157 Ga0075434_100635870 3300006871 Bacteria 1086
158 Ga0075434_101242394 3300006871 Bacteria 756
159 Ga0075429_100192648 3300006880 Unclassified 1786
160 Ga0068865_100029834 3300006881 Bacteria 3623
161 Ga0075436_100022101 3300006914 Bacteria 4369
162 Ga0075436_100164391 3300006914 Bacteria 1565
163 Ga0075436_100869986 3300006914 Bacteria 673
164 Ga0097620_100004037 3300006931 Bacteria 14965
165 Ga0097620_100076885 3300006931 Bacteria 3378
166 Ga0097620_100881049 3300006931 Bacteria 980
167 Ga0097620_102117844 3300006931 Bacteria 621
168 Ga0075435_100003579 3300007076 Bacteria 10554
169 Ga0075435_100723528 3300007076 Unclassified 865
170 Ga0111539_10032691 3300009094 Bacteria 6317
171 Ga0111539_10340698 3300009094 Bacteria 1745
172 Ga0111539_10882609 3300009094 Bacteria 1040
173 Ga0111539_12671231 3300009094 Bacteria 579
174 Ga0105245_10820341 3300009098 Bacteria 969
175 Ga0105247_10541994 3300009101 Bacteria 854
176 Ga0114129_10012072 3300009147 Bacteria 12294
177 Ga0114129_10154009 3300009147 Bacteria 3145
178 Ga0114129_10219561 3300009147 Bacteria 2565
179 Ga0114129_10289560 3300009147 Bacteria 2186
180 Ga0114129_10607654 3300009147 Bacteria 1416
181 Ga0114129_10649870 3300009147 Unclassified 1361
182 Ga0114129_10719932 3300009147 Bacteria 1281
183 Ga0105243_10014938 3300009148 Bacteria 5877
184 Ga0105243_10302806 3300009148 Bacteria 1449
185 Ga0105243_10351577 3300009148 Bacteria 1353
186 Ga0105241_10712681 3300009174 Bacteria 917
187 Ga0105242_10353212 3300009176 Bacteria 1358
188 Ga0105242_10636978 3300009176 Bacteria 1035
189 Ga0105242_11437654 3300009176 Bacteria 718
190 Ga0105248_10000636 3300009177 Bacteria 39914
191 Ga0105248_10004282 3300009177 Bacteria 15790
192 Ga0105248_10660667 3300009177 Bacteria 1179
193 Ga0105237_12023613 3300009545 Unclassified 585
194 Ga0105238_10606866 3300009551 Unclassified 1102
195 Ga0105238_12182735 3300009551 Bacteria 588
196 Ga0105249_10012608 3300009553 Bacteria 7453
197 Ga0105249_10049460 3300009553 Bacteria 3834
198 Ga0105249_10087890 3300009553 Bacteria 2901
199 Ga0105249_10174465 3300009553 Bacteria 2087
200 Ga0105249_10330768 3300009553 Bacteria 1537
201 Ga0105249_10407805 3300009553 Bacteria 1390
202 Ga0105239_11918015 3300010375 Bacteria 687
203 Ga0105246_11189012 3300011119 Unclassified 701
204 Ga0157374_10951378 3300013296 Bacteria 877
205 Ga0157378_10126023 3300013297 Unclassified 2365
206 Ga0157378_10702119 3300013297 Bacteria 1031
207 Ga0157378_11000734 3300013297 Bacteria 870
208 Ga0163162_10031072 3300013306 Bacteria 5295
209 Ga0163162_10068330 3300013306 Unclassified 3605
210 Ga0163162_10706859 3300013306 Bacteria 1129
211 Ga0163162_10835794 3300013306 Bacteria 1037
212 Ga0157372_11215909 3300013307 Bacteria 870
213 Ga0157375_10024708 3300013308 Bacteria 5566
214 Ga0157375_10053214 3300013308 Bacteria 3982
215 Ga0157375_10078796 3300013308 Bacteria 3329
216 Ga0157375_13472499 3300013308 Unclassified 525
217 Ga0163163_10015281 3300014325 Bacteria 7094
218 Ga0163163_11180384 3300014325 Unclassified 828
219 Ga0157380_10106559 3300014326 Bacteria 2346
220 Ga0157380_10171948 3300014326 Bacteria 1894
221 Ga0157380_10660047 3300014326 Bacteria 1045
222 Ga0157377_10034964 3300014745 Bacteria 2752
223 Ga0157379_10056778 3300014968 Unclassified 3498
224 Ga0157379_10105286 3300014968 Bacteria 2532
225 Ga0157376_10714153 3300014969 Bacteria 1009
226 Ga0163161_10360292 3300017792 Bacteria 1158
227 Ga0209050_1008842 3300025298 Bacteria 5280
228 Ga0207682_10105785 3300025893 Bacteria 1234
229 Ga0207642_10006499 3300025899 Bacteria 3892
230 Ga0207642_10068903 3300025899 Bacteria 1676
231 Ga0207710_10037373 3300025900 Bacteria 2144
232 Ga0207680_10357690 3300025903 Bacteria 1026
233 Ga0207643_10014204 3300025908 Bacteria 4324
234 Ga0207643_10047702 3300025908 Bacteria 2425
235 Ga0207643_10386346 3300025908 Bacteria 883
236 Ga0207705_10205297 3300025909 Bacteria 1493
237 Ga0207654_10350338 3300025911 Bacteria 1016
238 Ga0207654_10559554 3300025911 Bacteria 813
239 Ga0207707_10649061 3300025912 Bacteria 890
240 Ga0207671_10101181 3300025914 Bacteria 2183
241 Ga0207671_11217028 3300025914 Unclassified 589
242 Ga0207660_10233759 3300025917 Bacteria 1446
243 Ga0207660_11221840 3300025917 Unclassified 611
244 Ga0207662_10002852 3300025918 Bacteria 8745
245 Ga0207662_10183510 3300025918 Bacteria 1347
246 Ga0207662_10931495 3300025918 Bacteria 616
247 Ga0207649_10940280 3300025920 Bacteria 679
248 Ga0207649_11427787 3300025920 Bacteria 548
249 Ga0207681_10001608 3300025923 Bacteria 14557
250 Ga0207681_10183108 3300025923 Bacteria 1597
251 Ga0207681_10438775 3300025923 Bacteria 1060
252 Ga0207659_10424912 3300025926 Bacteria 1115
253 Ga0207687_11583829 3300025927 Bacteria 562
254 Ga0207644_10003773 3300025931 Bacteria 9817
255 Ga0207706_10398173 3300025933 Bacteria 1194
256 Ga0207709_10006618 3300025935 Bacteria 6502
257 Ga0207709_10137196 3300025935 Bacteria 1676
258 Ga0207709_10251868 3300025935 Bacteria 1290
259 Ga0207670_10014307 3300025936 Bacteria 4706
260 Ga0207670_11134213 3300025936 Bacteria 661
261 Ga0207669_10093276 3300025937 Bacteria 1967
262 Ga0207669_10686593 3300025937 Bacteria 840
263 Ga0207669_11337229 3300025937 Bacteria 609
264 Ga0207669_11396994 3300025937 Bacteria 596
265 Ga0207704_10046716 3300025938 Bacteria 2582
