F445887
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 223 | 447 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_100986976|Ga0070673_1009869762 |
| Length | 88 |
| Sequence | MATEVCVHIDSITDIKPEGESVRRVREDRSKLGSLAYVSTVRDDSMLRQFAEQACVEAARASGHPVIASAEVGERWLYCYPDDAFAEY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 171 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 172 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 173 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 174 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 175 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 176 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 185 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 186 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 187 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 188 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 189 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 194 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 195 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 196 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 200 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 202 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 203 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 204 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 205 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 206 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 207 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 208 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 209 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 210 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 211 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 212 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 213 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 214 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.89 |
| Nodule | 0 |
| Rhizoplane | 4.25 |
| Rhizosphere | 94.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10184660 | 3300003316 | Bacteria | 1607 |
| 2 | Ga0065712_10075630 | 3300005290 | Bacteria | 3821 |
| 3 | Ga0065715_10365936 | 3300005293 | Unclassified | 920 |
| 4 | Ga0065715_10990515 | 3300005293 | Bacteria | 548 |
| 5 | Ga0065707_10114898 | 3300005295 | Bacteria | 2283 |
| 6 | Ga0065707_10147827 | 3300005295 | Bacteria | 1690 |
| 7 | Ga0070658_10095219 | 3300005327 | Bacteria | 2458 |
| 8 | Ga0070690_100075831 | 3300005330 | Bacteria | 2192 |
| 9 | Ga0070690_100178164 | 3300005330 | Bacteria | 1467 |
| 10 | Ga0070690_100199227 | 3300005330 | Bacteria | 1392 |
| 11 | Ga0070670_100005863 | 3300005331 | Bacteria | 10383 |
| 12 | Ga0070670_100327072 | 3300005331 | Bacteria | 1344 |
| 13 | Ga0070677_10258096 | 3300005333 | Bacteria | 868 |
| 14 | Ga0070677_10613818 | 3300005333 | Bacteria | 604 |
| 15 | Ga0068869_100021294 | 3300005334 | Bacteria | 4459 |
| 16 | Ga0068869_100064219 | 3300005334 | Bacteria | 2700 |
| 17 | Ga0068869_100190783 | 3300005334 | Unclassified | 1611 |
| 18 | Ga0070666_10127472 | 3300005335 | Bacteria | 1767 |
| 19 | Ga0070666_10155212 | 3300005335 | Bacteria | 1598 |
| 20 | Ga0070680_100543970 | 3300005336 | Bacteria | 995 |
| 21 | Ga0070680_100644179 | 3300005336 | Unclassified | 910 |
| 22 | Ga0070689_100001677 | 3300005340 | Bacteria | 14142 |
| 23 | Ga0070689_100333964 | 3300005340 | Bacteria | 1268 |
| 24 | Ga0070691_10341462 | 3300005341 | Unclassified | 829 |
| 25 | Ga0070687_100083494 | 3300005343 | Bacteria | 1749 |
| 26 | Ga0070687_100220547 | 3300005343 | Bacteria | 1161 |
| 27 | Ga0070687_100600041 | 3300005343 | Bacteria | 756 |
| 28 | Ga0070661_100007860 | 3300005344 | Bacteria | 7362 |
| 29 | Ga0070661_100325705 | 3300005344 | Bacteria | 1201 |
| 30 | Ga0070661_100612272 | 3300005344 | Unclassified | 881 |
| 31 | Ga0070661_101775000 | 3300005344 | Unclassified | 523 |
| 32 | Ga0070692_10098800 | 3300005345 | Bacteria | 1597 |
| 33 | Ga0070692_10702503 | 3300005345 | Bacteria | 681 |
| 34 | Ga0070692_10852811 | 3300005345 | Unclassified | 626 |
| 35 | Ga0070668_100038491 | 3300005347 | Bacteria | 3655 |
| 36 | Ga0070668_100265106 | 3300005347 | Bacteria | 1430 |
| 37 | Ga0070668_100458588 | 3300005347 | Bacteria | 1097 |
| 38 | Ga0070668_101227131 | 3300005347 | Bacteria | 680 |
| 39 | Ga0070669_100003009 | 3300005353 | Bacteria | 12139 |
| 40 | Ga0070669_100013543 | 3300005353 | Bacteria | 5797 |
| 41 | Ga0070669_100236427 | 3300005353 | Bacteria | 1450 |
| 42 | Ga0070675_100000581 | 3300005354 | Bacteria | 25079 |
| 43 | Ga0070671_100018896 | 3300005355 | Bacteria | 5602 |
| 44 | Ga0070671_100675716 | 3300005355 | Bacteria | 895 |
| 45 | Ga0070674_100076649 | 3300005356 | Bacteria | 2377 |
| 46 | Ga0070674_100082355 | 3300005356 | Bacteria | 2302 |
| 47 | Ga0070674_100414906 | 3300005356 | Unclassified | 1103 |
| 48 | Ga0070674_102085638 | 3300005356 | Bacteria | 517 |
| 49 | Ga0070673_100009576 | 3300005364 | Bacteria | 6510 |
| 50 | Ga0070673_100037311 | 3300005364 | Bacteria | 3702 |
| 51 | Ga0070673_100560093 | 3300005364 | Bacteria | 1039 |
| 52 | Ga0070673_100986976 | 3300005364 | Unclassified | 784 |
| 53 | Ga0070688_100016244 | 3300005365 | Bacteria | 4252 |
| 54 | Ga0070688_100268346 | 3300005365 | Bacteria | 1222 |
| 55 | Ga0070688_100639767 | 3300005365 | Unclassified | 818 |
| 56 | Ga0070659_100400801 | 3300005366 | Bacteria | 1158 |
| 57 | Ga0070667_100034154 | 3300005367 | Bacteria | 4253 |
| 58 | Ga0070701_10032840 | 3300005438 | Bacteria | 2588 |
| 59 | Ga0070701_10368431 | 3300005438 | Bacteria | 902 |
| 60 | Ga0070705_100194304 | 3300005440 | Bacteria | 1386 |
| 61 | Ga0070700_100055550 | 3300005441 | Unclassified | 2479 |
| 62 | Ga0070700_100564822 | 3300005441 | Unclassified | 886 |
| 63 | Ga0070700_101388592 | 3300005441 | Bacteria | 593 |
| 64 | Ga0070694_100356191 | 3300005444 | Unclassified | 1135 |
| 65 | Ga0070694_100799395 | 3300005444 | Bacteria | 773 |
| 66 | Ga0070708_100042563 | 3300005445 | Bacteria | 3987 |
| 67 | Ga0070663_102009222 | 3300005455 | Bacteria | 520 |
| 68 | Ga0070678_100404997 | 3300005456 | Bacteria | 1186 |
| 69 | Ga0070662_100049021 | 3300005457 | Bacteria | 3045 |
| 70 | Ga0068867_100057517 | 3300005459 | Bacteria | 2880 |
| 71 | Ga0068867_101166693 | 3300005459 | Unclassified | 706 |
| 72 | Ga0068867_101660466 | 3300005459 | Bacteria | 598 |
| 73 | Ga0070706_100008279 | 3300005467 | Bacteria | 9692 |
| 74 | Ga0070707_100039383 | 3300005468 | Bacteria | 4517 |
| 75 | Ga0070698_100134106 | 3300005471 | Bacteria | 2431 |
| 76 | Ga0070698_100223853 | 3300005471 | Bacteria | 1814 |
| 77 | Ga0070699_100045302 | 3300005518 | Bacteria | 3807 |
| 78 | Ga0070699_100679811 | 3300005518 | Unclassified | 940 |
| 79 | Ga0070699_100938214 | 3300005518 | Unclassified | 793 |
| 80 | Ga0070684_100001825 | 3300005535 | Bacteria | 15598 |
| 81 | Ga0070684_101253388 | 3300005535 | Bacteria | 698 |
| 82 | Ga0070697_100518671 | 3300005536 | Bacteria | 1043 |
| 83 | Ga0070697_100551222 | 3300005536 | Bacteria | 1011 |
| 84 | Ga0070697_100911677 | 3300005536 | Bacteria | 780 |
| 85 | Ga0070697_101977745 | 3300005536 | Unclassified | 522 |
| 86 | Ga0068853_100478281 | 3300005539 | Bacteria | 1174 |
| 87 | Ga0070672_100035347 | 3300005543 | Bacteria | 3798 |
| 88 | Ga0070672_100174265 | 3300005543 | Bacteria | 1790 |
| 89 | Ga0070672_100228527 | 3300005543 | Bacteria | 1562 |
| 90 | Ga0070686_100031166 | 3300005544 | Bacteria | 3258 |
| 91 | Ga0070686_100039149 | 3300005544 | Bacteria | 2952 |
| 92 | Ga0070686_101186300 | 3300005544 | Bacteria | 634 |
| 93 | Ga0070695_100242103 | 3300005545 | Bacteria | 1309 |
| 94 | Ga0070696_100427825 | 3300005546 | Unclassified | 1041 |
| 95 | Ga0070696_100477767 | 3300005546 | Bacteria | 988 |
| 96 | Ga0070696_101050442 | 3300005546 | Unclassified | 683 |