266 Ga0207691_10003671 3300025940 Bacteria 14895
267 Ga0207691_10047646 3300025940 Bacteria 3932
268 Ga0207691_10270404 3300025940 Bacteria 1463
269 Ga0207711_10015433 3300025941 Bacteria 6339
270 Ga0207711_10562045 3300025941 Bacteria 1064
271 Ga0207711_11058475 3300025941 Bacteria 751
272 Ga0207689_10002509 3300025942 Bacteria 17059
273 Ga0207689_10266886 3300025942 Unclassified 1417
274 Ga0207689_10874175 3300025942 Bacteria 759
275 Ga0207679_10013866 3300025945 Bacteria 5285
276 Ga0207651_10033514 3300025960 Bacteria 3314
277 Ga0207651_10684306 3300025960 Bacteria 902
278 Ga0207712_10009436 3300025961 Bacteria 6175
279 Ga0207712_10013013 3300025961 Bacteria 5329
280 Ga0207712_10573955 3300025961 Bacteria 973
281 Ga0207668_10003776 3300025972 Bacteria 8921
282 Ga0207668_10018942 3300025972 Bacteria 4340
283 Ga0207668_10236649 3300025972 Bacteria 1475
284 Ga0207668_10788890 3300025972 Bacteria 840
285 Ga0207668_11126838 3300025972 Bacteria 704
286 Ga0207668_11777854 3300025972 Bacteria 556
287 Ga0207658_10026169 3300025986 Bacteria 4088
288 Ga0207658_10581213 3300025986 Bacteria 1005
289 Ga0207677_10796711 3300026023 Unclassified 846
290 Ga0207703_10267290 3300026035 Bacteria 1548
291 Ga0207703_10425674 3300026035 Bacteria 1236
292 Ga0207703_10514423 3300026035 Bacteria 1125
293 Ga0207703_10946136 3300026035 Bacteria 826
294 Ga0207639_10398820 3300026041 Bacteria 1239
295 Ga0207708_10020022 3300026075 Bacteria 5045
296 Ga0207708_10082794 3300026075 Bacteria 2467
297 Ga0207708_10404611 3300026075 Unclassified 1129
298 Ga0207708_10529073 3300026075 Bacteria 991
299 Ga0207708_11164483 3300026075 Unclassified 673
300 Ga0207702_10086249 3300026078 Bacteria 2737
301 Ga0207641_10074598 3300026088 Bacteria 2926
302 Ga0207641_10740733 3300026088 Bacteria 970
303 Ga0207641_12151105 3300026088 Bacteria 558
304 Ga0207648_10010171 3300026089 Bacteria 8946
305 Ga0207676_10010255 3300026095 Bacteria 6667
306 Ga0207674_10010706 3300026116 Bacteria 10357
307 Ga0207675_100000379 3300026118 Bacteria 42654
308 Ga0207675_100007555 3300026118 Bacteria 10270
309 Ga0207675_100014641 3300026118 Bacteria 7313
310 Ga0207675_100072075 3300026118 Bacteria 3231
311 Ga0207683_10046176 3300026121 Bacteria 3810
312 Ga0207683_10450055 3300026121 Unclassified 1187
313 Ga0207683_10606082 3300026121 Bacteria 1014
314 Ga0207698_10451074 3300026142 Bacteria 1242
315 Ga0207428_10275159 3300027907 Bacteria 1251
316 Ga0268266_10267102 3300028379 Bacteria 1587
317 Ga0268265_10004332 3300028380 Bacteria 9881
318 Ga0268265_10014122 3300028380 Bacteria 5443
319 Ga0268265_10015704 3300028380 Bacteria 5186
320 Ga0268265_10026087 3300028380 Bacteria 4154
321 Ga0268265_10175593 3300028380 Bacteria 1836
322 Ga0268265_10476244 3300028380 Unclassified 1171
323 Ga0268265_10737586 3300028380 Unclassified 955
324 Ga0268265_10871073 3300028380 Bacteria 882
325 Ga0268264_10160808 3300028381 Bacteria 2023
326 Ga0268264_11478685 3300028381 Unclassified 690
327 Ga0307515_10773096 3300028794 Bacteria 581
328 Ga0307513_10695268 3300031456 Bacteria 723
329 Ga0307408_100009479 3300031548 Bacteria 6422
330 Ga0307408_100088952 3300031548 Bacteria 2327
331 Ga0307408_100146352 3300031548 Bacteria 1860
332 Ga0307405_10009652 3300031731 Bacteria 4956
333 Ga0307405_10128102 3300031731 Bacteria 1749
334 Ga0307405_10649690 3300031731 Bacteria 867
335 Ga0307413_10012240 3300031824 Bacteria 4262
336 Ga0307410_10005256 3300031852 Bacteria 6825
337 Ga0307410_10039742 3300031852 Unclassified 3091
338 Ga0307406_10011920 3300031901 Bacteria 4941
339 Ga0307406_10427349 3300031901 Bacteria 1057
340 Ga0307406_11076878 3300031901 Bacteria 693
341 Ga0307406_11915396 3300031901 Bacteria 529
342 Ga0307407_10001575 3300031903 Bacteria 8390
343 Ga0307412_10181258 3300031911 Bacteria 1584
344 Ga0307409_100001882 3300031995 Bacteria 10697
345 Ga0307416_100009444 3300032002 Bacteria 6385
346 Ga0307416_100035293 3300032002 Bacteria 3817
347 Ga0307416_100061350 3300032002 Bacteria 3068
348 Ga0307416_100924428 3300032002 Bacteria 973
349 Ga0307414_10166682 3300032004 Bacteria 1756
350 Ga0307414_10548552 3300032004 Unclassified 1030
351 Ga0307411_10095695 3300032005 Bacteria 2085
352 Ga0307411_11325592 3300032005 Bacteria 656
353 Ga0307415_100056336 3300032126 Unclassified 2694
354 Ga0307415_101249806 3300032126 Bacteria 701
355 Ga0373958_0207339 3300034819 Unclassified 516
356 Ga0373951_0096050 3300035091 Bacteria 783
357 Ga0373932_0288076 3300035112 Bacteria 609
358 Ga0373941_0244790 3300035115 Bacteria 698
359 Ga0373960_0002196 3300035121 Bacteria 4387
360 Ga0373960_0126235 3300035121 Unclassified 854
361 Ga0373961_0023908 3300035241 Bacteria 1648
362 Ga0373962_0112976 3300035242 Bacteria 859
363 Ga0373931_0076294 3300035691 Bacteria 1841
364 Ga0242420_000748 3300038996 Bacteria 3911
365 Ga0439453_0071279 3300041408 Bacteria 735
366 Ga0439442_055383 3300042002 Bacteria 838
367 Ga0439448_0099831 3300042005 Bacteria 986
368 Ga0439455_0017839 3300042012 Bacteria 1659
369 Ga0450896_002793 3300042133 Bacteria 2279
370 Ga0439444_0150970 3300042437 Bacteria 561
371 Ga0451576_0106963 3300045051 Bacteria 2910
372 Ga0451576_0972393 3300045051 Bacteria 890
373 Ga0495582_0863179 3300046473 Unclassified 523
374 Ga0495586_0299005 3300046535 Bacteria 922