| 97 | Ga0070693_100435219 | 3300005547 | Bacteria | 917 |
| 98 | Ga0070665_100780473 | 3300005548 | Bacteria | 968 |
| 99 | Ga0070704_100738394 | 3300005549 | Bacteria | 876 |
| 100 | Ga0070664_100002455 | 3300005564 | Bacteria | 14929 |
| 101 | Ga0068857_100014904 | 3300005577 | Bacteria | 6780 |
| 102 | Ga0068854_100443117 | 3300005578 | Bacteria | 1083 |
| 103 | Ga0068854_101342561 | 3300005578 | Unclassified | 645 |
| 104 | Ga0068856_100169409 | 3300005614 | Bacteria | 2196 |
| 105 | Ga0070702_100004977 | 3300005615 | Bacteria | 6136 |
| 106 | Ga0070702_100079183 | 3300005615 | Bacteria | 1963 |
| 107 | Ga0070702_100136851 | 3300005615 | Bacteria | 1555 |
| 108 | Ga0068859_100004037 | 3300005617 | Bacteria | 14965 |
| 109 | Ga0068859_100076888 | 3300005617 | Bacteria | 3378 |
| 110 | Ga0068859_100881185 | 3300005617 | Bacteria | 980 |
| 111 | Ga0068859_102117879 | 3300005617 | Bacteria | 621 |
| 112 | Ga0068864_101539104 | 3300005618 | Unclassified | 668 |
| 113 | Ga0068866_10019016 | 3300005718 | Bacteria | 3118 |
| 114 | Ga0068866_10057911 | 3300005718 | Bacteria | 1999 |
| 115 | Ga0068866_10522648 | 3300005718 | Bacteria | 789 |
| 116 | Ga0068861_100035653 | 3300005719 | Bacteria | 3686 |
| 117 | Ga0068861_100162808 | 3300005719 | Bacteria | 1842 |
| 118 | Ga0068861_100646452 | 3300005719 | Bacteria | 976 |
| 119 | Ga0068870_10013060 | 3300005840 | Bacteria | 3893 |
| 120 | Ga0068870_10217385 | 3300005840 | Bacteria | 1168 |
| 121 | Ga0068870_10420447 | 3300005840 | Bacteria | 874 |
| 122 | Ga0068870_10805465 | 3300005840 | Unclassified | 657 |
| 123 | Ga0068863_100067911 | 3300005841 | Unclassified | 3372 |
| 124 | Ga0068863_100098183 | 3300005841 | Bacteria | 2781 |
| 125 | Ga0068858_100022837 | 3300005842 | Bacteria | 5835 |
| 126 | Ga0068858_100438422 | 3300005842 | Bacteria | 1258 |
| 127 | Ga0068858_100679898 | 3300005842 | Bacteria | 1001 |
| 128 | Ga0068858_100872582 | 3300005842 | Bacteria | 879 |
| 129 | Ga0068860_100023002 | 3300005843 | Bacteria | 6027 |
| 130 | Ga0068862_100004536 | 3300005844 | Bacteria | 11708 |
| 131 | Ga0068862_100006355 | 3300005844 | Bacteria | 9825 |
| 132 | Ga0068862_100027991 | 3300005844 | Bacteria | 4746 |
| 133 | Ga0068862_100248466 | 3300005844 | Bacteria | 1620 |
| 134 | Ga0068862_100652000 | 3300005844 | Bacteria | 1015 |
| 135 | Ga0068862_100886379 | 3300005844 | Unclassified | 876 |
| 136 | Ga0068862_100916144 | 3300005844 | Bacteria | 862 |
| 137 | Ga0081539_10348996 | 3300005985 | Unclassified | 622 |
| 138 | Ga0070716_100089278 | 3300006173 | Bacteria | 1861 |
| 139 | Ga0070712_100257888 | 3300006175 | Bacteria | 1396 |
| 140 | Ga0075366_10551863 | 3300006195 | Bacteria | 713 |
| 141 | Ga0097621_100177480 | 3300006237 | Bacteria | 1839 |
| 142 | Ga0075428_100168993 | 3300006844 | Bacteria | 2371 |
| 143 | Ga0075428_100304589 | 3300006844 | Bacteria | 1713 |
| 144 | Ga0075430_100042601 | 3300006846 | Bacteria | 3839 |
| 145 | Ga0075430_100302308 | 3300006846 | Bacteria | 1323 |
| 146 | Ga0075430_100372216 | 3300006846 | Unclassified | 1179 |
| 147 | Ga0075430_100596527 | 3300006846 | Unclassified | 911 |
| 148 | Ga0075430_101297628 | 3300006846 | Bacteria | 599 |
| 149 | Ga0075431_100238240 | 3300006847 | Bacteria | 1852 |
| 150 | Ga0075433_10011834 | 3300006852 | Bacteria | 7028 |
| 151 | Ga0075433_10044859 | 3300006852 | Bacteria | 3842 |
| 152 | Ga0075433_10191309 | 3300006852 | Bacteria | 1820 |
| 153 | Ga0075433_10588921 | 3300006852 | Bacteria | 977 |
| 154 | Ga0075433_10910354 | 3300006852 | Unclassified | 767 |
| 155 | Ga0075434_100049532 | 3300006871 | Bacteria | 4171 |
| 156 | Ga0075434_100163089 | 3300006871 | Unclassified | 2248 |
| 157 | Ga0075434_100635870 | 3300006871 | Bacteria | 1086 |
| 158 | Ga0075434_101242394 | 3300006871 | Bacteria | 756 |
| 159 | Ga0075429_100192648 | 3300006880 | Unclassified | 1786 |
| 160 | Ga0068865_100029834 | 3300006881 | Bacteria | 3623 |
| 161 | Ga0075436_100022101 | 3300006914 | Bacteria | 4369 |
| 162 | Ga0075436_100164391 | 3300006914 | Bacteria | 1565 |
| 163 | Ga0075436_100869986 | 3300006914 | Bacteria | 673 |
| 164 | Ga0097620_100004037 | 3300006931 | Bacteria | 14965 |
| 165 | Ga0097620_100076885 | 3300006931 | Bacteria | 3378 |
| 166 | Ga0097620_100881049 | 3300006931 | Bacteria | 980 |
| 167 | Ga0097620_102117844 | 3300006931 | Bacteria | 621 |
| 168 | Ga0075435_100003579 | 3300007076 | Bacteria | 10554 |
| 169 | Ga0075435_100723528 | 3300007076 | Unclassified | 865 |
| 170 | Ga0111539_10032691 | 3300009094 | Bacteria | 6317 |
| 171 | Ga0111539_10340698 | 3300009094 | Bacteria | 1745 |
| 172 | Ga0111539_10882609 | 3300009094 | Bacteria | 1040 |
| 173 | Ga0111539_12671231 | 3300009094 | Bacteria | 579 |
| 174 | Ga0105245_10820341 | 3300009098 | Bacteria | 969 |
| 175 | Ga0105247_10541994 | 3300009101 | Bacteria | 854 |
| 176 | Ga0114129_10012072 | 3300009147 | Bacteria | 12294 |
| 177 | Ga0114129_10154009 | 3300009147 | Bacteria | 3145 |
| 178 | Ga0114129_10219561 | 3300009147 | Bacteria | 2565 |
| 179 | Ga0114129_10289560 | 3300009147 | Bacteria | 2186 |
| 180 | Ga0114129_10607654 | 3300009147 | Bacteria | 1416 |
| 181 | Ga0114129_10649870 | 3300009147 | Unclassified | 1361 |
| 182 | Ga0114129_10719932 | 3300009147 | Bacteria | 1281 |
| 183 | Ga0105243_10014938 | 3300009148 | Bacteria | 5877 |
| 184 | Ga0105243_10302806 | 3300009148 | Bacteria | 1449 |
| 185 | Ga0105243_10351577 | 3300009148 | Bacteria | 1353 |
| 186 | Ga0105241_10712681 | 3300009174 | Bacteria | 917 |
| 187 | Ga0105242_10353212 | 3300009176 | Bacteria | 1358 |
| 188 | Ga0105242_10636978 | 3300009176 | Bacteria | 1035 |
| 189 | Ga0105242_11437654 | 3300009176 | Bacteria | 718 |
| 190 | Ga0105248_10000636 | 3300009177 | Bacteria | 39914 |
| 191 | Ga0105248_10004282 | 3300009177 | Bacteria | 15790 |
| 192 | Ga0105248_10660667 | 3300009177 | Bacteria | 1179 |
| 193 | Ga0105237_12023613 | 3300009545 | Unclassified | 585 |
| 194 | Ga0105238_10606866 | 3300009551 | Unclassified | 1102 |
| 195 | Ga0105238_12182735 | 3300009551 | Bacteria | 588 |
| 196 | Ga0105249_10012608 | 3300009553 | Bacteria | 7453 |
| 197 | Ga0105249_10049460 | 3300009553 | Bacteria | 3834 |
| 198 | Ga0105249_10087890 | 3300009553 | Bacteria | 2901 |
| 199 | Ga0105249_10174465 | 3300009553 | Bacteria | 2087 |
| 200 | Ga0105249_10330768 | 3300009553 | Bacteria | 1537 |
| 201 | Ga0105249_10407805 | 3300009553 | Bacteria | 1390 |
| 202 | Ga0105239_11918015 | 3300010375 | Bacteria | 687 |
| 203 | Ga0105246_11189012 | 3300011119 | Unclassified | 701 |
| 204 | Ga0157374_10951378 | 3300013296 | Bacteria | 877 |
| 205 | Ga0157378_10126023 | 3300013297 | Unclassified | 2365 |
| 206 | Ga0157378_10702119 | 3300013297 | Bacteria | 1031 |
| 207 | Ga0157378_11000734 | 3300013297 | Bacteria | 870 |
| 208 | Ga0163162_10031072 | 3300013306 | Bacteria | 5295 |
| 209 | Ga0163162_10068330 | 3300013306 | Unclassified | 3605 |
| 210 | Ga0163162_10706859 | 3300013306 | Bacteria | 1129 |
| 211 | Ga0163162_10835794 | 3300013306 | Bacteria | 1037 |
| 212 | Ga0157372_11215909 | 3300013307 | Bacteria | 870 |
| 213 | Ga0157375_10024708 | 3300013308 | Bacteria | 5566 |
| 214 | Ga0157375_10053214 | 3300013308 | Bacteria | 3982 |
| 215 | Ga0157375_10078796 | 3300013308 | Bacteria | 3329 |
| 216 | Ga0157375_13472499 | 3300013308 | Unclassified | 525 |
| 217 | Ga0163163_10015281 | 3300014325 | Bacteria | 7094 |
| 218 | Ga0163163_11180384 | 3300014325 | Unclassified | 828 |
| 219 | Ga0157380_10106559 | 3300014326 | Bacteria | 2346 |
| 220 | Ga0157380_10171948 | 3300014326 | Bacteria | 1894 |
| 221 | Ga0157380_10660047 | 3300014326 | Bacteria | 1045 |
| 222 | Ga0157377_10034964 | 3300014745 | Bacteria | 2752 |
| 223 | Ga0157379_10056778 | 3300014968 | Unclassified | 3498 |
| 224 | Ga0157379_10105286 | 3300014968 | Bacteria | 2532 |
| 225 | Ga0157376_10714153 | 3300014969 | Bacteria | 1009 |
| 226 | Ga0163161_10360292 | 3300017792 | Bacteria | 1158 |
| 227 | Ga0209050_1008842 | 3300025298 | Bacteria | 5280 |
| 228 | Ga0207682_10105785 | 3300025893 | Bacteria | 1234 |
| 229 | Ga0207642_10006499 | 3300025899 | Bacteria | 3892 |
| 230 | Ga0207642_10068903 | 3300025899 | Bacteria | 1676 |
| 231 | Ga0207710_10037373 | 3300025900 | Bacteria | 2144 |
| 232 | Ga0207680_10357690 | 3300025903 | Bacteria | 1026 |
| 233 | Ga0207643_10014204 | 3300025908 | Bacteria | 4324 |
| 234 | Ga0207643_10047702 | 3300025908 | Bacteria | 2425 |
| 235 | Ga0207643_10386346 | 3300025908 | Bacteria | 883 |
| 236 | Ga0207705_10205297 | 3300025909 | Bacteria | 1493 |
| 237 | Ga0207654_10350338 | 3300025911 | Bacteria | 1016 |
| 238 | Ga0207654_10559554 | 3300025911 | Bacteria | 813 |
| 239 | Ga0207707_10649061 | 3300025912 | Bacteria | 890 |
| 240 | Ga0207671_10101181 | 3300025914 | Bacteria | 2183 |
| 241 | Ga0207671_11217028 | 3300025914 | Unclassified | 589 |
| 242 | Ga0207660_10233759 | 3300025917 | Bacteria | 1446 |
| 243 | Ga0207660_11221840 | 3300025917 | Unclassified | 611 |
| 244 | Ga0207662_10002852 | 3300025918 | Bacteria | 8745 |
| 245 | Ga0207662_10183510 | 3300025918 | Bacteria | 1347 |
| 246 | Ga0207662_10931495 | 3300025918 | Bacteria | 616 |
| 247 | Ga0207649_10940280 | 3300025920 | Bacteria | 679 |
| 248 | Ga0207649_11427787 | 3300025920 | Bacteria | 548 |
| 249 | Ga0207681_10001608 | 3300025923 | Bacteria | 14557 |
| 250 | Ga0207681_10183108 | 3300025923 | Bacteria | 1597 |
| 251 | Ga0207681_10438775 | 3300025923 | Bacteria | 1060 |
| 252 | Ga0207659_10424912 | 3300025926 | Bacteria | 1115 |
| 253 | Ga0207687_11583829 | 3300025927 | Bacteria | 562 |
| 254 | Ga0207644_10003773 | 3300025931 | Bacteria | 9817 |
| 255 | Ga0207706_10398173 | 3300025933 | Bacteria | 1194 |
| 256 | Ga0207709_10006618 | 3300025935 | Bacteria | 6502 |
| 257 | Ga0207709_10137196 | 3300025935 | Bacteria | 1676 |
| 258 | Ga0207709_10251868 | 3300025935 | Bacteria | 1290 |
| 259 | Ga0207670_10014307 | 3300025936 | Bacteria | 4706 |
| 260 | Ga0207670_11134213 | 3300025936 | Bacteria | 661 |
| 261 | Ga0207669_10093276 | 3300025937 | Bacteria | 1967 |
| 262 | Ga0207669_10686593 | 3300025937 | Bacteria | 840 |
| 263 | Ga0207669_11337229 | 3300025937 | Bacteria | 609 |
| 264 | Ga0207669_11396994 | 3300025937 | Bacteria | 596 |
| 265 | Ga0207704_10046716 | 3300025938 | Bacteria | 2582 |
| 266 | Ga0207691_10003671 | 3300025940 | Bacteria | 14895 |
| 267 | Ga0207691_10047646 | 3300025940 | Bacteria | 3932 |
| 268 | Ga0207691_10270404 | 3300025940 | Bacteria | 1463 |
| 269 | Ga0207711_10015433 | 3300025941 | Bacteria | 6339 |
| 270 | Ga0207711_10562045 | 3300025941 | Bacteria | 1064 |
| 271 | Ga0207711_11058475 | 3300025941 | Bacteria | 751 |
| 272 | Ga0207689_10002509 | 3300025942 | Bacteria | 17059 |
| 273 | Ga0207689_10266886 | 3300025942 | Unclassified | 1417 |
| 274 | Ga0207689_10874175 | 3300025942 | Bacteria | 759 |
| 275 | Ga0207679_10013866 | 3300025945 | Bacteria | 5285 |
| 276 | Ga0207651_10033514 | 3300025960 | Bacteria | 3314 |
| 277 | Ga0207651_10684306 | 3300025960 | Bacteria | 902 |
| 278 | Ga0207712_10009436 | 3300025961 | Bacteria | 6175 |
| 279 | Ga0207712_10013013 | 3300025961 | Bacteria | 5329 |
| 280 | Ga0207712_10573955 | 3300025961 | Bacteria | 973 |
| 281 | Ga0207668_10003776 | 3300025972 | Bacteria | 8921 |
| 282 | Ga0207668_10018942 | 3300025972 | Bacteria | 4340 |
| 283 | Ga0207668_10236649 | 3300025972 | Bacteria | 1475 |
| 284 | Ga0207668_10788890 | 3300025972 | Bacteria | 840 |
| 285 | Ga0207668_11126838 | 3300025972 | Bacteria | 704 |
| 286 | Ga0207668_11777854 | 3300025972 | Bacteria | 556 |
| 287 | Ga0207658_10026169 | 3300025986 | Bacteria | 4088 |
| 288 | Ga0207658_10581213 | 3300025986 | Bacteria | 1005 |
| 289 | Ga0207677_10796711 | 3300026023 | Unclassified | 846 |
| 290 | Ga0207703_10267290 | 3300026035 | Bacteria | 1548 |
| 291 | Ga0207703_10425674 | 3300026035 | Bacteria | 1236 |
| 292 | Ga0207703_10514423 | 3300026035 | Bacteria | 1125 |
| 293 | Ga0207703_10946136 | 3300026035 | Bacteria | 826 |
| 294 | Ga0207639_10398820 | 3300026041 | Bacteria | 1239 |
| 295 | Ga0207708_10020022 | 3300026075 | Bacteria | 5045 |
| 296 | Ga0207708_10082794 | 3300026075 | Bacteria | 2467 |
| 297 | Ga0207708_10404611 | 3300026075 | Unclassified | 1129 |
| 298 | Ga0207708_10529073 | 3300026075 | Bacteria | 991 |
| 299 | Ga0207708_11164483 | 3300026075 | Unclassified | 673 |
| 300 | Ga0207702_10086249 | 3300026078 | Bacteria | 2737 |
| 301 | Ga0207641_10074598 | 3300026088 | Bacteria | 2926 |
| 302 | Ga0207641_10740733 | 3300026088 | Bacteria | 970 |
| 303 | Ga0207641_12151105 | 3300026088 | Bacteria | 558 |
| 304 | Ga0207648_10010171 | 3300026089 | Bacteria | 8946 |
| 305 | Ga0207676_10010255 | 3300026095 | Bacteria | 6667 |
| 306 | Ga0207674_10010706 | 3300026116 | Bacteria | 10357 |
| 307 | Ga0207675_100000379 | 3300026118 | Bacteria | 42654 |
| 308 | Ga0207675_100007555 | 3300026118 | Bacteria | 10270 |
| 309 | Ga0207675_100014641 | 3300026118 | Bacteria | 7313 |
| 310 | Ga0207675_100072075 | 3300026118 | Bacteria | 3231 |
| 311 | Ga0207683_10046176 | 3300026121 | Bacteria | 3810 |
| 312 | Ga0207683_10450055 | 3300026121 | Unclassified | 1187 |
| 313 | Ga0207683_10606082 | 3300026121 | Bacteria | 1014 |
| 314 | Ga0207698_10451074 | 3300026142 | Bacteria | 1242 |
| 315 | Ga0207428_10275159 | 3300027907 | Bacteria | 1251 |
| 316 | Ga0268266_10267102 | 3300028379 | Bacteria | 1587 |
| 317 | Ga0268265_10004332 | 3300028380 | Bacteria | 9881 |
| 318 | Ga0268265_10014122 | 3300028380 | Bacteria | 5443 |
| 319 | Ga0268265_10015704 | 3300028380 | Bacteria | 5186 |
| 320 | Ga0268265_10026087 | 3300028380 | Bacteria | 4154 |
| 321 | Ga0268265_10175593 | 3300028380 | Bacteria | 1836 |
| 322 | Ga0268265_10476244 | 3300028380 | Unclassified | 1171 |
| 323 | Ga0268265_10737586 | 3300028380 | Unclassified | 955 |
| 324 | Ga0268265_10871073 | 3300028380 | Bacteria | 882 |
| 325 | Ga0268264_10160808 | 3300028381 | Bacteria | 2023 |
| 326 | Ga0268264_11478685 | 3300028381 | Unclassified | 690 |
| 327 | Ga0307515_10773096 | 3300028794 | Bacteria | 581 |
| 328 | Ga0307513_10695268 | 3300031456 | Bacteria | 723 |
| 329 | Ga0307408_100009479 | 3300031548 | Bacteria | 6422 |
| 330 | Ga0307408_100088952 | 3300031548 | Bacteria | 2327 |
| 331 | Ga0307408_100146352 | 3300031548 | Bacteria | 1860 |
| 332 | Ga0307405_10009652 | 3300031731 | Bacteria | 4956 |
| 333 | Ga0307405_10128102 | 3300031731 | Bacteria | 1749 |
| 334 | Ga0307405_10649690 | 3300031731 | Bacteria | 867 |
| 335 | Ga0307413_10012240 | 3300031824 | Bacteria | 4262 |
| 336 | Ga0307410_10005256 | 3300031852 | Bacteria | 6825 |
| 337 | Ga0307410_10039742 | 3300031852 | Unclassified | 3091 |
| 338 | Ga0307406_10011920 | 3300031901 | Bacteria | 4941 |
| 339 | Ga0307406_10427349 | 3300031901 | Bacteria | 1057 |
| 340 | Ga0307406_11076878 | 3300031901 | Bacteria | 693 |
| 341 | Ga0307406_11915396 | 3300031901 | Bacteria | 529 |
| 342 | Ga0307407_10001575 | 3300031903 | Bacteria | 8390 |
| 343 | Ga0307412_10181258 | 3300031911 | Bacteria | 1584 |
| 344 | Ga0307409_100001882 | 3300031995 | Bacteria | 10697 |
| 345 | Ga0307416_100009444 | 3300032002 | Bacteria | 6385 |
| 346 | Ga0307416_100035293 | 3300032002 | Bacteria | 3817 |
| 347 | Ga0307416_100061350 | 3300032002 | Bacteria | 3068 |
| 348 | Ga0307416_100924428 | 3300032002 | Bacteria | 973 |
| 349 | Ga0307414_10166682 | 3300032004 | Bacteria | 1756 |
| 350 | Ga0307414_10548552 | 3300032004 | Unclassified | 1030 |
| 351 | Ga0307411_10095695 | 3300032005 | Bacteria | 2085 |
| 352 | Ga0307411_11325592 | 3300032005 | Bacteria | 656 |
| 353 | Ga0307415_100056336 | 3300032126 | Unclassified | 2694 |
| 354 | Ga0307415_101249806 | 3300032126 | Bacteria | 701 |