375 Ga0495598_0038062 3300046537 Bacteria 1391
376 Ga0495621_0119827 3300046539 Bacteria 1016
377 Ga0496101_0080332 3300048904 Bacteria 2409
378 Ga0496101_0569208 3300048904 Bacteria 896
379 Ga0496102_0117853 3300048905 Bacteria 2478
380 Ga0496103_0597515 3300048906 Unclassified 703
381 Ga0496104_0143262 3300048907 Bacteria 2296
382 Ga0496104_0918471 3300048907 Bacteria 780
383 Ga0496105_0178423 3300048908 Bacteria 1740
384 Ga0496106_0149159 3300048909 Bacteria 1844
385 Ga0496106_0172690 3300048909 Bacteria 1714
386 Ga0496106_1212467 3300048909 Bacteria 588
387 Ga0496107_0186255 3300048910 Bacteria 1542
388 Ga0496107_0871744 3300048910 Bacteria 657
389 Ga0496108_0255943 3300048911 Bacteria 1523
390 Ga0496108_0954302 3300048911 Bacteria 734
391 Ga0496109_0076344 3300048912 Bacteria 3082
392 Ga0496110_0132355 3300048913 Bacteria 2252
393 Ga0496110_0165158 3300048913 Bacteria 2008
394 Ga0496110_0188430 3300048913 Bacteria 1873
395 Ga0496113_0171390 3300048916 Bacteria 1719
396 Ga0501293_013273 3300049516 Bacteria 738
397 Ga0501297_054392 3300049520 Bacteria 597
398 Ga0501298_101013 3300049521 Bacteria 658
399 Ga0501048_0518675 3300049582 Bacteria 855
400 Ga0501067_0066297 3300049583 Bacteria 1998
401 Ga0501069_0108143 3300049585 Bacteria 1582
402 Ga0501198_077886 3300049649 Bacteria 637
403 Ga0501208_106656 3300049655 Unclassified 606
404 Ga0501217_168929 3300049661 Bacteria 664
405 Ga0501233_263418 3300049668 Bacteria 522
406 Ga0501239_005908 3300049672 Bacteria 1244
407 Ga0501246_023002 3300049676 Bacteria 657
408 Ga0501249_005737 3300049679 Bacteria 2537
409 Ga0501249_069116 3300049679 Unclassified 824
410 Ga0501249_105372 3300049679 Unclassified 678
411 Ga0501253_162470 3300049683 Unclassified 570
412 Ga0501257_131264 3300049686 Unclassified 678
413 Ga0501263_088308 3300049760 Unclassified 520
414 Ga0501268_089930 3300049765 Unclassified 645
415 Ga0501273_074201 3300049770 Unclassified 556
416 Ga0501280_089126 3300049776 Bacteria 579
417 Ga0501283_049400 3300049779 Bacteria 743
418 nmdc:mga0k408_754948_c1 3300050493 Bacteria 568
419 nmdc:mga05p37_235609_c1 3300050507 Bacteria 2203
420 nmdc:mga05p37_31967_c1 3300050507 Bacteria 6434
421 nmdc:mga05p37_40907_c1 3300050507 Bacteria 5691
422 nmdc:mga05p37_515828_c1 3300050507 Bacteria 1368
423 nmdc:mga05p37_693288_c1 3300050507 Bacteria 1133
424 nmdc:mga05p37_796716_c1 3300050507 Bacteria 1034
425 nmdc:mga09592_183753_c1 3300050508 Unclassified 1809
426 nmdc:mga0qj67_194579_c1 3300050509 Unclassified 1648
427 nmdc:mga0qj67_25434_c1 3300050509 Bacteria 4574
428 nmdc:mga0qj67_984837_c1 3300050509 Unclassified 662
429 nmdc:mga06r32_841124_c1 3300050510 Unclassified 877
430 nmdc:mga06r32_898479_c1 3300050510 Bacteria 842
431 nmdc:mga08y16_489595_c1 3300050511 Bacteria 1251
432 nmdc:mga08y16_522698_c1 3300050511 Bacteria 1203
433 nmdc:mga08y16_742010_c1 3300050511 Bacteria 978
434 nmdc:mga08y16_97571_c1 3300050511 Bacteria 3060
435 nmdc:mga0n895_118993_c1 3300050512 Bacteria 2662
436 nmdc:mga0n895_31600_c1 3300050512 Bacteria 5072
437 nmdc:mga0n895_834550_c1 3300050512 Unclassified 910
438 nmdc:mga0n895_843479_c1 3300050512 Bacteria 905
439 nmdc:mga0rr50_20375_c1 3300050513 Bacteria 4502
440 nmdc:mga0rr50_687571_c1 3300050513 Unclassified 873
441 nmdc:mga08x19_11955_c1 3300050514 Bacteria 5224
442 nmdc:mga0a205_13493_c1 3300050515 Bacteria 7608
443 nmdc:mga0a205_25168_c1 3300050515 Bacteria 5667
444 nmdc:mga0a205_26017_c1 3300050515 Bacteria 5575
445 nmdc:mga0a205_579678_c1 3300050515 Bacteria 976
446 nmdc:mga0a205_782444_c1 3300050515 Unclassified 802
447 Ga0500622_0000020 3300053156 Bacteria 271239

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_100986976 Ga0070673_1009869762 81
2 3300005518 Ga0070699_100938214 Ga0070699_1009382142 86
3 3300009551 Ga0105238_10606866 Ga0105238_106068662 86
4 3300005293 Ga0065715_10365936 Ga0065715_103659362 87
5 3300005445 Ga0070708_100042563 Ga0070708_1000425632 87
6 3300005467 Ga0070706_100008279 Ga0070706_1000082798 87
7 3300005468 Ga0070707_100039383 Ga0070707_1000393832 87
8 3300005518 Ga0070699_100679811 Ga0070699_1006798112 87
9 3300006846 Ga0075430_100372216 Ga0075430_1003722162 87
10 3300025918 Ga0207662_10183510 Ga0207662_101835102 87
11 3300025972 Ga0207668_10018942 Ga0207668_100189424 87
12 3300005327 Ga0070658_10095219 Ga0070658_100952192 88
13 3300005330 Ga0070690_100075831 Ga0070690_1000758314 88
14 3300005330 Ga0070690_100178164 Ga0070690_1001781642 88
15 3300005330 Ga0070690_100199227 Ga0070690_1001992272 88
16 3300005333 Ga0070677_10613818 Ga0070677_106138181 88
17 3300005335 Ga0070666_10127472 Ga0070666_101274722 88
18 3300005336 Ga0070680_100644179 Ga0070680_1006441792 88
19 3300005341 Ga0070691_10341462 Ga0070691_103414622 88
20 3300005343 Ga0070687_100220547 Ga0070687_1002205472 88
21 3300005344 Ga0070661_100325705 Ga0070661_1003257052 88
22 3300005344 Ga0070661_101775000 Ga0070661_1017750001 88
23 3300005345 Ga0070692_10098800 Ga0070692_100988002 88
24 3300005345 Ga0070692_10852811 Ga0070692_108528112 88
25 3300005347 Ga0070668_100265106 Ga0070668_1002651062 88
26 3300005347 Ga0070668_100458588 Ga0070668_1004585882 88
27 3300005353 Ga0070669_100013543 Ga0070669_1000135436 88
28 3300005353 Ga0070669_100236427 Ga0070669_1002364271 88