| 355 | Ga0373958_0207339 | 3300034819 | Unclassified | 516 |
| 356 | Ga0373951_0096050 | 3300035091 | Bacteria | 783 |
| 357 | Ga0373932_0288076 | 3300035112 | Bacteria | 609 |
| 358 | Ga0373941_0244790 | 3300035115 | Bacteria | 698 |
| 359 | Ga0373960_0002196 | 3300035121 | Bacteria | 4387 |
| 360 | Ga0373960_0126235 | 3300035121 | Unclassified | 854 |
| 361 | Ga0373961_0023908 | 3300035241 | Bacteria | 1648 |
| 362 | Ga0373962_0112976 | 3300035242 | Bacteria | 859 |
| 363 | Ga0373931_0076294 | 3300035691 | Bacteria | 1841 |
| 364 | Ga0242420_000748 | 3300038996 | Bacteria | 3911 |
| 365 | Ga0439453_0071279 | 3300041408 | Bacteria | 735 |
| 366 | Ga0439442_055383 | 3300042002 | Bacteria | 838 |
| 367 | Ga0439448_0099831 | 3300042005 | Bacteria | 986 |
| 368 | Ga0439455_0017839 | 3300042012 | Bacteria | 1659 |
| 369 | Ga0450896_002793 | 3300042133 | Bacteria | 2279 |
| 370 | Ga0439444_0150970 | 3300042437 | Bacteria | 561 |
| 371 | Ga0451576_0106963 | 3300045051 | Bacteria | 2910 |
| 372 | Ga0451576_0972393 | 3300045051 | Bacteria | 890 |
| 373 | Ga0495582_0863179 | 3300046473 | Unclassified | 523 |
| 374 | Ga0495586_0299005 | 3300046535 | Bacteria | 922 |
| 375 | Ga0495598_0038062 | 3300046537 | Bacteria | 1391 |
| 376 | Ga0495621_0119827 | 3300046539 | Bacteria | 1016 |
| 377 | Ga0496101_0080332 | 3300048904 | Bacteria | 2409 |
| 378 | Ga0496101_0569208 | 3300048904 | Bacteria | 896 |
| 379 | Ga0496102_0117853 | 3300048905 | Bacteria | 2478 |
| 380 | Ga0496103_0597515 | 3300048906 | Unclassified | 703 |
| 381 | Ga0496104_0143262 | 3300048907 | Bacteria | 2296 |
| 382 | Ga0496104_0918471 | 3300048907 | Bacteria | 780 |
| 383 | Ga0496105_0178423 | 3300048908 | Bacteria | 1740 |
| 384 | Ga0496106_0149159 | 3300048909 | Bacteria | 1844 |
| 385 | Ga0496106_0172690 | 3300048909 | Bacteria | 1714 |
| 386 | Ga0496106_1212467 | 3300048909 | Bacteria | 588 |
| 387 | Ga0496107_0186255 | 3300048910 | Bacteria | 1542 |
| 388 | Ga0496107_0871744 | 3300048910 | Bacteria | 657 |
| 389 | Ga0496108_0255943 | 3300048911 | Bacteria | 1523 |
| 390 | Ga0496108_0954302 | 3300048911 | Bacteria | 734 |
| 391 | Ga0496109_0076344 | 3300048912 | Bacteria | 3082 |
| 392 | Ga0496110_0132355 | 3300048913 | Bacteria | 2252 |
| 393 | Ga0496110_0165158 | 3300048913 | Bacteria | 2008 |
| 394 | Ga0496110_0188430 | 3300048913 | Bacteria | 1873 |
| 395 | Ga0496113_0171390 | 3300048916 | Bacteria | 1719 |
| 396 | Ga0501293_013273 | 3300049516 | Bacteria | 738 |
| 397 | Ga0501297_054392 | 3300049520 | Bacteria | 597 |
| 398 | Ga0501298_101013 | 3300049521 | Bacteria | 658 |
| 399 | Ga0501048_0518675 | 3300049582 | Bacteria | 855 |
| 400 | Ga0501067_0066297 | 3300049583 | Bacteria | 1998 |
| 401 | Ga0501069_0108143 | 3300049585 | Bacteria | 1582 |
| 402 | Ga0501198_077886 | 3300049649 | Bacteria | 637 |
| 403 | Ga0501208_106656 | 3300049655 | Unclassified | 606 |
| 404 | Ga0501217_168929 | 3300049661 | Bacteria | 664 |
| 405 | Ga0501233_263418 | 3300049668 | Bacteria | 522 |
| 406 | Ga0501239_005908 | 3300049672 | Bacteria | 1244 |
| 407 | Ga0501246_023002 | 3300049676 | Bacteria | 657 |
| 408 | Ga0501249_005737 | 3300049679 | Bacteria | 2537 |
| 409 | Ga0501249_069116 | 3300049679 | Unclassified | 824 |
| 410 | Ga0501249_105372 | 3300049679 | Unclassified | 678 |
| 411 | Ga0501253_162470 | 3300049683 | Unclassified | 570 |
| 412 | Ga0501257_131264 | 3300049686 | Unclassified | 678 |
| 413 | Ga0501263_088308 | 3300049760 | Unclassified | 520 |
| 414 | Ga0501268_089930 | 3300049765 | Unclassified | 645 |
| 415 | Ga0501273_074201 | 3300049770 | Unclassified | 556 |
| 416 | Ga0501280_089126 | 3300049776 | Bacteria | 579 |
| 417 | Ga0501283_049400 | 3300049779 | Bacteria | 743 |
| 418 | nmdc:mga0k408_754948_c1 | 3300050493 | Bacteria | 568 |
| 419 | nmdc:mga05p37_235609_c1 | 3300050507 | Bacteria | 2203 |
| 420 | nmdc:mga05p37_31967_c1 | 3300050507 | Bacteria | 6434 |
| 421 | nmdc:mga05p37_40907_c1 | 3300050507 | Bacteria | 5691 |
| 422 | nmdc:mga05p37_515828_c1 | 3300050507 | Bacteria | 1368 |
| 423 | nmdc:mga05p37_693288_c1 | 3300050507 | Bacteria | 1133 |
| 424 | nmdc:mga05p37_796716_c1 | 3300050507 | Bacteria | 1034 |
| 425 | nmdc:mga09592_183753_c1 | 3300050508 | Unclassified | 1809 |
| 426 | nmdc:mga0qj67_194579_c1 | 3300050509 | Unclassified | 1648 |
| 427 | nmdc:mga0qj67_25434_c1 | 3300050509 | Bacteria | 4574 |
| 428 | nmdc:mga0qj67_984837_c1 | 3300050509 | Unclassified | 662 |
| 429 | nmdc:mga06r32_841124_c1 | 3300050510 | Unclassified | 877 |
| 430 | nmdc:mga06r32_898479_c1 | 3300050510 | Bacteria | 842 |
| 431 | nmdc:mga08y16_489595_c1 | 3300050511 | Bacteria | 1251 |
| 432 | nmdc:mga08y16_522698_c1 | 3300050511 | Bacteria | 1203 |
| 433 | nmdc:mga08y16_742010_c1 | 3300050511 | Bacteria | 978 |
| 434 | nmdc:mga08y16_97571_c1 | 3300050511 | Bacteria | 3060 |
| 435 | nmdc:mga0n895_118993_c1 | 3300050512 | Bacteria | 2662 |
| 436 | nmdc:mga0n895_31600_c1 | 3300050512 | Bacteria | 5072 |
| 437 | nmdc:mga0n895_834550_c1 | 3300050512 | Unclassified | 910 |
| 438 | nmdc:mga0n895_843479_c1 | 3300050512 | Bacteria | 905 |
| 439 | nmdc:mga0rr50_20375_c1 | 3300050513 | Bacteria | 4502 |
| 440 | nmdc:mga0rr50_687571_c1 | 3300050513 | Unclassified | 873 |
| 441 | nmdc:mga08x19_11955_c1 | 3300050514 | Bacteria | 5224 |
| 442 | nmdc:mga0a205_13493_c1 | 3300050515 | Bacteria | 7608 |
| 443 | nmdc:mga0a205_25168_c1 | 3300050515 | Bacteria | 5667 |
| 444 | nmdc:mga0a205_26017_c1 | 3300050515 | Bacteria | 5575 |
| 445 | nmdc:mga0a205_579678_c1 | 3300050515 | Bacteria | 976 |
| 446 | nmdc:mga0a205_782444_c1 | 3300050515 | Unclassified | 802 |
| 447 | Ga0500622_0000020 | 3300053156 | Bacteria | 271239 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005364 | Ga0070673_100986976 | Ga0070673_1009869762 | 81 |
| 2 | 3300005518 | Ga0070699_100938214 | Ga0070699_1009382142 | 86 |
| 3 | 3300009551 | Ga0105238_10606866 | Ga0105238_106068662 | 86 |
| 4 | 3300005293 | Ga0065715_10365936 | Ga0065715_103659362 | 87 |
| 5 | 3300005445 | Ga0070708_100042563 | Ga0070708_1000425632 | 87 |
| 6 | 3300005467 | Ga0070706_100008279 | Ga0070706_1000082798 | 87 |
| 7 | 3300005468 | Ga0070707_100039383 | Ga0070707_1000393832 | 87 |
| 8 | 3300005518 | Ga0070699_100679811 | Ga0070699_1006798112 | 87 |
| 9 | 3300006846 | Ga0075430_100372216 | Ga0075430_1003722162 | 87 |
| 10 | 3300025918 | Ga0207662_10183510 | Ga0207662_101835102 | 87 |
| 11 | 3300025972 | Ga0207668_10018942 | Ga0207668_100189424 | 87 |
| 12 | 3300005327 | Ga0070658_10095219 | Ga0070658_100952192 | 88 |
| 13 | 3300005330 | Ga0070690_100075831 | Ga0070690_1000758314 | 88 |
| 14 | 3300005330 | Ga0070690_100178164 | Ga0070690_1001781642 | 88 |
| 15 | 3300005330 | Ga0070690_100199227 | Ga0070690_1001992272 | 88 |
| 16 | 3300005333 | Ga0070677_10613818 | Ga0070677_106138181 | 88 |
| 17 | 3300005335 | Ga0070666_10127472 | Ga0070666_101274722 | 88 |
| 18 | 3300005336 | Ga0070680_100644179 | Ga0070680_1006441792 | 88 |
| 19 | 3300005341 | Ga0070691_10341462 | Ga0070691_103414622 | 88 |
| 20 | 3300005343 | Ga0070687_100220547 | Ga0070687_1002205472 | 88 |
| 21 | 3300005344 | Ga0070661_100325705 | Ga0070661_1003257052 | 88 |
| 22 | 3300005344 | Ga0070661_101775000 | Ga0070661_1017750001 | 88 |
| 23 | 3300005345 | Ga0070692_10098800 | Ga0070692_100988002 | 88 |
| 24 | 3300005345 | Ga0070692_10852811 | Ga0070692_108528112 | 88 |
| 25 | 3300005347 | Ga0070668_100265106 | Ga0070668_1002651062 | 88 |
| 26 | 3300005347 | Ga0070668_100458588 | Ga0070668_1004585882 | 88 |
| 27 | 3300005353 | Ga0070669_100013543 | Ga0070669_1000135436 | 88 |
| 28 | 3300005353 | Ga0070669_100236427 | Ga0070669_1002364271 | 88 |
| 29 | 3300005355 | Ga0070671_100018896 | Ga0070671_1000188962 | 88 |
| 30 | 3300005356 | Ga0070674_100076649 | Ga0070674_1000766492 | 88 |
| 31 | 3300005356 | Ga0070674_102085638 | Ga0070674_1020856381 | 88 |