29 3300005355 Ga0070671_100018896 Ga0070671_1000188962 88
30 3300005356 Ga0070674_100076649 Ga0070674_1000766492 88
31 3300005356 Ga0070674_102085638 Ga0070674_1020856381 88
32 3300005364 Ga0070673_100560093 Ga0070673_1005600932 88
33 3300005365 Ga0070688_100639767 Ga0070688_1006397672 88
34 3300005366 Ga0070659_100400801 Ga0070659_1004008011 88
35 3300005438 Ga0070701_10368431 Ga0070701_103684312 88
36 3300005440 Ga0070705_100194304 Ga0070705_1001943042 88
37 3300005441 Ga0070700_100055550 Ga0070700_1000555502 88
38 3300005441 Ga0070700_101388592 Ga0070700_1013885921 88
39 3300005444 Ga0070694_100799395 Ga0070694_1007993952 88
40 3300005457 Ga0070662_100049021 Ga0070662_1000490212 88
41 3300005459 Ga0068867_100057517 Ga0068867_1000575172 88
42 3300005459 Ga0068867_101660466 Ga0068867_1016604662 88
43 3300005471 Ga0070698_100134106 Ga0070698_1001341062 88
44 3300005518 Ga0070699_100045302 Ga0070699_1000453023 88
45 3300005535 Ga0070684_101253388 Ga0070684_1012533881 88
46 3300005536 Ga0070697_100551222 Ga0070697_1005512221 88
47 3300005536 Ga0070697_100911677 Ga0070697_1009116772 88
48 3300005536 Ga0070697_101977745 Ga0070697_1019777451 88
49 3300005543 Ga0070672_100174265 Ga0070672_1001742652 88
50 3300005544 Ga0070686_100031166 Ga0070686_1000311665 88
51 3300005544 Ga0070686_101186300 Ga0070686_1011863001 88
52 3300005546 Ga0070696_100477767 Ga0070696_1004777671 88
53 3300005546 Ga0070696_101050442 Ga0070696_1010504421 88
54 3300005549 Ga0070704_100738394 Ga0070704_1007383941 88
55 3300005578 Ga0068854_100443117 Ga0068854_1004431173 88
56 3300005578 Ga0068854_101342561 Ga0068854_1013425611 88
57 3300005617 Ga0068859_100881185 Ga0068859_1008811852 88
58 3300005617 Ga0068859_102117879 Ga0068859_1021178792 88
59 3300005718 Ga0068866_10019016 Ga0068866_100190162 88
60 3300005719 Ga0068861_100646452 Ga0068861_1006464522 88
61 3300005840 Ga0068870_10420447 Ga0068870_104204471 88
62 3300005841 Ga0068863_100067911 Ga0068863_1000679113 88
63 3300005842 Ga0068858_100438422 Ga0068858_1004384222 88
64 3300005842 Ga0068858_100679898 Ga0068858_1006798982 88
65 3300005842 Ga0068858_100872582 Ga0068858_1008725821 88
66 3300005844 Ga0068862_100004536 Ga0068862_1000045365 88
67 3300005844 Ga0068862_100027991 Ga0068862_1000279913 88
68 3300005844 Ga0068862_100248466 Ga0068862_1002484662 88
69 3300005844 Ga0068862_100916144 Ga0068862_1009161442 88
70 3300006852 Ga0075433_10011834 Ga0075433_100118343 88
71 3300006852 Ga0075433_10044859 Ga0075433_100448594 88
72 3300006852 Ga0075433_10191309 Ga0075433_101913092 88
73 3300006852 Ga0075433_10588921 Ga0075433_105889212 88
74 3300006871 Ga0075434_100049532 Ga0075434_1000495323 88
75 3300006871 Ga0075434_100163089 Ga0075434_1001630892 88
76 3300006871 Ga0075434_100635870 Ga0075434_1006358702 88
77 3300006871 Ga0075434_101242394 Ga0075434_1012423942 88
78 3300006914 Ga0075436_100022101 Ga0075436_1000221012 88
79 3300006914 Ga0075436_100164391 Ga0075436_1001643912 88
80 3300006914 Ga0075436_100869986 Ga0075436_1008699861 88
81 3300006931 Ga0097620_100881049 Ga0097620_1008810492 88
82 3300006931 Ga0097620_102117844 Ga0097620_1021178442 88
83 3300007076 Ga0075435_100003579 Ga0075435_1000035792 88
84 3300007076 Ga0075435_100723528 Ga0075435_1007235281 88
85 3300009094 Ga0111539_10032691 Ga0111539_100326915 88
86 3300009094 Ga0111539_10882609 Ga0111539_108826092 88
87 3300009098 Ga0105245_10820341 Ga0105245_108203412 88
88 3300009101 Ga0105247_10541994 Ga0105247_105419942 88
89 3300009147 Ga0114129_10012072 Ga0114129_100120728 88
90 3300009147 Ga0114129_10154009 Ga0114129_101540094 88
91 3300009147 Ga0114129_10607654 Ga0114129_106076542 88
92 3300009147 Ga0114129_10719932 Ga0114129_107199322 88
93 3300009148 Ga0105243_10014938 Ga0105243_100149383 88
94 3300009176 Ga0105242_10353212 Ga0105242_103532122 88
95 3300009176 Ga0105242_11437654 Ga0105242_114376541 88
96 3300009177 Ga0105248_10660667 Ga0105248_106606672 88
97 3300009551 Ga0105238_12182735 Ga0105238_121827352 88
98 3300009553 Ga0105249_10174465 Ga0105249_101744651 88
99 3300009553 Ga0105249_10330768 Ga0105249_103307682 88
100 3300009553 Ga0105249_10407805 Ga0105249_104078051 88
101 3300011119 Ga0105246_11189012 Ga0105246_111890122 88
102 3300013297 Ga0157378_10126023 Ga0157378_101260232 88
103 3300013308 Ga0157375_10024708 Ga0157375_100247085 88
104 3300013308 Ga0157375_10078796 Ga0157375_100787964 88
105 3300013308 Ga0157375_13472499 Ga0157375_134724991 88
106 3300014326 Ga0157380_10106559 Ga0157380_101065592 88
107 3300014326 Ga0157380_10660047 Ga0157380_106600472 88
108 3300014969 Ga0157376_10714153 Ga0157376_107141532 88
109 3300017792 Ga0163161_10360292 Ga0163161_103602922 88
110 3300025899 Ga0207642_10006499 Ga0207642_100064992 88
111 3300025900 Ga0207710_10037373 Ga0207710_100373732 88
112 3300025908 Ga0207643_10386346 Ga0207643_103863462 88
113 3300025909 Ga0207705_10205297 Ga0207705_102052972 88
114 3300025917 Ga0207660_11221840 Ga0207660_112218402 88
115 3300025918 Ga0207662_10931495 Ga0207662_109314951 88
116 3300025920 Ga0207649_10940280 Ga0207649_109402802 88
117 3300025920 Ga0207649_11427787 Ga0207649_114277872 88
118 3300025923 Ga0207681_10438775 Ga0207681_104387752 88
119 3300025927 Ga0207687_11583829 Ga0207687_115838291 88
120 3300025935 Ga0207709_10006618 Ga0207709_100066184 88