| 32 | 3300005364 | Ga0070673_100560093 | Ga0070673_1005600932 | 88 |
| 33 | 3300005365 | Ga0070688_100639767 | Ga0070688_1006397672 | 88 |
| 34 | 3300005366 | Ga0070659_100400801 | Ga0070659_1004008011 | 88 |
| 35 | 3300005438 | Ga0070701_10368431 | Ga0070701_103684312 | 88 |
| 36 | 3300005440 | Ga0070705_100194304 | Ga0070705_1001943042 | 88 |
| 37 | 3300005441 | Ga0070700_100055550 | Ga0070700_1000555502 | 88 |
| 38 | 3300005441 | Ga0070700_101388592 | Ga0070700_1013885921 | 88 |
| 39 | 3300005444 | Ga0070694_100799395 | Ga0070694_1007993952 | 88 |
| 40 | 3300005457 | Ga0070662_100049021 | Ga0070662_1000490212 | 88 |
| 41 | 3300005459 | Ga0068867_100057517 | Ga0068867_1000575172 | 88 |
| 42 | 3300005459 | Ga0068867_101660466 | Ga0068867_1016604662 | 88 |
| 43 | 3300005471 | Ga0070698_100134106 | Ga0070698_1001341062 | 88 |
| 44 | 3300005518 | Ga0070699_100045302 | Ga0070699_1000453023 | 88 |
| 45 | 3300005535 | Ga0070684_101253388 | Ga0070684_1012533881 | 88 |
| 46 | 3300005536 | Ga0070697_100551222 | Ga0070697_1005512221 | 88 |
| 47 | 3300005536 | Ga0070697_100911677 | Ga0070697_1009116772 | 88 |
| 48 | 3300005536 | Ga0070697_101977745 | Ga0070697_1019777451 | 88 |
| 49 | 3300005543 | Ga0070672_100174265 | Ga0070672_1001742652 | 88 |
| 50 | 3300005544 | Ga0070686_100031166 | Ga0070686_1000311665 | 88 |
| 51 | 3300005544 | Ga0070686_101186300 | Ga0070686_1011863001 | 88 |
| 52 | 3300005546 | Ga0070696_100477767 | Ga0070696_1004777671 | 88 |
| 53 | 3300005546 | Ga0070696_101050442 | Ga0070696_1010504421 | 88 |
| 54 | 3300005549 | Ga0070704_100738394 | Ga0070704_1007383941 | 88 |
| 55 | 3300005578 | Ga0068854_100443117 | Ga0068854_1004431173 | 88 |
| 56 | 3300005578 | Ga0068854_101342561 | Ga0068854_1013425611 | 88 |
| 57 | 3300005617 | Ga0068859_100881185 | Ga0068859_1008811852 | 88 |
| 58 | 3300005617 | Ga0068859_102117879 | Ga0068859_1021178792 | 88 |
| 59 | 3300005718 | Ga0068866_10019016 | Ga0068866_100190162 | 88 |
| 60 | 3300005719 | Ga0068861_100646452 | Ga0068861_1006464522 | 88 |
| 61 | 3300005840 | Ga0068870_10420447 | Ga0068870_104204471 | 88 |
| 62 | 3300005841 | Ga0068863_100067911 | Ga0068863_1000679113 | 88 |
| 63 | 3300005842 | Ga0068858_100438422 | Ga0068858_1004384222 | 88 |
| 64 | 3300005842 | Ga0068858_100679898 | Ga0068858_1006798982 | 88 |
| 65 | 3300005842 | Ga0068858_100872582 | Ga0068858_1008725821 | 88 |
| 66 | 3300005844 | Ga0068862_100004536 | Ga0068862_1000045365 | 88 |
| 67 | 3300005844 | Ga0068862_100027991 | Ga0068862_1000279913 | 88 |
| 68 | 3300005844 | Ga0068862_100248466 | Ga0068862_1002484662 | 88 |
| 69 | 3300005844 | Ga0068862_100916144 | Ga0068862_1009161442 | 88 |
| 70 | 3300006852 | Ga0075433_10011834 | Ga0075433_100118343 | 88 |
| 71 | 3300006852 | Ga0075433_10044859 | Ga0075433_100448594 | 88 |
| 72 | 3300006852 | Ga0075433_10191309 | Ga0075433_101913092 | 88 |
| 73 | 3300006852 | Ga0075433_10588921 | Ga0075433_105889212 | 88 |
| 74 | 3300006871 | Ga0075434_100049532 | Ga0075434_1000495323 | 88 |
| 75 | 3300006871 | Ga0075434_100163089 | Ga0075434_1001630892 | 88 |
| 76 | 3300006871 | Ga0075434_100635870 | Ga0075434_1006358702 | 88 |
| 77 | 3300006871 | Ga0075434_101242394 | Ga0075434_1012423942 | 88 |
| 78 | 3300006914 | Ga0075436_100022101 | Ga0075436_1000221012 | 88 |
| 79 | 3300006914 | Ga0075436_100164391 | Ga0075436_1001643912 | 88 |
| 80 | 3300006914 | Ga0075436_100869986 | Ga0075436_1008699861 | 88 |
| 81 | 3300006931 | Ga0097620_100881049 | Ga0097620_1008810492 | 88 |
| 82 | 3300006931 | Ga0097620_102117844 | Ga0097620_1021178442 | 88 |
| 83 | 3300007076 | Ga0075435_100003579 | Ga0075435_1000035792 | 88 |
| 84 | 3300007076 | Ga0075435_100723528 | Ga0075435_1007235281 | 88 |
| 85 | 3300009094 | Ga0111539_10032691 | Ga0111539_100326915 | 88 |
| 86 | 3300009094 | Ga0111539_10882609 | Ga0111539_108826092 | 88 |
| 87 | 3300009098 | Ga0105245_10820341 | Ga0105245_108203412 | 88 |
| 88 | 3300009101 | Ga0105247_10541994 | Ga0105247_105419942 | 88 |
| 89 | 3300009147 | Ga0114129_10012072 | Ga0114129_100120728 | 88 |
| 90 | 3300009147 | Ga0114129_10154009 | Ga0114129_101540094 | 88 |
| 91 | 3300009147 | Ga0114129_10607654 | Ga0114129_106076542 | 88 |
| 92 | 3300009147 | Ga0114129_10719932 | Ga0114129_107199322 | 88 |
| 93 | 3300009148 | Ga0105243_10014938 | Ga0105243_100149383 | 88 |
| 94 | 3300009176 | Ga0105242_10353212 | Ga0105242_103532122 | 88 |
| 95 | 3300009176 | Ga0105242_11437654 | Ga0105242_114376541 | 88 |
| 96 | 3300009177 | Ga0105248_10660667 | Ga0105248_106606672 | 88 |
| 97 | 3300009551 | Ga0105238_12182735 | Ga0105238_121827352 | 88 |
| 98 | 3300009553 | Ga0105249_10174465 | Ga0105249_101744651 | 88 |
| 99 | 3300009553 | Ga0105249_10330768 | Ga0105249_103307682 | 88 |
| 100 | 3300009553 | Ga0105249_10407805 | Ga0105249_104078051 | 88 |
| 101 | 3300011119 | Ga0105246_11189012 | Ga0105246_111890122 | 88 |
| 102 | 3300013297 | Ga0157378_10126023 | Ga0157378_101260232 | 88 |
| 103 | 3300013308 | Ga0157375_10024708 | Ga0157375_100247085 | 88 |
| 104 | 3300013308 | Ga0157375_10078796 | Ga0157375_100787964 | 88 |
| 105 | 3300013308 | Ga0157375_13472499 | Ga0157375_134724991 | 88 |
| 106 | 3300014326 | Ga0157380_10106559 | Ga0157380_101065592 | 88 |
| 107 | 3300014326 | Ga0157380_10660047 | Ga0157380_106600472 | 88 |
| 108 | 3300014969 | Ga0157376_10714153 | Ga0157376_107141532 | 88 |
| 109 | 3300017792 | Ga0163161_10360292 | Ga0163161_103602922 | 88 |
| 110 | 3300025899 | Ga0207642_10006499 | Ga0207642_100064992 | 88 |
| 111 | 3300025900 | Ga0207710_10037373 | Ga0207710_100373732 | 88 |
| 112 | 3300025908 | Ga0207643_10386346 | Ga0207643_103863462 | 88 |
| 113 | 3300025909 | Ga0207705_10205297 | Ga0207705_102052972 | 88 |
| 114 | 3300025917 | Ga0207660_11221840 | Ga0207660_112218402 | 88 |
| 115 | 3300025918 | Ga0207662_10931495 | Ga0207662_109314951 | 88 |
| 116 | 3300025920 | Ga0207649_10940280 | Ga0207649_109402802 | 88 |
| 117 | 3300025920 | Ga0207649_11427787 | Ga0207649_114277872 | 88 |
| 118 | 3300025923 | Ga0207681_10438775 | Ga0207681_104387752 | 88 |
| 119 | 3300025927 | Ga0207687_11583829 | Ga0207687_115838291 | 88 |
| 120 | 3300025935 | Ga0207709_10006618 | Ga0207709_100066184 | 88 |
| 121 | 3300025936 | Ga0207670_11134213 | Ga0207670_111342132 | 88 |
| 122 | 3300025937 | Ga0207669_11337229 | Ga0207669_113372292 | 88 |
| 123 | 3300025937 | Ga0207669_11396994 | Ga0207669_113969941 | 88 |
| 124 | 3300025940 | Ga0207691_10270404 | Ga0207691_102704042 | 88 |
| 125 | 3300025941 | Ga0207711_11058475 | Ga0207711_110584751 | 88 |
| 126 | 3300025942 | Ga0207689_10874175 | Ga0207689_108741752 | 88 |
| 127 | 3300025960 | Ga0207651_10684306 | Ga0207651_106843061 | 88 |
| 128 | 3300025961 | Ga0207712_10573955 | Ga0207712_105739552 | 88 |
| 129 | 3300025972 | Ga0207668_10236649 | Ga0207668_102366492 | 88 |
| 130 | 3300025972 | Ga0207668_10788890 | Ga0207668_107888901 | 88 |
| 131 | 3300025972 | Ga0207668_11126838 | Ga0207668_111268382 | 88 |
| 132 | 3300025972 | Ga0207668_11777854 | Ga0207668_117778541 | 88 |
| 133 | 3300026035 | Ga0207703_10267290 | Ga0207703_102672902 | 88 |
| 134 | 3300026035 | Ga0207703_10946136 | Ga0207703_109461362 | 88 |
| 135 | 3300026075 | Ga0207708_10082794 | Ga0207708_100827942 | 88 |
| 136 | 3300026075 | Ga0207708_10529073 | Ga0207708_105290732 | 88 |
| 137 | 3300026088 | Ga0207641_10074598 | Ga0207641_100745982 | 88 |
| 138 | 3300026089 | Ga0207648_10010171 | Ga0207648_100101716 | 88 |
| 139 | 3300026118 | Ga0207675_100014641 | Ga0207675_1000146414 | 88 |
| 140 | 3300027907 | Ga0207428_10275159 | Ga0207428_102751592 | 88 |
| 141 | 3300028380 | Ga0268265_10015704 | Ga0268265_100157042 | 88 |
| 142 | 3300028380 | Ga0268265_10026087 | Ga0268265_100260875 | 88 |
| 143 | 3300028380 | Ga0268265_10871073 | Ga0268265_108710732 | 88 |
| 144 | 3300028381 | Ga0268264_10160808 | Ga0268264_101608082 | 88 |