121 3300025936 Ga0207670_11134213 Ga0207670_111342132 88
122 3300025937 Ga0207669_11337229 Ga0207669_113372292 88
123 3300025937 Ga0207669_11396994 Ga0207669_113969941 88
124 3300025940 Ga0207691_10270404 Ga0207691_102704042 88
125 3300025941 Ga0207711_11058475 Ga0207711_110584751 88
126 3300025942 Ga0207689_10874175 Ga0207689_108741752 88
127 3300025960 Ga0207651_10684306 Ga0207651_106843061 88
128 3300025961 Ga0207712_10573955 Ga0207712_105739552 88
129 3300025972 Ga0207668_10236649 Ga0207668_102366492 88
130 3300025972 Ga0207668_10788890 Ga0207668_107888901 88
131 3300025972 Ga0207668_11126838 Ga0207668_111268382 88
132 3300025972 Ga0207668_11777854 Ga0207668_117778541 88
133 3300026035 Ga0207703_10267290 Ga0207703_102672902 88
134 3300026035 Ga0207703_10946136 Ga0207703_109461362 88
135 3300026075 Ga0207708_10082794 Ga0207708_100827942 88
136 3300026075 Ga0207708_10529073 Ga0207708_105290732 88
137 3300026088 Ga0207641_10074598 Ga0207641_100745982 88
138 3300026089 Ga0207648_10010171 Ga0207648_100101716 88
139 3300026118 Ga0207675_100014641 Ga0207675_1000146414 88
140 3300027907 Ga0207428_10275159 Ga0207428_102751592 88
141 3300028380 Ga0268265_10015704 Ga0268265_100157042 88
142 3300028380 Ga0268265_10026087 Ga0268265_100260875 88
143 3300028380 Ga0268265_10871073 Ga0268265_108710732 88
144 3300028381 Ga0268264_10160808 Ga0268264_101608082 88
145 3300028794 Ga0307515_10773096 Ga0307515_107730962 88
146 3300034819 Ga0373958_0207339 Ga0373958_0207339_178_444 88
147 3300035091 Ga0373951_0096050 Ga0373951_0096050_413_679 88
148 3300035121 Ga0373960_0126235 Ga0373960_0126235_385_651 88
149 3300035241 Ga0373961_0023908 Ga0373961_0023908_1018_1284 88
150 3300046539 Ga0495621_0119827 Ga0495621_0119827_735_1001 88
151 3300048904 Ga0496101_0569208 Ga0496101_0569208_270_536 88
152 3300048909 Ga0496106_1212467 Ga0496106_1212467_312_578 88
153 3300048913 Ga0496110_0188430 Ga0496110_0188430_997_1263 88
154 3300049582 Ga0501048_0518675 Ga0501048_0518675_539_805 88
155 3300050507 nmdc:mga05p37_235609_c1 nmdc:mga05p37_235609_c1_1872_2141 88
156 3300050507 nmdc:mga05p37_31967_c1 nmdc:mga05p37_31967_c1_47_313 88
157 3300050507 nmdc:mga05p37_515828_c1 nmdc:mga05p37_515828_c1_895_1161 88
158 3300050507 nmdc:mga05p37_693288_c1 nmdc:mga05p37_693288_c1_805_1071 88
159 3300050511 nmdc:mga08y16_489595_c1 nmdc:mga08y16_489595_c1_727_993 88
160 3300050511 nmdc:mga08y16_742010_c1 nmdc:mga08y16_742010_c1_562_828 88
161 3300050512 nmdc:mga0n895_118993_c1 nmdc:mga0n895_118993_c1_324_590 88
162 3300050512 nmdc:mga0n895_31600_c1 nmdc:mga0n895_31600_c1_4641_4907 88
163 3300050512 nmdc:mga0n895_834550_c1 nmdc:mga0n895_834550_c1_436_702 88
164 3300050512 nmdc:mga0n895_843479_c1 nmdc:mga0n895_843479_c1_152_418 88
165 3300050513 nmdc:mga0rr50_20375_c1 nmdc:mga0rr50_20375_c1_4028_4294 88
166 3300050513 nmdc:mga0rr50_687571_c1 nmdc:mga0rr50_687571_c1_49_318 88
167 3300050514 nmdc:mga08x19_11955_c1 nmdc:mga08x19_11955_c1_4761_5027 88
168 3300050515 nmdc:mga0a205_13493_c1 nmdc:mga0a205_13493_c1_2203_2469 88
169 3300050515 nmdc:mga0a205_25168_c1 nmdc:mga0a205_25168_c1_5132_5398 88
170 3300050515 nmdc:mga0a205_26017_c1 nmdc:mga0a205_26017_c1_1172_1438 88
171 3300050515 nmdc:mga0a205_579678_c1 nmdc:mga0a205_579678_c1_507_773 88
172 3300003316 rootH1_10184660 rootH1_101846602 89
173 3300005290 Ga0065712_10075630 Ga0065712_100756304 89
174 3300005293 Ga0065715_10990515 Ga0065715_109905152 89
175 3300005295 Ga0065707_10114898 Ga0065707_101148981 89
176 3300005295 Ga0065707_10147827 Ga0065707_101478273 89
177 3300005331 Ga0070670_100005863 Ga0070670_1000058631 89
178 3300005331 Ga0070670_100327072 Ga0070670_1003270722 89
179 3300005333 Ga0070677_10258096 Ga0070677_102580962 89
180 3300005334 Ga0068869_100021294 Ga0068869_1000212944 89
181 3300005334 Ga0068869_100064219 Ga0068869_1000642191 89
182 3300005334 Ga0068869_100190783 Ga0068869_1001907832 89
183 3300005335 Ga0070666_10155212 Ga0070666_101552122 89
184 3300005336 Ga0070680_100543970 Ga0070680_1005439702 89
185 3300005340 Ga0070689_100001677 Ga0070689_1000016775 89
186 3300005340 Ga0070689_100333964 Ga0070689_1003339642 89
187 3300005343 Ga0070687_100083494 Ga0070687_1000834943 89
188 3300005343 Ga0070687_100600041 Ga0070687_1006000411 89
189 3300005344 Ga0070661_100007860 Ga0070661_1000078608 89
190 3300005344 Ga0070661_100612272 Ga0070661_1006122722 89
191 3300005345 Ga0070692_10702503 Ga0070692_107025032 89
192 3300005347 Ga0070668_100038491 Ga0070668_1000384912 89
193 3300005347 Ga0070668_101227131 Ga0070668_1012271311 89
194 3300005353 Ga0070669_100003009 Ga0070669_10000300912 89
195 3300005354 Ga0070675_100000581 Ga0070675_10000058125 89
196 3300005355 Ga0070671_100675716 Ga0070671_1006757162 89
197 3300005356 Ga0070674_100082355 Ga0070674_1000823552 89
198 3300005356 Ga0070674_100414906 Ga0070674_1004149062 89
199 3300005364 Ga0070673_100009576 Ga0070673_1000095763 89
200 3300005364 Ga0070673_100037311 Ga0070673_1000373112 89
201 3300005365 Ga0070688_100016244 Ga0070688_1000162443 89
202 3300005365 Ga0070688_100268346 Ga0070688_1002683462 89
203 3300005367 Ga0070667_100034154 Ga0070667_1000341543 89
204 3300005438 Ga0070701_10032840 Ga0070701_100328403 89
205 3300005441 Ga0070700_100564822 Ga0070700_1005648222 89
206 3300005444 Ga0070694_100356191 Ga0070694_1003561912 89
207 3300005455 Ga0070663_102009222 Ga0070663_1020092222 89
208 3300005456 Ga0070678_100404997 Ga0070678_1004049972 89
209 3300005459 Ga0068867_101166693 Ga0068867_1011666931 89
210 3300005471 Ga0070698_100223853 Ga0070698_1002238532 89
211 3300005535 Ga0070684_100001825 Ga0070684_1000018259 89
212 3300005536 Ga0070697_100518671 Ga0070697_1005186712 89
213 3300005539 Ga0068853_100478281 Ga0068853_1004782813 89
214 3300005543 Ga0070672_100035347 Ga0070672_1000353472 89
215 3300005543 Ga0070672_100228527 Ga0070672_1002285272 89
216 3300005544 Ga0070686_100039149 Ga0070686_1000391492 89
217 3300005545 Ga0070695_100242103 Ga0070695_1002421032 89
218 3300005546 Ga0070696_100427825 Ga0070696_1004278251 89
219 3300005547 Ga0070693_100435219 Ga0070693_1004352192 89
220 3300005548 Ga0070665_100780473 Ga0070665_1007804732 89
221 3300005564 Ga0070664_100002455 Ga0070664_1000024556 89
222 3300005577 Ga0068857_100014904 Ga0068857_1000149043 89
223 3300005614 Ga0068856_100169409 Ga0068856_1001694092 89
224 3300005615 Ga0070702_100004977 Ga0070702_1000049773 89
225 3300005615 Ga0070702_100079183 Ga0070702_1000791831 89
226 3300005615 Ga0070702_100136851 Ga0070702_1001368512 89
227 3300005617 Ga0068859_100004037 Ga0068859_1000040373 89
228 3300005617 Ga0068859_100076888 Ga0068859_1000768885 89
229 3300005618 Ga0068864_101539104 Ga0068864_1015391042 89
230 3300005718 Ga0068866_10057911 Ga0068866_100579113 89
231 3300005718 Ga0068866_10522648 Ga0068866_105226482 89
232 3300005719 Ga0068861_100035653 Ga0068861_1000356534 89
233 3300005719 Ga0068861_100162808 Ga0068861_1001628082 89
234 3300005840 Ga0068870_10013060 Ga0068870_100130602 89
235 3300005840 Ga0068870_10217385 Ga0068870_102173852 89
236 3300005840 Ga0068870_10805465 Ga0068870_108054651 89
237 3300005841 Ga0068863_100098183 Ga0068863_1000981832 89
238 3300005842 Ga0068858_100022837 Ga0068858_1000228372 89
239 3300005843 Ga0068860_100023002 Ga0068860_1000230023 89
240 3300005844 Ga0068862_100006355 Ga0068862_1000063552 89
241 3300005844 Ga0068862_100652000 Ga0068862_1006520002 89
242 3300005844 Ga0068862_100886379 Ga0068862_1008863792 89
243 3300005985 Ga0081539_10348996 Ga0081539_103489962 89
244 3300006173 Ga0070716_100089278 Ga0070716_1000892782 89
245 3300006175 Ga0070712_100257888 Ga0070712_1002578882 89
246 3300006195 Ga0075366_10551863 Ga0075366_105518632 89
247 3300006237 Ga0097621_100177480 Ga0097621_1001774801 89
248 3300006844 Ga0075428_100168993 Ga0075428_1001689931 89
249 3300006844 Ga0075428_100304589 Ga0075428_1003045892 89
250 3300006846 Ga0075430_100042601 Ga0075430_1000426016 89
251 3300006846 Ga0075430_100302308 Ga0075430_1003023081 89
252 3300006846 Ga0075430_100596527 Ga0075430_1005965272 89
253 3300006846 Ga0075430_101297628 Ga0075430_1012976282 89
254 3300006847 Ga0075431_100238240 Ga0075431_1002382402 89
255 3300006852 Ga0075433_10910354 Ga0075433_109103541 89
256 3300006880 Ga0075429_100192648 Ga0075429_1001926482 89
257 3300006881 Ga0068865_100029834 Ga0068865_1000298343 89
258 3300006931 Ga0097620_100004037 Ga0097620_1000040373 89
259 3300006931 Ga0097620_100076885 Ga0097620_1000768852 89
260 3300009094 Ga0111539_10340698 Ga0111539_103406981 89
261 3300009094 Ga0111539_12671231 Ga0111539_126712311 89
262 3300009147 Ga0114129_10219561 Ga0114129_102195612 89
263 3300009147 Ga0114129_10289560 Ga0114129_102895602 89
264 3300009147 Ga0114129_10649870 Ga0114129_106498703 89
265 3300009148 Ga0105243_10302806 Ga0105243_103028062 89
266 3300009148 Ga0105243_10351577 Ga0105243_103515772 89
267 3300009174 Ga0105241_10712681 Ga0105241_107126812 89
268 3300009176 Ga0105242_10636978 Ga0105242_106369783 89
269 3300009177 Ga0105248_10000636 Ga0105248_1000063621 89
270 3300009177 Ga0105248_10004282 Ga0105248_100042826 89
271 3300009545 Ga0105237_12023613 Ga0105237_120236132 89
272 3300009553 Ga0105249_10012608 Ga0105249_100126083 89
273 3300009553 Ga0105249_10049460 Ga0105249_100494604 89
274 3300009553 Ga0105249_10087890 Ga0105249_100878904 89
275 3300010375 Ga0105239_11918015 Ga0105239_119180152 89
276 3300013296 Ga0157374_10951378 Ga0157374_109513782 89
277 3300013297 Ga0157378_10702119 Ga0157378_107021191 89
278 3300013297 Ga0157378_11000734 Ga0157378_110007342 89
279 3300013306 Ga0163162_10031072 Ga0163162_100310725 89
280 3300013306 Ga0163162_10068330 Ga0163162_100683304 89
281 3300013306 Ga0163162_10706859 Ga0163162_107068592 89
282 3300013306 Ga0163162_10835794 Ga0163162_108357942 89
283 3300013307 Ga0157372_11215909 Ga0157372_112159092 89
284 3300013308 Ga0157375_10053214 Ga0157375_100532143 89
285 3300014325 Ga0163163_10015281 Ga0163163_100152813 89
286 3300014325 Ga0163163_11180384 Ga0163163_111803841 89
287 3300014326 Ga0157380_10171948 Ga0157380_101719482 89
288 3300014745 Ga0157377_10034964 Ga0157377_100349642 89
289 3300014968 Ga0157379_10056778 Ga0157379_100567782 89
290 3300014968 Ga0157379_10105286 Ga0157379_101052863 89
291 3300025298 Ga0209050_1008842 Ga0209050_10088425 89
292 3300025893 Ga0207682_10105785 Ga0207682_101057852 89
293 3300025899 Ga0207642_10068903 Ga0207642_100689033 89
294 3300025903 Ga0207680_10357690 Ga0207680_103576902 89
295 3300025908 Ga0207643_10014204 Ga0207643_100142045 89
296 3300025908 Ga0207643_10047702 Ga0207643_100477023 89