| 145 | 3300028794 | Ga0307515_10773096 | Ga0307515_107730962 | 88 |
| 146 | 3300034819 | Ga0373958_0207339 | Ga0373958_0207339_178_444 | 88 |
| 147 | 3300035091 | Ga0373951_0096050 | Ga0373951_0096050_413_679 | 88 |
| 148 | 3300035121 | Ga0373960_0126235 | Ga0373960_0126235_385_651 | 88 |
| 149 | 3300035241 | Ga0373961_0023908 | Ga0373961_0023908_1018_1284 | 88 |
| 150 | 3300046539 | Ga0495621_0119827 | Ga0495621_0119827_735_1001 | 88 |
| 151 | 3300048904 | Ga0496101_0569208 | Ga0496101_0569208_270_536 | 88 |
| 152 | 3300048909 | Ga0496106_1212467 | Ga0496106_1212467_312_578 | 88 |
| 153 | 3300048913 | Ga0496110_0188430 | Ga0496110_0188430_997_1263 | 88 |
| 154 | 3300049582 | Ga0501048_0518675 | Ga0501048_0518675_539_805 | 88 |
| 155 | 3300050507 | nmdc:mga05p37_235609_c1 | nmdc:mga05p37_235609_c1_1872_2141 | 88 |
| 156 | 3300050507 | nmdc:mga05p37_31967_c1 | nmdc:mga05p37_31967_c1_47_313 | 88 |
| 157 | 3300050507 | nmdc:mga05p37_515828_c1 | nmdc:mga05p37_515828_c1_895_1161 | 88 |
| 158 | 3300050507 | nmdc:mga05p37_693288_c1 | nmdc:mga05p37_693288_c1_805_1071 | 88 |
| 159 | 3300050511 | nmdc:mga08y16_489595_c1 | nmdc:mga08y16_489595_c1_727_993 | 88 |
| 160 | 3300050511 | nmdc:mga08y16_742010_c1 | nmdc:mga08y16_742010_c1_562_828 | 88 |
| 161 | 3300050512 | nmdc:mga0n895_118993_c1 | nmdc:mga0n895_118993_c1_324_590 | 88 |
| 162 | 3300050512 | nmdc:mga0n895_31600_c1 | nmdc:mga0n895_31600_c1_4641_4907 | 88 |
| 163 | 3300050512 | nmdc:mga0n895_834550_c1 | nmdc:mga0n895_834550_c1_436_702 | 88 |
| 164 | 3300050512 | nmdc:mga0n895_843479_c1 | nmdc:mga0n895_843479_c1_152_418 | 88 |
| 165 | 3300050513 | nmdc:mga0rr50_20375_c1 | nmdc:mga0rr50_20375_c1_4028_4294 | 88 |
| 166 | 3300050513 | nmdc:mga0rr50_687571_c1 | nmdc:mga0rr50_687571_c1_49_318 | 88 |
| 167 | 3300050514 | nmdc:mga08x19_11955_c1 | nmdc:mga08x19_11955_c1_4761_5027 | 88 |
| 168 | 3300050515 | nmdc:mga0a205_13493_c1 | nmdc:mga0a205_13493_c1_2203_2469 | 88 |
| 169 | 3300050515 | nmdc:mga0a205_25168_c1 | nmdc:mga0a205_25168_c1_5132_5398 | 88 |
| 170 | 3300050515 | nmdc:mga0a205_26017_c1 | nmdc:mga0a205_26017_c1_1172_1438 | 88 |
| 171 | 3300050515 | nmdc:mga0a205_579678_c1 | nmdc:mga0a205_579678_c1_507_773 | 88 |
| 172 | 3300003316 | rootH1_10184660 | rootH1_101846602 | 89 |
| 173 | 3300005290 | Ga0065712_10075630 | Ga0065712_100756304 | 89 |
| 174 | 3300005293 | Ga0065715_10990515 | Ga0065715_109905152 | 89 |
| 175 | 3300005295 | Ga0065707_10114898 | Ga0065707_101148981 | 89 |
| 176 | 3300005295 | Ga0065707_10147827 | Ga0065707_101478273 | 89 |
| 177 | 3300005331 | Ga0070670_100005863 | Ga0070670_1000058631 | 89 |
| 178 | 3300005331 | Ga0070670_100327072 | Ga0070670_1003270722 | 89 |
| 179 | 3300005333 | Ga0070677_10258096 | Ga0070677_102580962 | 89 |
| 180 | 3300005334 | Ga0068869_100021294 | Ga0068869_1000212944 | 89 |
| 181 | 3300005334 | Ga0068869_100064219 | Ga0068869_1000642191 | 89 |
| 182 | 3300005334 | Ga0068869_100190783 | Ga0068869_1001907832 | 89 |
| 183 | 3300005335 | Ga0070666_10155212 | Ga0070666_101552122 | 89 |
| 184 | 3300005336 | Ga0070680_100543970 | Ga0070680_1005439702 | 89 |
| 185 | 3300005340 | Ga0070689_100001677 | Ga0070689_1000016775 | 89 |
| 186 | 3300005340 | Ga0070689_100333964 | Ga0070689_1003339642 | 89 |
| 187 | 3300005343 | Ga0070687_100083494 | Ga0070687_1000834943 | 89 |
| 188 | 3300005343 | Ga0070687_100600041 | Ga0070687_1006000411 | 89 |
| 189 | 3300005344 | Ga0070661_100007860 | Ga0070661_1000078608 | 89 |
| 190 | 3300005344 | Ga0070661_100612272 | Ga0070661_1006122722 | 89 |
| 191 | 3300005345 | Ga0070692_10702503 | Ga0070692_107025032 | 89 |
| 192 | 3300005347 | Ga0070668_100038491 | Ga0070668_1000384912 | 89 |
| 193 | 3300005347 | Ga0070668_101227131 | Ga0070668_1012271311 | 89 |
| 194 | 3300005353 | Ga0070669_100003009 | Ga0070669_10000300912 | 89 |
| 195 | 3300005354 | Ga0070675_100000581 | Ga0070675_10000058125 | 89 |
| 196 | 3300005355 | Ga0070671_100675716 | Ga0070671_1006757162 | 89 |
| 197 | 3300005356 | Ga0070674_100082355 | Ga0070674_1000823552 | 89 |
| 198 | 3300005356 | Ga0070674_100414906 | Ga0070674_1004149062 | 89 |
| 199 | 3300005364 | Ga0070673_100009576 | Ga0070673_1000095763 | 89 |
| 200 | 3300005364 | Ga0070673_100037311 | Ga0070673_1000373112 | 89 |
| 201 | 3300005365 | Ga0070688_100016244 | Ga0070688_1000162443 | 89 |
| 202 | 3300005365 | Ga0070688_100268346 | Ga0070688_1002683462 | 89 |
| 203 | 3300005367 | Ga0070667_100034154 | Ga0070667_1000341543 | 89 |
| 204 | 3300005438 | Ga0070701_10032840 | Ga0070701_100328403 | 89 |
| 205 | 3300005441 | Ga0070700_100564822 | Ga0070700_1005648222 | 89 |
| 206 | 3300005444 | Ga0070694_100356191 | Ga0070694_1003561912 | 89 |
| 207 | 3300005455 | Ga0070663_102009222 | Ga0070663_1020092222 | 89 |
| 208 | 3300005456 | Ga0070678_100404997 | Ga0070678_1004049972 | 89 |
| 209 | 3300005459 | Ga0068867_101166693 | Ga0068867_1011666931 | 89 |
| 210 | 3300005471 | Ga0070698_100223853 | Ga0070698_1002238532 | 89 |
| 211 | 3300005535 | Ga0070684_100001825 | Ga0070684_1000018259 | 89 |
| 212 | 3300005536 | Ga0070697_100518671 | Ga0070697_1005186712 | 89 |
| 213 | 3300005539 | Ga0068853_100478281 | Ga0068853_1004782813 | 89 |
| 214 | 3300005543 | Ga0070672_100035347 | Ga0070672_1000353472 | 89 |
| 215 | 3300005543 | Ga0070672_100228527 | Ga0070672_1002285272 | 89 |
| 216 | 3300005544 | Ga0070686_100039149 | Ga0070686_1000391492 | 89 |
| 217 | 3300005545 | Ga0070695_100242103 | Ga0070695_1002421032 | 89 |
| 218 | 3300005546 | Ga0070696_100427825 | Ga0070696_1004278251 | 89 |
| 219 | 3300005547 | Ga0070693_100435219 | Ga0070693_1004352192 | 89 |
| 220 | 3300005548 | Ga0070665_100780473 | Ga0070665_1007804732 | 89 |
| 221 | 3300005564 | Ga0070664_100002455 | Ga0070664_1000024556 | 89 |
| 222 | 3300005577 | Ga0068857_100014904 | Ga0068857_1000149043 | 89 |
| 223 | 3300005614 | Ga0068856_100169409 | Ga0068856_1001694092 | 89 |
| 224 | 3300005615 | Ga0070702_100004977 | Ga0070702_1000049773 | 89 |
| 225 | 3300005615 | Ga0070702_100079183 | Ga0070702_1000791831 | 89 |
| 226 | 3300005615 | Ga0070702_100136851 | Ga0070702_1001368512 | 89 |
| 227 | 3300005617 | Ga0068859_100004037 | Ga0068859_1000040373 | 89 |
| 228 | 3300005617 | Ga0068859_100076888 | Ga0068859_1000768885 | 89 |
| 229 | 3300005618 | Ga0068864_101539104 | Ga0068864_1015391042 | 89 |
| 230 | 3300005718 | Ga0068866_10057911 | Ga0068866_100579113 | 89 |
| 231 | 3300005718 | Ga0068866_10522648 | Ga0068866_105226482 | 89 |
| 232 | 3300005719 | Ga0068861_100035653 | Ga0068861_1000356534 | 89 |
| 233 | 3300005719 | Ga0068861_100162808 | Ga0068861_1001628082 | 89 |
| 234 | 3300005840 | Ga0068870_10013060 | Ga0068870_100130602 | 89 |
| 235 | 3300005840 | Ga0068870_10217385 | Ga0068870_102173852 | 89 |
| 236 | 3300005840 | Ga0068870_10805465 | Ga0068870_108054651 | 89 |
| 237 | 3300005841 | Ga0068863_100098183 | Ga0068863_1000981832 | 89 |
| 238 | 3300005842 | Ga0068858_100022837 | Ga0068858_1000228372 | 89 |
| 239 | 3300005843 | Ga0068860_100023002 | Ga0068860_1000230023 | 89 |
| 240 | 3300005844 | Ga0068862_100006355 | Ga0068862_1000063552 | 89 |
| 241 | 3300005844 | Ga0068862_100652000 | Ga0068862_1006520002 | 89 |
| 242 | 3300005844 | Ga0068862_100886379 | Ga0068862_1008863792 | 89 |
| 243 | 3300005985 | Ga0081539_10348996 | Ga0081539_103489962 | 89 |
| 244 | 3300006173 | Ga0070716_100089278 | Ga0070716_1000892782 | 89 |
| 245 | 3300006175 | Ga0070712_100257888 | Ga0070712_1002578882 | 89 |
| 246 | 3300006195 | Ga0075366_10551863 | Ga0075366_105518632 | 89 |
| 247 | 3300006237 | Ga0097621_100177480 | Ga0097621_1001774801 | 89 |
| 248 | 3300006844 | Ga0075428_100168993 | Ga0075428_1001689931 | 89 |
| 249 | 3300006844 | Ga0075428_100304589 | Ga0075428_1003045892 | 89 |
| 250 | 3300006846 | Ga0075430_100042601 | Ga0075430_1000426016 | 89 |
| 251 | 3300006846 | Ga0075430_100302308 | Ga0075430_1003023081 | 89 |