297 3300025911 Ga0207654_10350338 Ga0207654_103503382 89
298 3300025911 Ga0207654_10559554 Ga0207654_105595541 89
299 3300025912 Ga0207707_10649061 Ga0207707_106490612 89
300 3300025914 Ga0207671_10101181 Ga0207671_101011813 89
301 3300025914 Ga0207671_11217028 Ga0207671_112170281 89
302 3300025917 Ga0207660_10233759 Ga0207660_102337592 89
303 3300025918 Ga0207662_10002852 Ga0207662_100028521 89
304 3300025923 Ga0207681_10001608 Ga0207681_100016082 89
305 3300025923 Ga0207681_10183108 Ga0207681_101831082 89
306 3300025926 Ga0207659_10424912 Ga0207659_104249122 89
307 3300025931 Ga0207644_10003773 Ga0207644_100037735 89
308 3300025933 Ga0207706_10398173 Ga0207706_103981732 89
309 3300025935 Ga0207709_10137196 Ga0207709_101371962 89
310 3300025935 Ga0207709_10251868 Ga0207709_102518683 89
311 3300025936 Ga0207670_10014307 Ga0207670_100143075 89
312 3300025937 Ga0207669_10093276 Ga0207669_100932763 89
313 3300025937 Ga0207669_10686593 Ga0207669_106865932 89
314 3300025938 Ga0207704_10046716 Ga0207704_100467163 89
315 3300025940 Ga0207691_10003671 Ga0207691_100036717 89
316 3300025940 Ga0207691_10047646 Ga0207691_100476463 89
317 3300025941 Ga0207711_10015433 Ga0207711_100154335 89
318 3300025941 Ga0207711_10562045 Ga0207711_105620452 89
319 3300025942 Ga0207689_10002509 Ga0207689_1000250916 89
320 3300025942 Ga0207689_10266886 Ga0207689_102668862 89
321 3300025945 Ga0207679_10013866 Ga0207679_100138662 89
322 3300025960 Ga0207651_10033514 Ga0207651_100335142 89
323 3300025961 Ga0207712_10009436 Ga0207712_100094365 89
324 3300025961 Ga0207712_10013013 Ga0207712_100130132 89
325 3300025972 Ga0207668_10003776 Ga0207668_100037764 89
326 3300025986 Ga0207658_10026169 Ga0207658_100261694 89
327 3300025986 Ga0207658_10581213 Ga0207658_105812132 89
328 3300026023 Ga0207677_10796711 Ga0207677_107967112 89
329 3300026035 Ga0207703_10425674 Ga0207703_104256742 89
330 3300026035 Ga0207703_10514423 Ga0207703_105144232 89
331 3300026041 Ga0207639_10398820 Ga0207639_103988203 89
332 3300026075 Ga0207708_10020022 Ga0207708_100200223 89
333 3300026075 Ga0207708_10404611 Ga0207708_104046112 89
334 3300026075 Ga0207708_11164483 Ga0207708_111644831 89
335 3300026078 Ga0207702_10086249 Ga0207702_100862492 89
336 3300026088 Ga0207641_10740733 Ga0207641_107407332 89
337 3300026088 Ga0207641_12151105 Ga0207641_121511052 89
338 3300026095 Ga0207676_10010255 Ga0207676_100102556 89
339 3300026116 Ga0207674_10010706 Ga0207674_100107063 89
340 3300026118 Ga0207675_100000379 Ga0207675_10000037931 89
341 3300026118 Ga0207675_100007555 Ga0207675_1000075558 89
342 3300026118 Ga0207675_100072075 Ga0207675_1000720752 89
343 3300026121 Ga0207683_10046176 Ga0207683_100461762 89
344 3300026121 Ga0207683_10450055 Ga0207683_104500552 89
345 3300026121 Ga0207683_10606082 Ga0207683_106060822 89
346 3300026142 Ga0207698_10451074 Ga0207698_104510742 89
347 3300028379 Ga0268266_10267102 Ga0268266_102671022 89
348 3300028380 Ga0268265_10004332 Ga0268265_1000433210 89
349 3300028380 Ga0268265_10014122 Ga0268265_100141225 89
350 3300028380 Ga0268265_10175593 Ga0268265_101755932 89
351 3300028380 Ga0268265_10476244 Ga0268265_104762443 89
352 3300028380 Ga0268265_10737586 Ga0268265_107375862 89
353 3300028381 Ga0268264_11478685 Ga0268264_114786851 89
354 3300031456 Ga0307513_10695268 Ga0307513_106952682 89
355 3300031548 Ga0307408_100009479 Ga0307408_1000094797 89
356 3300031548 Ga0307408_100088952 Ga0307408_1000889524 89
357 3300031548 Ga0307408_100146352 Ga0307408_1001463523 89
358 3300031731 Ga0307405_10009652 Ga0307405_100096522 89
359 3300031731 Ga0307405_10128102 Ga0307405_101281022 89
360 3300031731 Ga0307405_10649690 Ga0307405_106496902 89
361 3300031824 Ga0307413_10012240 Ga0307413_100122405 89
362 3300031852 Ga0307410_10005256 Ga0307410_100052565 89
363 3300031852 Ga0307410_10039742 Ga0307410_100397423 89
364 3300031901 Ga0307406_10011920 Ga0307406_100119205 89
365 3300031901 Ga0307406_10427349 Ga0307406_104273492 89
366 3300031901 Ga0307406_11076878 Ga0307406_110768782 89
367 3300031901 Ga0307406_11915396 Ga0307406_119153962 89
368 3300031903 Ga0307407_10001575 Ga0307407_100015756 89
369 3300031911 Ga0307412_10181258 Ga0307412_101812582 89
370 3300031995 Ga0307409_100001882 Ga0307409_1000018821 89
371 3300032002 Ga0307416_100009444 Ga0307416_1000094446 89
372 3300032002 Ga0307416_100035293 Ga0307416_1000352932 89
373 3300032002 Ga0307416_100061350 Ga0307416_1000613502 89
374 3300032002 Ga0307416_100924428 Ga0307416_1009244282 89
375 3300032004 Ga0307414_10166682 Ga0307414_101666823 89
376 3300032004 Ga0307414_10548552 Ga0307414_105485522 89
377 3300032005 Ga0307411_10095695 Ga0307411_100956952 89
378 3300032005 Ga0307411_11325592 Ga0307411_113255922 89
379 3300032126 Ga0307415_100056336 Ga0307415_1000563362 89
380 3300032126 Ga0307415_101249806 Ga0307415_1012498062 89
381 3300035112 Ga0373932_0288076 Ga0373932_0288076_224_493 89
382 3300035115 Ga0373941_0244790 Ga0373941_0244790_347_616 89
383 3300035121 Ga0373960_0002196 Ga0373960_0002196_2845_3117 89
384 3300035242 Ga0373962_0112976 Ga0373962_0112976_556_825 89
385 3300035691 Ga0373931_0076294 Ga0373931_0076294_1364_1633 89
386 3300038996 Ga0242420_000748 Ga0242420_000748_2365_2634 89
387 3300041408 Ga0439453_0071279 Ga0439453_0071279_197_469 89
388 3300042002 Ga0439442_055383 Ga0439442_055383_108_377 89
389 3300042005 Ga0439448_0099831 Ga0439448_0099831_691_960 89
390 3300042012 Ga0439455_0017839 Ga0439455_0017839_1077_1346 89
391 3300042133 Ga0450896_002793 Ga0450896_002793_255_524 89
392 3300042437 Ga0439444_0150970 Ga0439444_0150970_203_487 89
393 3300045051 Ga0451576_0106963 Ga0451576_0106963_1952_2221 89
394 3300045051 Ga0451576_0972393 Ga0451576_0972393_327_602 89
395 3300046473 Ga0495582_0863179 Ga0495582_0863179_58_327 89
396 3300046535 Ga0495586_0299005 Ga0495586_0299005_40_309 89
397 3300046537 Ga0495598_0038062 Ga0495598_0038062_206_478 89
398 3300048904 Ga0496101_0080332 Ga0496101_0080332_537_806 89
399 3300048905 Ga0496102_0117853 Ga0496102_0117853_1339_1608 89
400 3300048906 Ga0496103_0597515 Ga0496103_0597515_193_462 89
401 3300048907 Ga0496104_0143262 Ga0496104_0143262_875_1144 89
402 3300048907 Ga0496104_0918471 Ga0496104_0918471_490_759 89
403 3300048908 Ga0496105_0178423 Ga0496105_0178423_242_511 89
404 3300048909 Ga0496106_0149159 Ga0496106_0149159_129_398 89
405 3300048909 Ga0496106_0172690 Ga0496106_0172690_1148_1417 89
406 3300048910 Ga0496107_0186255 Ga0496107_0186255_336_605 89
407 3300048910 Ga0496107_0871744 Ga0496107_0871744_236_505 89
408 3300048911 Ga0496108_0255943 Ga0496108_0255943_206_475 89
409 3300048911 Ga0496108_0954302 Ga0496108_0954302_417_686 89
410 3300048912 Ga0496109_0076344 Ga0496109_0076344_497_766 89
411 3300048913 Ga0496110_0132355 Ga0496110_0132355_1160_1429 89
412 3300048913 Ga0496110_0165158 Ga0496110_0165158_328_597 89
413 3300048916 Ga0496113_0171390 Ga0496113_0171390_614_883 89
414 3300049516 Ga0501293_013273 Ga0501293_013273_33_347 89
415 3300049520 Ga0501297_054392 Ga0501297_054392_169_438 89
416 3300049521 Ga0501298_101013 Ga0501298_101013_201_515 89
417 3300049583 Ga0501067_0066297 Ga0501067_0066297_1138_1413 89
418 3300049585 Ga0501069_0108143 Ga0501069_0108143_602_877 89
419 3300049649 Ga0501198_077886 Ga0501198_077886_88_402 89
420 3300049655 Ga0501208_106656 Ga0501208_106656_103_372 89
421 3300049661 Ga0501217_168929 Ga0501217_168929_26_340 89
422 3300049668 Ga0501233_263418 Ga0501233_263418_147_416 89
423 3300049672 Ga0501239_005908 Ga0501239_005908_195_509 89
424 3300049676 Ga0501246_023002 Ga0501246_023002_314_628 89
425 3300049679 Ga0501249_005737 Ga0501249_005737_2048_2362 89
426 3300049679 Ga0501249_069116 Ga0501249_069116_496_765 89
427 3300049679 Ga0501249_105372 Ga0501249_105372_140_430 89
428 3300049683 Ga0501253_162470 Ga0501253_162470_109_423 89
429 3300049686 Ga0501257_131264 Ga0501257_131264_299_589 89
430 3300049760 Ga0501263_088308 Ga0501263_088308_111_425 89
431 3300049765 Ga0501268_089930 Ga0501268_089930_44_334 89
432 3300049770 Ga0501273_074201 Ga0501273_074201_139_429 89
433 3300049776 Ga0501280_089126 Ga0501280_089126_88_402 89
434 3300049779 Ga0501283_049400 Ga0501283_049400_196_510 89
435 3300050493 nmdc:mga0k408_754948_c1 nmdc:mga0k408_754948_c1_168_437 89
436 3300050507 nmdc:mga05p37_40907_c1 nmdc:mga05p37_40907_c1_2190_2462 89
437 3300050507 nmdc:mga05p37_796716_c1 nmdc:mga05p37_796716_c1_305_574 89
438 3300050508 nmdc:mga09592_183753_c1 nmdc:mga09592_183753_c1_561_833 89
439 3300050509 nmdc:mga0qj67_194579_c1 nmdc:mga0qj67_194579_c1_227_499 89
440 3300050509 nmdc:mga0qj67_25434_c1 nmdc:mga0qj67_25434_c1_1532_1801 89
441 3300050509 nmdc:mga0qj67_984837_c1 nmdc:mga0qj67_984837_c1_82_351 89
442 3300050510 nmdc:mga06r32_841124_c1 nmdc:mga06r32_841124_c1_533_805 89
443 3300050510 nmdc:mga06r32_898479_c1 nmdc:mga06r32_898479_c1_168_437 89
444 3300050511 nmdc:mga08y16_522698_c1 nmdc:mga08y16_522698_c1_159_428 89
445 3300050511 nmdc:mga08y16_97571_c1 nmdc:mga08y16_97571_c1_1442_1711 89
446 3300050515 nmdc:mga0a205_782444_c1 nmdc:mga0a205_782444_c1_474_743 89
447 3300053156 Ga0500622_0000020 Ga0500622_0000020_252871_253152 89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8854 5 88
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8222 5 88
4zux-assembly1.cif.gz_Z saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome 0.816 20 88
4fk5-assembly1.cif.gz_A structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module 0.8106 21 88
6aqr-assembly1.cif.gz_A saga dub module ubp8(c146a)/sgf11/sus1/sgf73 bound to monoubiquitin 0.8103 21 88
ID Description Score Start End Superfamily
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9027 35 87 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8854 5 88 3.30.40.10
af_A4IA95_233_330_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8777 22 89 3.30.40.10
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8731 20 87 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8705 22 86 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A2V5ZUY0-F1-model_v4 UBP-type domain-containing protein 0.9954 6 89 GO:0008270
AF-A0A1G9GPU1-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9953 2 89 GO:0008270
GO:0016787
AF-A0A2V6MP59-F1-model_v4 UBP-type domain-containing protein 0.9949 6 89 GO:0008270
AF-A0A538NRT0-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9924 22 89 GO:0008270
AF-A0A2G5KCF3-F1-model_v4 UBP-type domain-containing protein 0.9903 5 89 GO:0008270

Feature Viewer

pLDDT pTM Quality
90.26 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map