| 252 | 3300006846 | Ga0075430_100596527 | Ga0075430_1005965272 | 89 |
| 253 | 3300006846 | Ga0075430_101297628 | Ga0075430_1012976282 | 89 |
| 254 | 3300006847 | Ga0075431_100238240 | Ga0075431_1002382402 | 89 |
| 255 | 3300006852 | Ga0075433_10910354 | Ga0075433_109103541 | 89 |
| 256 | 3300006880 | Ga0075429_100192648 | Ga0075429_1001926482 | 89 |
| 257 | 3300006881 | Ga0068865_100029834 | Ga0068865_1000298343 | 89 |
| 258 | 3300006931 | Ga0097620_100004037 | Ga0097620_1000040373 | 89 |
| 259 | 3300006931 | Ga0097620_100076885 | Ga0097620_1000768852 | 89 |
| 260 | 3300009094 | Ga0111539_10340698 | Ga0111539_103406981 | 89 |
| 261 | 3300009094 | Ga0111539_12671231 | Ga0111539_126712311 | 89 |
| 262 | 3300009147 | Ga0114129_10219561 | Ga0114129_102195612 | 89 |
| 263 | 3300009147 | Ga0114129_10289560 | Ga0114129_102895602 | 89 |
| 264 | 3300009147 | Ga0114129_10649870 | Ga0114129_106498703 | 89 |
| 265 | 3300009148 | Ga0105243_10302806 | Ga0105243_103028062 | 89 |
| 266 | 3300009148 | Ga0105243_10351577 | Ga0105243_103515772 | 89 |
| 267 | 3300009174 | Ga0105241_10712681 | Ga0105241_107126812 | 89 |
| 268 | 3300009176 | Ga0105242_10636978 | Ga0105242_106369783 | 89 |
| 269 | 3300009177 | Ga0105248_10000636 | Ga0105248_1000063621 | 89 |
| 270 | 3300009177 | Ga0105248_10004282 | Ga0105248_100042826 | 89 |
| 271 | 3300009545 | Ga0105237_12023613 | Ga0105237_120236132 | 89 |
| 272 | 3300009553 | Ga0105249_10012608 | Ga0105249_100126083 | 89 |
| 273 | 3300009553 | Ga0105249_10049460 | Ga0105249_100494604 | 89 |
| 274 | 3300009553 | Ga0105249_10087890 | Ga0105249_100878904 | 89 |
| 275 | 3300010375 | Ga0105239_11918015 | Ga0105239_119180152 | 89 |
| 276 | 3300013296 | Ga0157374_10951378 | Ga0157374_109513782 | 89 |
| 277 | 3300013297 | Ga0157378_10702119 | Ga0157378_107021191 | 89 |
| 278 | 3300013297 | Ga0157378_11000734 | Ga0157378_110007342 | 89 |
| 279 | 3300013306 | Ga0163162_10031072 | Ga0163162_100310725 | 89 |
| 280 | 3300013306 | Ga0163162_10068330 | Ga0163162_100683304 | 89 |
| 281 | 3300013306 | Ga0163162_10706859 | Ga0163162_107068592 | 89 |
| 282 | 3300013306 | Ga0163162_10835794 | Ga0163162_108357942 | 89 |
| 283 | 3300013307 | Ga0157372_11215909 | Ga0157372_112159092 | 89 |
| 284 | 3300013308 | Ga0157375_10053214 | Ga0157375_100532143 | 89 |
| 285 | 3300014325 | Ga0163163_10015281 | Ga0163163_100152813 | 89 |
| 286 | 3300014325 | Ga0163163_11180384 | Ga0163163_111803841 | 89 |
| 287 | 3300014326 | Ga0157380_10171948 | Ga0157380_101719482 | 89 |
| 288 | 3300014745 | Ga0157377_10034964 | Ga0157377_100349642 | 89 |
| 289 | 3300014968 | Ga0157379_10056778 | Ga0157379_100567782 | 89 |
| 290 | 3300014968 | Ga0157379_10105286 | Ga0157379_101052863 | 89 |
| 291 | 3300025298 | Ga0209050_1008842 | Ga0209050_10088425 | 89 |
| 292 | 3300025893 | Ga0207682_10105785 | Ga0207682_101057852 | 89 |
| 293 | 3300025899 | Ga0207642_10068903 | Ga0207642_100689033 | 89 |
| 294 | 3300025903 | Ga0207680_10357690 | Ga0207680_103576902 | 89 |
| 295 | 3300025908 | Ga0207643_10014204 | Ga0207643_100142045 | 89 |
| 296 | 3300025908 | Ga0207643_10047702 | Ga0207643_100477023 | 89 |
| 297 | 3300025911 | Ga0207654_10350338 | Ga0207654_103503382 | 89 |
| 298 | 3300025911 | Ga0207654_10559554 | Ga0207654_105595541 | 89 |
| 299 | 3300025912 | Ga0207707_10649061 | Ga0207707_106490612 | 89 |
| 300 | 3300025914 | Ga0207671_10101181 | Ga0207671_101011813 | 89 |
| 301 | 3300025914 | Ga0207671_11217028 | Ga0207671_112170281 | 89 |
| 302 | 3300025917 | Ga0207660_10233759 | Ga0207660_102337592 | 89 |
| 303 | 3300025918 | Ga0207662_10002852 | Ga0207662_100028521 | 89 |
| 304 | 3300025923 | Ga0207681_10001608 | Ga0207681_100016082 | 89 |
| 305 | 3300025923 | Ga0207681_10183108 | Ga0207681_101831082 | 89 |
| 306 | 3300025926 | Ga0207659_10424912 | Ga0207659_104249122 | 89 |
| 307 | 3300025931 | Ga0207644_10003773 | Ga0207644_100037735 | 89 |
| 308 | 3300025933 | Ga0207706_10398173 | Ga0207706_103981732 | 89 |
| 309 | 3300025935 | Ga0207709_10137196 | Ga0207709_101371962 | 89 |
| 310 | 3300025935 | Ga0207709_10251868 | Ga0207709_102518683 | 89 |
| 311 | 3300025936 | Ga0207670_10014307 | Ga0207670_100143075 | 89 |
| 312 | 3300025937 | Ga0207669_10093276 | Ga0207669_100932763 | 89 |
| 313 | 3300025937 | Ga0207669_10686593 | Ga0207669_106865932 | 89 |
| 314 | 3300025938 | Ga0207704_10046716 | Ga0207704_100467163 | 89 |
| 315 | 3300025940 | Ga0207691_10003671 | Ga0207691_100036717 | 89 |
| 316 | 3300025940 | Ga0207691_10047646 | Ga0207691_100476463 | 89 |
| 317 | 3300025941 | Ga0207711_10015433 | Ga0207711_100154335 | 89 |
| 318 | 3300025941 | Ga0207711_10562045 | Ga0207711_105620452 | 89 |
| 319 | 3300025942 | Ga0207689_10002509 | Ga0207689_1000250916 | 89 |
| 320 | 3300025942 | Ga0207689_10266886 | Ga0207689_102668862 | 89 |
| 321 | 3300025945 | Ga0207679_10013866 | Ga0207679_100138662 | 89 |
| 322 | 3300025960 | Ga0207651_10033514 | Ga0207651_100335142 | 89 |
| 323 | 3300025961 | Ga0207712_10009436 | Ga0207712_100094365 | 89 |
| 324 | 3300025961 | Ga0207712_10013013 | Ga0207712_100130132 | 89 |
| 325 | 3300025972 | Ga0207668_10003776 | Ga0207668_100037764 | 89 |
| 326 | 3300025986 | Ga0207658_10026169 | Ga0207658_100261694 | 89 |
| 327 | 3300025986 | Ga0207658_10581213 | Ga0207658_105812132 | 89 |
| 328 | 3300026023 | Ga0207677_10796711 | Ga0207677_107967112 | 89 |
| 329 | 3300026035 | Ga0207703_10425674 | Ga0207703_104256742 | 89 |
| 330 | 3300026035 | Ga0207703_10514423 | Ga0207703_105144232 | 89 |
| 331 | 3300026041 | Ga0207639_10398820 | Ga0207639_103988203 | 89 |
| 332 | 3300026075 | Ga0207708_10020022 | Ga0207708_100200223 | 89 |
| 333 | 3300026075 | Ga0207708_10404611 | Ga0207708_104046112 | 89 |
| 334 | 3300026075 | Ga0207708_11164483 | Ga0207708_111644831 | 89 |
| 335 | 3300026078 | Ga0207702_10086249 | Ga0207702_100862492 | 89 |
| 336 | 3300026088 | Ga0207641_10740733 | Ga0207641_107407332 | 89 |
| 337 | 3300026088 | Ga0207641_12151105 | Ga0207641_121511052 | 89 |
| 338 | 3300026095 | Ga0207676_10010255 | Ga0207676_100102556 | 89 |
| 339 | 3300026116 | Ga0207674_10010706 | Ga0207674_100107063 | 89 |
| 340 | 3300026118 | Ga0207675_100000379 | Ga0207675_10000037931 | 89 |
| 341 | 3300026118 | Ga0207675_100007555 | Ga0207675_1000075558 | 89 |
| 342 | 3300026118 | Ga0207675_100072075 | Ga0207675_1000720752 | 89 |
| 343 | 3300026121 | Ga0207683_10046176 | Ga0207683_100461762 | 89 |
| 344 | 3300026121 | Ga0207683_10450055 | Ga0207683_104500552 | 89 |
| 345 | 3300026121 | Ga0207683_10606082 | Ga0207683_106060822 | 89 |
| 346 | 3300026142 | Ga0207698_10451074 | Ga0207698_104510742 | 89 |
| 347 | 3300028379 | Ga0268266_10267102 | Ga0268266_102671022 | 89 |
| 348 | 3300028380 | Ga0268265_10004332 | Ga0268265_1000433210 | 89 |
| 349 | 3300028380 | Ga0268265_10014122 | Ga0268265_100141225 | 89 |
| 350 | 3300028380 | Ga0268265_10175593 | Ga0268265_101755932 | 89 |
| 351 | 3300028380 | Ga0268265_10476244 | Ga0268265_104762443 | 89 |
| 352 | 3300028380 | Ga0268265_10737586 | Ga0268265_107375862 | 89 |
| 353 | 3300028381 | Ga0268264_11478685 | Ga0268264_114786851 | 89 |
| 354 | 3300031456 | Ga0307513_10695268 | Ga0307513_106952682 | 89 |
| 355 | 3300031548 | Ga0307408_100009479 | Ga0307408_1000094797 | 89 |
| 356 | 3300031548 | Ga0307408_100088952 | Ga0307408_1000889524 | 89 |
| 357 | 3300031548 | Ga0307408_100146352 | Ga0307408_1001463523 | 89 |
| 358 | 3300031731 | Ga0307405_10009652 | Ga0307405_100096522 | 89 |
| 359 | 3300031731 | Ga0307405_10128102 | Ga0307405_101281022 | 89 |
| 360 | 3300031731 | Ga0307405_10649690 | Ga0307405_106496902 | 89 |
| 361 | 3300031824 | Ga0307413_10012240 | Ga0307413_100122405 | 89 |
| 362 | 3300031852 | Ga0307410_10005256 | Ga0307410_100052565 | 89 |
| 363 | 3300031852 | Ga0307410_10039742 | Ga0307410_100397423 | 89 |
| 364 | 3300031901 | Ga0307406_10011920 | Ga0307406_100119205 | 89 |
| 365 | 3300031901 | Ga0307406_10427349 | Ga0307406_104273492 | 89 |
| 366 | 3300031901 | Ga0307406_11076878 | Ga0307406_110768782 | 89 |
| 367 | 3300031901 | Ga0307406_11915396 | Ga0307406_119153962 | 89 |
| 368 | 3300031903 | Ga0307407_10001575 | Ga0307407_100015756 | 89 |
| 369 | 3300031911 | Ga0307412_10181258 | Ga0307412_101812582 | 89 |
| 370 | 3300031995 | Ga0307409_100001882 | Ga0307409_1000018821 | 89 |
| 371 | 3300032002 | Ga0307416_100009444 | Ga0307416_1000094446 | 89 |
| 372 | 3300032002 | Ga0307416_100035293 | Ga0307416_1000352932 | 89 |
| 373 | 3300032002 | Ga0307416_100061350 | Ga0307416_1000613502 | 89 |
| 374 | 3300032002 | Ga0307416_100924428 | Ga0307416_1009244282 | 89 |
| 375 | 3300032004 | Ga0307414_10166682 | Ga0307414_101666823 | 89 |
| 376 | 3300032004 | Ga0307414_10548552 | Ga0307414_105485522 | 89 |
| 377 | 3300032005 | Ga0307411_10095695 | Ga0307411_100956952 | 89 |
| 378 | 3300032005 | Ga0307411_11325592 | Ga0307411_113255922 | 89 |
| 379 | 3300032126 | Ga0307415_100056336 | Ga0307415_1000563362 | 89 |
| 380 | 3300032126 | Ga0307415_101249806 | Ga0307415_1012498062 | 89 |
| 381 | 3300035112 | Ga0373932_0288076 | Ga0373932_0288076_224_493 | 89 |
| 382 | 3300035115 | Ga0373941_0244790 | Ga0373941_0244790_347_616 | 89 |
| 383 | 3300035121 | Ga0373960_0002196 | Ga0373960_0002196_2845_3117 | 89 |
| 384 | 3300035242 | Ga0373962_0112976 | Ga0373962_0112976_556_825 | 89 |
| 385 | 3300035691 | Ga0373931_0076294 | Ga0373931_0076294_1364_1633 | 89 |
| 386 | 3300038996 | Ga0242420_000748 | Ga0242420_000748_2365_2634 | 89 |
| 387 | 3300041408 | Ga0439453_0071279 | Ga0439453_0071279_197_469 | 89 |
| 388 | 3300042002 | Ga0439442_055383 | Ga0439442_055383_108_377 | 89 |
| 389 | 3300042005 | Ga0439448_0099831 | Ga0439448_0099831_691_960 | 89 |
| 390 | 3300042012 | Ga0439455_0017839 | Ga0439455_0017839_1077_1346 | 89 |
| 391 | 3300042133 | Ga0450896_002793 | Ga0450896_002793_255_524 | 89 |
| 392 | 3300042437 | Ga0439444_0150970 | Ga0439444_0150970_203_487 | 89 |
| 393 | 3300045051 | Ga0451576_0106963 | Ga0451576_0106963_1952_2221 | 89 |
| 394 | 3300045051 | Ga0451576_0972393 | Ga0451576_0972393_327_602 | 89 |
| 395 | 3300046473 | Ga0495582_0863179 | Ga0495582_0863179_58_327 | 89 |
| 396 | 3300046535 | Ga0495586_0299005 | Ga0495586_0299005_40_309 | 89 |
| 397 | 3300046537 | Ga0495598_0038062 | Ga0495598_0038062_206_478 | 89 |
| 398 | 3300048904 | Ga0496101_0080332 | Ga0496101_0080332_537_806 | 89 |
| 399 | 3300048905 | Ga0496102_0117853 | Ga0496102_0117853_1339_1608 | 89 |
| 400 | 3300048906 | Ga0496103_0597515 | Ga0496103_0597515_193_462 | 89 |
| 401 | 3300048907 | Ga0496104_0143262 | Ga0496104_0143262_875_1144 | 89 |
| 402 | 3300048907 | Ga0496104_0918471 | Ga0496104_0918471_490_759 | 89 |
| 403 | 3300048908 | Ga0496105_0178423 | Ga0496105_0178423_242_511 | 89 |
| 404 | 3300048909 | Ga0496106_0149159 | Ga0496106_0149159_129_398 | 89 |
| 405 | 3300048909 | Ga0496106_0172690 | Ga0496106_0172690_1148_1417 | 89 |
| 406 | 3300048910 | Ga0496107_0186255 | Ga0496107_0186255_336_605 | 89 |
| 407 | 3300048910 | Ga0496107_0871744 | Ga0496107_0871744_236_505 | 89 |
| 408 | 3300048911 | Ga0496108_0255943 | Ga0496108_0255943_206_475 | 89 |
| 409 | 3300048911 | Ga0496108_0954302 | Ga0496108_0954302_417_686 | 89 |
| 410 | 3300048912 | Ga0496109_0076344 | Ga0496109_0076344_497_766 | 89 |
| 411 | 3300048913 | Ga0496110_0132355 | Ga0496110_0132355_1160_1429 | 89 |
| 412 | 3300048913 | Ga0496110_0165158 | Ga0496110_0165158_328_597 | 89 |
| 413 | 3300048916 | Ga0496113_0171390 | Ga0496113_0171390_614_883 | 89 |
| 414 | 3300049516 | Ga0501293_013273 | Ga0501293_013273_33_347 | 89 |
| 415 | 3300049520 | Ga0501297_054392 | Ga0501297_054392_169_438 | 89 |
| 416 | 3300049521 | Ga0501298_101013 | Ga0501298_101013_201_515 | 89 |
| 417 | 3300049583 | Ga0501067_0066297 | Ga0501067_0066297_1138_1413 | 89 |
| 418 | 3300049585 | Ga0501069_0108143 | Ga0501069_0108143_602_877 | 89 |
| 419 | 3300049649 | Ga0501198_077886 | Ga0501198_077886_88_402 | 89 |
| 420 | 3300049655 | Ga0501208_106656 | Ga0501208_106656_103_372 | 89 |
| 421 | 3300049661 | Ga0501217_168929 | Ga0501217_168929_26_340 | 89 |
| 422 | 3300049668 | Ga0501233_263418 | Ga0501233_263418_147_416 | 89 |
| 423 | 3300049672 | Ga0501239_005908 | Ga0501239_005908_195_509 | 89 |
| 424 | 3300049676 | Ga0501246_023002 | Ga0501246_023002_314_628 | 89 |
| 425 | 3300049679 | Ga0501249_005737 | Ga0501249_005737_2048_2362 | 89 |
| 426 | 3300049679 | Ga0501249_069116 | Ga0501249_069116_496_765 | 89 |
| 427 | 3300049679 | Ga0501249_105372 | Ga0501249_105372_140_430 | 89 |
| 428 | 3300049683 | Ga0501253_162470 | Ga0501253_162470_109_423 | 89 |
| 429 | 3300049686 | Ga0501257_131264 | Ga0501257_131264_299_589 | 89 |
| 430 | 3300049760 | Ga0501263_088308 | Ga0501263_088308_111_425 | 89 |
| 431 | 3300049765 | Ga0501268_089930 | Ga0501268_089930_44_334 | 89 |
| 432 | 3300049770 | Ga0501273_074201 | Ga0501273_074201_139_429 | 89 |
| 433 | 3300049776 | Ga0501280_089126 | Ga0501280_089126_88_402 | 89 |
| 434 | 3300049779 | Ga0501283_049400 | Ga0501283_049400_196_510 | 89 |
| 435 | 3300050493 | nmdc:mga0k408_754948_c1 | nmdc:mga0k408_754948_c1_168_437 | 89 |
| 436 | 3300050507 | nmdc:mga05p37_40907_c1 | nmdc:mga05p37_40907_c1_2190_2462 | 89 |
| 437 | 3300050507 | nmdc:mga05p37_796716_c1 | nmdc:mga05p37_796716_c1_305_574 | 89 |
| 438 | 3300050508 | nmdc:mga09592_183753_c1 | nmdc:mga09592_183753_c1_561_833 | 89 |
| 439 | 3300050509 | nmdc:mga0qj67_194579_c1 | nmdc:mga0qj67_194579_c1_227_499 | 89 |
| 440 | 3300050509 | nmdc:mga0qj67_25434_c1 | nmdc:mga0qj67_25434_c1_1532_1801 | 89 |
| 441 | 3300050509 | nmdc:mga0qj67_984837_c1 | nmdc:mga0qj67_984837_c1_82_351 | 89 |
| 442 | 3300050510 | nmdc:mga06r32_841124_c1 | nmdc:mga06r32_841124_c1_533_805 | 89 |
| 443 | 3300050510 | nmdc:mga06r32_898479_c1 | nmdc:mga06r32_898479_c1_168_437 | 89 |
| 444 | 3300050511 | nmdc:mga08y16_522698_c1 | nmdc:mga08y16_522698_c1_159_428 | 89 |
| 445 | 3300050511 | nmdc:mga08y16_97571_c1 | nmdc:mga08y16_97571_c1_1442_1711 | 89 |
| 446 | 3300050515 | nmdc:mga0a205_782444_c1 | nmdc:mga0a205_782444_c1_474_743 | 89 |
| 447 | 3300053156 | Ga0500622_0000020 | Ga0500622_0000020_252871_253152 | 89 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8854 | 5 | 88 |
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8222 | 5 | 88 |
| 4zux-assembly1.cif.gz_Z | saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome | 0.816 | 20 | 88 |
| 4fk5-assembly1.cif.gz_A | structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module | 0.8106 | 21 | 88 |
| 6aqr-assembly1.cif.gz_A | saga dub module ubp8(c146a)/sgf11/sus1/sgf73 bound to monoubiquitin | 0.8103 | 21 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MCC9_211_290_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9027 | 35 | 87 | 3.30.40.10 |
| 2idaA01 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8854 | 5 | 88 | 3.30.40.10 |
| af_A4IA95_233_330_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8777 | 22 | 89 | 3.30.40.10 |
| af_Q4DD96_272_345_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8731 | 20 | 87 | 3.30.40.10 |
| af_A4HRG6_422_490_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8705 | 22 | 86 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5ZUY0-F1-model_v4 | UBP-type domain-containing protein | 0.9954 | 6 | 89 |
GO:0008270
|
| AF-A0A1G9GPU1-F1-model_v4 | Ubiquitin-hydrolase Zn-finger-containing protein | 0.9953 | 2 | 89 |
GO:0008270
GO:0016787 |
| AF-A0A2V6MP59-F1-model_v4 | UBP-type domain-containing protein | 0.9949 | 6 | 89 |
GO:0008270
|
| AF-A0A538NRT0-F1-model_v4 | UBP-type zinc finger domain-containing protein | 0.9924 | 22 | 89 |
GO:0008270
|
| AF-A0A2G5KCF3-F1-model_v4 | UBP-type domain-containing protein | 0.9903 | 5 | 89 |
GO:0008270
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar