F445709

General Info

Members Datasets Scaffolds Average Seq Length
446 194 892 475

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10261266|Ga0111539_102612662
Length 510
Sequence LPKLKTCEFQPANFERAVPMIHLPILRQGVPYKSLDVVTVPHYQTRQPFVDISQANAGLIRRDLRPERQASARQALARIPFERLIAMCSEAADHFLNDTLPLGDAEQAPADYVLQLSATTGMPHALVRRNMQRVAGVMREMQTVLGGLTRGLDLSVLDTGHGRHEGHVLSFYPRTDALGVVLPSNSPGVHSLWVPAIALKIPLVMKPGSAEPWTPFRIAQAFMKAGCPPEAFSYYPADHAGAGEILRRTGRSMFFGDVSAVGGWEGDPRVELHGPGYSKILIADDLLEGDAWMQHLDLIAGSIADNGGRSCVNASGVWVAASHAERVAEAVAAKLAAIVPRAADDERATLAPFADPRVAERISAQIDTGLQTAGAREVTLDHRPTPRLATFAGSTYLQPTVVWCDSPEHPLANREFLFPYAAVVGVTSEQMAQMPAAMGKTLVVTALTRDRGLVSRLLGSSLVDRLNVGPIQTNQISWDQPHEGNLFEHLYARRSFQHHAEAALAASGNA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
148 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
177 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 1.57
Rhizosphere 96.64
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10261266 3300009094 Bacteria 2015
2 JGI24751J29686_10000017 3300002459 Bacteria 109415
3 JGI25406J46586_10008775 3300003203 Bacteria 4554
4 Ga0065714_10002213 3300005288 Bacteria 57489
5 Ga0065704_10002984 3300005289 Bacteria 10131
6 Ga0065704_10103463 3300005289 Unclassified 2171
7 Ga0065712_10000144 3300005290 Bacteria 54862
8 Ga0065715_10002428 3300005293 Bacteria 5529
9 Ga0065715_10089504 3300005293 Bacteria 9808
10 Ga0065715_10136792 3300005293 Bacteria 1917
11 Ga0065707_10003348 3300005295 Bacteria 6561
12 Ga0065707_10005788 3300005295 Unclassified 3588
13 Ga0070690_100008883 3300005330 Bacteria 5804
14 Ga0070690_100019400 3300005330 Bacteria 4126
15 Ga0070670_100000761 3300005331 Bacteria 25034
16 Ga0070670_100002102 3300005331 Bacteria 16329
17 Ga0070670_100008471 3300005331 Bacteria 8770
18 Ga0070670_100015172 3300005331 Bacteria 6612
19 Ga0070670_100039845 3300005331 Bacteria 4040
20 Ga0070670_100244270 3300005331 Unclassified 1563
21 Ga0068869_100123417 3300005334 Bacteria 1984
22 Ga0070680_100004103 3300005336 Bacteria 10909
23 Ga0070680_100051816 3300005336 Bacteria 3350
24 Ga0070680_100095743 3300005336 Bacteria 2462
25 Ga0070682_100000059 3300005337 Bacteria 106643
26 Ga0070682_100005386 3300005337 Bacteria 7122
27 Ga0070682_100024748 3300005337 Bacteria 3576
28 Ga0068868_100035000 3300005338 Bacteria 3880
29 Ga0070660_100026314 3300005339 Bacteria 4330
30 Ga0070689_100006223 3300005340 Bacteria 8240
31 Ga0070689_100007077 3300005340 Bacteria 7812
32 Ga0070689_100066198 3300005340 Bacteria 2815
33 Ga0070689_100116039 3300005340 Bacteria 2135
34 Ga0070689_100134650 3300005340 Unclassified 1984
35 Ga0070661_100056457 3300005344 Bacteria 2877
36 Ga0070692_10030500 3300005345 Bacteria 2696
37 Ga0070669_100002600 3300005353 Bacteria 13049
38 Ga0070669_100004869 3300005353 Bacteria 9688
39 Ga0070669_100036945 3300005353 Bacteria 3541
40 Ga0070669_100037865 3300005353 Bacteria 3500
41 Ga0070675_100069251 3300005354 Bacteria 2923
42 Ga0070675_100093613 3300005354 Bacteria 2520
43 Ga0070675_100193532 3300005354 Bacteria 1763
44 Ga0070671_100002555 3300005355 Bacteria 14102
45 Ga0070671_100014020 3300005355 Bacteria 6472
46 Ga0070671_100042978 3300005355 Bacteria 3758
47 Ga0070674_100008722 3300005356 Bacteria 6048
48 Ga0070674_100156104 3300005356 Bacteria 1727
49 Ga0070673_100004270 3300005364 Bacteria 9018
50 Ga0070673_100061136 3300005364 Bacteria 2987
51 Ga0070673_100247993 3300005364 Bacteria 1551
52 Ga0070667_100195166 3300005367 Bacteria 1795
53 Ga0070703_10001621 3300005406 Bacteria 6694
54 Ga0070705_100016967 3300005440 Bacteria 3793
55 Ga0070705_100065058 3300005440 Bacteria 2181
56 Ga0070705_100119867 3300005440 Bacteria 1697
57 Ga0070700_100000308 3300005441 Bacteria 25453
58 Ga0070700_100003350 3300005441 Bacteria 8265
59 Ga0070700_100008043 3300005441 Bacteria 5732
60 Ga0070700_100013664 3300005441 Bacteria 4564
61 Ga0070694_100001085 3300005444 Bacteria 15586
62 Ga0070694_100007541 3300005444 Bacteria 6640
63 Ga0070694_100010419 3300005444 Bacteria 5736
64 Ga0070694_100066785 3300005444 Bacteria 2468
65 Ga0070694_100067610 3300005444 Bacteria 2453
66 Ga0070694_100074483 3300005444 Bacteria 2347
67 Ga0070694_100182876 3300005444 Bacteria 1551
68 Ga0070663_100027374 3300005455 Bacteria 3871
69 Ga0070663_100031865 3300005455 Bacteria 3627
70 Ga0070678_100205324 3300005456 Bacteria 1629
71 Ga0070662_100157756 3300005457 Bacteria 1772
72 Ga0070681_10000254 3300005458 Bacteria 42307
73 Ga0070681_10000807 3300005458 Bacteria 26154
74 Ga0070681_10088091 3300005458 Bacteria 3057
75 Ga0068867_100015512 3300005459 Bacteria 5406
76 Ga0070706_100000088 3300005467 Bacteria 107818
77 Ga0070706_100010705 3300005467 Bacteria 8514
78 Ga0070707_100018867 3300005468 Bacteria 6495
79 Ga0070698_100004385 3300005471 Bacteria 15500
80 Ga0070698_100008286 3300005471 Bacteria 11235
81 Ga0070698_100010486 3300005471 Bacteria 9884
82 Ga0070698_100026408 3300005471 Bacteria 6044
83 Ga0070698_100085489 3300005471 Bacteria 3141
84 Ga0070698_100232444 3300005471 Unclassified 1777
85 Ga0070699_100002231 3300005518 Bacteria 17500
86 Ga0070679_100000029 3300005530 Bacteria 108401
87 Ga0070697_100000018 3300005536 Bacteria 140702
88 Ga0070697_100000293 3300005536 Bacteria 40046
89 Ga0070697_100052367 3300005536 Bacteria 3317
90 Ga0068853_100063487 3300005539 Bacteria 3199
91 Ga0070686_100030024 3300005544 Unclassified 3312
92 Ga0070695_100041458 3300005545 Bacteria 2918
93 Ga0070695_100042997 3300005545 Bacteria 2871
94 Ga0070695_100067960 3300005545 Bacteria 2326
95 Ga0070695_100075760 3300005545 Bacteria 2214
96 Ga0070695_100161812 3300005545 Unclassified 1572
97 Ga0070696_100012327 3300005546 Bacteria 5734
98 Ga0070693_100029427 3300005547 Bacteria 2996
99 Ga0070693_100085238 3300005547 Bacteria 1893
100 Ga0070704_100005514 3300005549 Bacteria 7375
101 Ga0070704_100010237 3300005549 Bacteria 5701
102 Ga0070704_100047046 3300005549 Bacteria 3013
103 Ga0070704_100075474 3300005549 Unclassified 2463
104 Ga0068855_100006411 3300005563 Bacteria 14323
105 Ga0070664_100001444 3300005564 Bacteria 18958
106 Ga0068857_100004076 3300005577 Bacteria 12305
107 Ga0068857_100031985 3300005577 Bacteria 4650
108 Ga0068857_100242153 3300005577 Unclassified 1652
109 Ga0068856_100019538 3300005614 Bacteria 6576
110 Ga0070702_100012671 3300005615 Bacteria 4235
111 Ga0068859_100004015 3300005617 Bacteria 14999
112 Ga0068859_100006232 3300005617 Bacteria 12108
113 Ga0068859_100008500 3300005617 Bacteria 10390
114 Ga0068859_100021079 3300005617 Bacteria 6539
115 Ga0068859_100027598 3300005617 Bacteria 5694
116 Ga0068864_100022782 3300005618 Bacteria 5253
117 Ga0068864_100066672 3300005618 Bacteria 3125
118 Ga0068864_100072855 3300005618 Unclassified 2994
119 Ga0068864_100171311 3300005618 Unclassified 1979
120 Ga0068864_100196575 3300005618 Bacteria 1851
121 Ga0068861_100011701 3300005719 Bacteria 6106
122 Ga0068861_100048610 3300005719 Unclassified 3208
123 Ga0068861_100095681 3300005719 Bacteria 2352
124 Ga0068861_100103424 3300005719 Bacteria 2270
125 Ga0068861_100178591 3300005719 Unclassified 1765
126 Ga0068851_10020073 3300005834 Bacteria 3232
127 Ga0068863_100173034 3300005841 Bacteria 2072
128 Ga0068858_100057473 3300005842 Bacteria 3595
129 Ga0068858_100076486 3300005842 Bacteria 3108
130 Ga0068858_100212500 3300005842 Bacteria 1831
131 Ga0068860_100028378 3300005843 Bacteria 5386
132 Ga0068860_100048220 3300005843 Bacteria 4059
133 Ga0068860_100069825 3300005843 Bacteria 3339
134 Ga0068862_100044848 3300005844 Bacteria 3771
135 Ga0068862_100073369 3300005844 Unclassified 2957
136 Ga0081539_10001175 3300005985 Bacteria 47406
137 Ga0081539_10002761 3300005985 Bacteria 23639
138 Ga0081539_10003574 3300005985 Bacteria 18868
139 Ga0075364_10025354 3300006051 Bacteria 3774
140 Ga0075364_10136613 3300006051 Bacteria 1647
141 Ga0070716_100039173 3300006173 Bacteria 2629
142 Ga0075367_10026763 3300006178 Bacteria 3274
143 Ga0075367_10061927 3300006178 Bacteria 2234
144 Ga0068871_100002635 3300006358 Bacteria 12247
145 Ga0068871_100007595 3300006358 Bacteria 7752
146 Ga0075428_100002028 3300006844 Bacteria 21834
147 Ga0075428_100013643 3300006844 Bacteria 9048
148 Ga0075428_100024924 3300006844 Bacteria 6617
149 Ga0075428_100046177 3300006844 Bacteria 4785
150 Ga0075428_100102298 3300006844 Bacteria 3124
151 Ga0075428_100149689 3300006844 Unclassified 2535
152 Ga0075430_100000917 3300006846 Bacteria 23149
153 Ga0075430_100001495 3300006846 Bacteria 19069
154 Ga0075430_100019829 3300006846 Bacteria 5719
155 Ga0075430_100042541 3300006846 Bacteria 3841
156 Ga0075430_100145779 3300006846 Bacteria 1972
157 Ga0075431_100002545 3300006847 Bacteria 17595
158 Ga0075431_100046745 3300006847 Bacteria 4464
159 Ga0075431_100061441 3300006847 Bacteria 3876
160 Ga0075431_100290272 3300006847 Bacteria 1655
161 Ga0075433_10017765 3300006852 Bacteria 5901
162 Ga0075433_10020442 3300006852 Bacteria 5535
163 Ga0075433_10068809 3300006852 Bacteria 3108
164 Ga0075433_10088075 3300006852 Bacteria 2743
165 Ga0075433_10124332 3300006852 Unclassified 2291
166 Ga0075433_10226989 3300006852 Bacteria 1658
167 Ga0075434_100146261 3300006871 Unclassified 2384
168 Ga0075434_100227926 3300006871 Unclassified 1883
169 Ga0075429_100002259 3300006880 Bacteria 16140
170 Ga0075429_100003266 3300006880 Bacteria 13816
171 Ga0075429_100012444 3300006880 Bacteria 7382
172 Ga0075429_100047324 3300006880 Unclassified 3741
173 Ga0075429_100113385 3300006880 Bacteria 2370
174 Ga0097620_100004015 3300006931 Bacteria 14999
175 Ga0097620_100006233 3300006931 Bacteria 12108
176 Ga0097620_100008500 3300006931 Bacteria 10390
177 Ga0097620_100021079 3300006931 Bacteria 6539
178 Ga0097620_100027598 3300006931 Bacteria 5694
179 Ga0075435_100060161 3300007076 Bacteria 3079
180 Ga0075435_100084836 3300007076 Unclassified 2607
181 Ga0105240_10178245 3300009093 Bacteria 2510
182 Ga0111539_10000530 3300009094 Bacteria 48418
183 Ga0111539_10005553 3300009094 Bacteria 16309
184 Ga0111539_10008122 3300009094 Bacteria 13368
185 Ga0111539_10010118 3300009094 Bacteria 11883
186 Ga0111539_10031647 3300009094 Bacteria 6427
187 Ga0111539_10037387 3300009094 Bacteria 5863
188 Ga0111539_10056776 3300009094 Bacteria 4652
189 Ga0111539_10061027 3300009094 Bacteria 4467
190 Ga0111539_10116083 3300009094 Bacteria 3139
191 Ga0111539_10142186 3300009094 Bacteria 2809
192 Ga0111539_10153240 3300009094 Unclassified 2697
193 Ga0111539_10160113 3300009094 Bacteria 2633
194 Ga0111539_10268312 3300009094 Unclassified 1987
195 Ga0105245_10009600 3300009098 Bacteria 8439
196 Ga0105245_10059045 3300009098 Unclassified 3453
197 Ga0105247_10000421 3300009101 Bacteria 36009
198 Ga0114129_10000204 3300009147 Bacteria 65893
199 Ga0114129_10007241 3300009147 Bacteria 15797
200 Ga0114129_10021219 3300009147 Bacteria 9223
201 Ga0114129_10035854 3300009147 Bacteria 7005
202 Ga0114129_10054854 3300009147 Bacteria 5586
203 Ga0114129_10069560 3300009147 Bacteria 4907
204 Ga0114129_10086380 3300009147 Bacteria 4351
205 Ga0114129_10210177 3300009147 Bacteria 2631
206 Ga0114129_10231552 3300009147 Bacteria 2488
207 Ga0114129_10248838 3300009147 Unclassified 2387
208 Ga0114129_10268413 3300009147 Bacteria 2284
209 Ga0114129_10287133 3300009147 Bacteria 2197
210 Ga0105243_10000044 3300009148 Bacteria 156661
211 Ga0105243_10010518 3300009148 Bacteria 7025
212 Ga0105243_10048990 3300009148 Unclassified 3332
213 Ga0105242_10000012 3300009176 Bacteria 136893
214 Ga0105248_10019375 3300009177 Bacteria 7530
215 Ga0105248_10021504 3300009177 Bacteria 7147
216 Ga0105248_10023543 3300009177 Bacteria 6841
217 Ga0105248_10028957 3300009177 Bacteria 6175
218 Ga0105248_10036906 3300009177 Bacteria 5466
219 Ga0105248_10049157 3300009177 Bacteria 4730
220 Ga0105248_10054584 3300009177 Bacteria 4481
221 Ga0105248_10160016 3300009177 Unclassified 2540
222 Ga0105248_10226107 3300009177 Bacteria 2106
223 Ga0105237_10000438 3300009545 Bacteria 59334
224 Ga0105238_10012805 3300009551 Bacteria 8464
225 Ga0105249_10000201 3300009553 Bacteria 68199
226 Ga0105249_10006943 3300009553 Bacteria 9873
227 Ga0105249_10030801 3300009553 Bacteria 4850
228 Ga0105249_10035974 3300009553 Unclassified 4492
229 Ga0105249_10039509 3300009553 Bacteria 4285
230 Ga0105246_10059825 3300011119 Bacteria 2645
231 Ga0157373_10004729 3300013100 Bacteria 10238
232 Ga0157378_10021347 3300013297 Bacteria 5693
233 Ga0163162_10000128 3300013306 Bacteria 68199
234 Ga0163162_10019473 3300013306 Bacteria 6658
235 Ga0163162_10060812 3300013306 Bacteria 3814
236 Ga0157375_10063350 3300013308 Unclassified 3678
237 Ga0163163_10002106 3300014325 Bacteria 16799
238 Ga0163163_10004294 3300014325 Bacteria 12140
239 Ga0163163_10054226 3300014325 Bacteria 3961
240 Ga0163163_10059828 3300014325 Bacteria 3770
241 Ga0163163_10145345 3300014325 Bacteria 2415
242 Ga0163163_10155411 3300014325 Unclassified 2332
243 Ga0163163_10230136 3300014325 Bacteria 1903
244 Ga0157380_10000470 3300014326 Bacteria 24591
245 Ga0157380_10029215 3300014326 Unclassified 4213
246 Ga0157380_10029502 3300014326 Bacteria 4192
247 Ga0157380_10029718 3300014326 Bacteria 4179
248 Ga0157377_10068740 3300014745 Bacteria 2042
249 Ga0207697_10001751 3300025315 Bacteria 11667
250 Ga0207697_10022501 3300025315 Bacteria 2582
251 Ga0207656_10013023 3300025321 Bacteria 3170
252 Ga0207653_10001864 3300025885 Bacteria 6745
253 Ga0207642_10030385 3300025899 Unclassified 2250
254 Ga0207710_10000553 3300025900 Bacteria 22414
255 Ga0207688_10000902 3300025901 Bacteria 14997
256 Ga0207647_10016890 3300025904 Bacteria 4970
257 Ga0207643_10004553 3300025908 Bacteria 7445
258 Ga0207684_10000170 3300025910 Bacteria 107800
259 Ga0207684_10095122 3300025910 Unclassified 2542
260 Ga0207654_10125781 3300025911 Bacteria 1616
261 Ga0207707_10000060 3300025912 Bacteria 108561
262 Ga0207707_10062036 3300025912 Bacteria 3253
263 Ga0207695_10149263 3300025913 Bacteria 2278
264 Ga0207671_10001676 3300025914 Bacteria 25161
265 Ga0207652_10000073 3300025921 Bacteria 108588
266 Ga0207646_10091972 3300025922 Bacteria 2715
267 Ga0207681_10010142 3300025923 Bacteria 5767
268 Ga0207681_10011147 3300025923 Bacteria 5521
269 Ga0207681_10011236 3300025923 Bacteria 5500
270 Ga0207681_10087135 3300025923 Unclassified 2221
271 Ga0207681_10173898 3300025923 Unclassified 1634
272 Ga0207694_10010874 3300025924 Bacteria 6870
273 Ga0207694_10015806 3300025924 Bacteria 5696
274 Ga0207650_10000005 3300025925 Bacteria 663190
275 Ga0207650_10002542 3300025925 Bacteria 12654
276 Ga0207650_10010275 3300025925 Bacteria 6416
277 Ga0207650_10013570 3300025925 Bacteria 5643
278 Ga0207659_10151397 3300025926 Bacteria 1812
279 Ga0207687_10042903 3300025927 Unclassified 3115
280 Ga0207690_10031533 3300025932 Unclassified 3393
281 Ga0207686_10000445 3300025934 Bacteria 27617
282 Ga0207709_10000029 3300025935 Bacteria 333327
283 Ga0207709_10004720 3300025935 Bacteria 7831
284 Ga0207709_10064057 3300025935 Bacteria 2306
285 Ga0207670_10003377 3300025936 Bacteria 8472
286 Ga0207670_10023215 3300025936 Bacteria 3858
287 Ga0207669_10090145 3300025937 Unclassified 1993
288 Ga0207665_10029076 3300025939 Bacteria 3655
289 Ga0207711_10013354 3300025941 Bacteria 6822
290 Ga0207711_10053846 3300025941 Bacteria 3451
291 Ga0207711_10218790 3300025941 Unclassified 1741
292 Ga0207689_10107637 3300025942 Bacteria 2291
293 Ga0207667_10332224 3300025949 Bacteria 1552
294 Ga0207651_10096360 3300025960 Bacteria 2182
295 Ga0207712_10001036 3300025961 Bacteria 19681
296 Ga0207712_10069079 3300025961 Bacteria 2534
297 Ga0207712_10107211 3300025961 Unclassified 2088
298 Ga0207677_10168193 3300026023 Bacteria 1711
299 Ga0207703_10024114 3300026035 Bacteria 4786
300 Ga0207703_10122309 3300026035 Bacteria 2236
301 Ga0207639_10061021 3300026041 Bacteria 2910
302 Ga0207678_10047816 3300026067 Bacteria 3699
303 Ga0207708_10000043 3300026075 Bacteria 121725
304 Ga0207708_10001112 3300026075 Bacteria 20185
305 Ga0207708_10019983 3300026075 Bacteria 5050
306 Ga0207708_10022614 3300026075 Bacteria 4748
307 Ga0207708_10043935 3300026075 Bacteria 3405
308 Ga0207708_10096941 3300026075 Bacteria 2279
309 Ga0207641_10009900 3300026088 Bacteria 7847
310 Ga0207641_10042650 3300026088 Bacteria 3807
311 Ga0207641_10234627 3300026088 Bacteria 1707
312 Ga0207648_10050104 3300026089 Unclassified 3652
313 Ga0207648_10083319 3300026089 Bacteria 2789
314 Ga0207676_10049101 3300026095 Unclassified 3280
315 Ga0207674_10000332 3300026116 Bacteria 60296
316 Ga0207674_10010508 3300026116 Bacteria 10477
317 Ga0207674_10083668 3300026116 Bacteria 3190
318 Ga0207674_10146812 3300026116 Bacteria 2317
319 Ga0207675_100071967 3300026118 Unclassified 3233
320 Ga0207675_100073154 3300026118 Bacteria 3207
321 Ga0207675_100093516 3300026118 Bacteria 2828
322 Ga0207675_100096697 3300026118 Unclassified 2780
323 Ga0207675_100127074 3300026118 Unclassified 2415
324 Ga0207675_100130615 3300026118 Bacteria 2382
325 Ga0207675_100195632 3300026118 Bacteria 1941
326 Ga0207683_10026091 3300026121 Bacteria 5045
327 Ga0207698_10108212 3300026142 Bacteria 2323
328 Ga0207428_10002189 3300027907 Bacteria 19643
329 Ga0207428_10002464 3300027907 Bacteria 18487
330 Ga0207428_10034521 3300027907 Unclassified 4144
331 Ga0207428_10125386 3300027907 Unclassified 1967
332 Ga0268265_10044896 3300028380 Bacteria 3294
333 Ga0268265_10087271 3300028380 Bacteria 2482
334 Ga0268265_10228006 3300028380 Bacteria 1635
335 Ga0268264_10032662 3300028381 Bacteria 4271
336 Ga0268264_10107395 3300028381 Bacteria 2438
337 Ga0307513_10004715 3300031456 Bacteria 18133
338 Ga0307408_100035181 3300031548 Bacteria 3513
339 Ga0307408_100041313 3300031548 Unclassified 3269
340 Ga0316576_10000684 3300031727 Bacteria 16603
341 Ga0307405_10013135 3300031731 Bacteria 4410
342 Ga0307405_10036961 3300031731 Bacteria 2931
343 Ga0307406_10003367 3300031901 Bacteria 8711
344 Ga0307406_10034548 3300031901 Bacteria 3102
345 Ga0307409_100052567 3300031995 Bacteria 3125
346 Ga0307416_100024713 3300032002 Bacteria 4391
347 Ga0307416_100076644 3300032002 Bacteria 2804
348 Ga0307416_100094632 3300032002 Bacteria 2577
349 Ga0307416_100095945 3300032002 Bacteria 2562
350 Ga0307416_100151437 3300032002 Bacteria 2128
351 Ga0307416_100207705 3300032002 Bacteria 1865
352 Ga0307414_10005530 3300032004 Bacteria 6966
353 Ga0307411_10069768 3300032005 Unclassified 2375
354 Ga0307415_100003564 3300032126 Bacteria 7944
355 Ga0307415_100020687 3300032126 Bacteria 4024
356 Ga0373951_0004259 3300035091 Bacteria 3405
357 Ga0242420_000552 3300038996 Bacteria 4322
358 Ga0450920_002449 3300042122 Bacteria 3159
359 Ga0439435_0023742 3300042436 Bacteria 1612
360 Ga0439464_0012119 3300042439 Unclassified 2292
361 Ga0439460_0008885 3300042461 Bacteria 2541
362 Ga0439460_0010868 3300042461 Unclassified 2339
363 Ga0450918_006998 3300042531 Bacteria 2004
364 Ga0451576_0338205 3300045051 Unclassified 1576
365 Ga0495580_0150218 3300046472 Bacteria 1614
366 Ga0495598_0000375 3300046537 Bacteria 8001
367 Ga0495621_0001772 3300046539 Bacteria 5661
368 Ga0495604_0167081 3300047317 Bacteria 1550
369 Ga0496106_0051661 3300048909 Unclassified 3100
370 Ga0496106_0068344 3300048909 Bacteria 2710
371 Ga0496109_0318880 3300048912 Unclassified 1467
372 Ga0496110_0046305 3300048913 Bacteria 3805
373 Ga0496112_0033175 3300048915 Bacteria 5017
374 Ga0496112_0221533 3300048915 Bacteria 1848
375 Ga0496113_0148345 3300048916 Bacteria 1849
376 Ga0501032_0120105 3300049569 Unclassified 1738
377 Ga0501036_0101912 3300049572 Bacteria 2428
378 Ga0501038_0000398 3300049574 Bacteria 37855
379 Ga0501039_0112566 3300049575 Bacteria 2128
380 Ga0501040_0124899 3300049576 Bacteria 1807
381 Ga0501041_0043999 3300049577 Bacteria 2714
382 Ga0501048_0027961 3300049582 Bacteria 4096
383 Ga0501071_0003331 3300049587 Bacteria 10037
384 Ga0501071_0026778 3300049587 Bacteria 4050
385 Ga0501071_0219608 3300049587 Bacteria 1430
386 Ga0501072_0023909 3300049588 Bacteria 4749
387 Ga0501072_0163940 3300049588 Bacteria 1773
388 Ga0501073_0001111 3300049589 Bacteria 19521
389 Ga0501075_0013332 3300049591 Bacteria 5864
390 Ga0501075_0036891 3300049591 Bacteria 3649
391 Ga0501075_0083041 3300049591 Bacteria 2427
392 Ga0501076_0004460 3300049592 Bacteria 9960
393 Ga0501076_0012747 3300049592 Bacteria 6293
394 Ga0501076_0049986 3300049592 Bacteria 3308
395 Ga0501076_0105387 3300049592 Bacteria 2275
396 Ga0501077_0082060 3300049593 Bacteria 2043
397 Ga0501223_009470 3300049663 Unclassified 1973
398 Ga0501234_001625 3300049707 Bacteria 3513
399 Ga0501080_0186683 3300049742 Bacteria 1906
400 Ga0501081_0030789 3300049743 Bacteria 3634
401 Ga0501283_003336 3300049779 Bacteria 2119
402 Ga0501035_0159589 3300049822 Bacteria 1953
403 Ga0501035_0175039 3300049822 Bacteria 1852
404 Ga0501045_0145650 3300049824 Bacteria 1762
405 Ga0501045_0202557 3300049824 Unclassified 1479
406 nmdc:mga07m45_36792_c1 3300050496 Bacteria 2728
407 nmdc:mga05p37_109691_c1 3300050507 Unclassified 3395
408 nmdc:mga05p37_109958_c1 3300050507 Bacteria 3390
409 nmdc:mga05p37_129191_c1 3300050507 Bacteria 3101
410 nmdc:mga05p37_166212_c1 3300050507 Bacteria 2692
411 nmdc:mga05p37_173171_c1 3300050507 Bacteria 2631
412 nmdc:mga05p37_195892_c1 3300050507 Bacteria 2450
413 nmdc:mga05p37_195941_c1 3300050507 Bacteria 2450
414 nmdc:mga05p37_207800_c1 3300050507 Bacteria 2367
415 nmdc:mga05p37_445699_c1 3300050507 Bacteria 1500
416 nmdc:mga05p37_54871_c1 3300050507 Bacteria 4901
417 nmdc:mga05p37_6877_c1 3300050507 Bacteria 13408
418 nmdc:mga05p37_72064_c1 3300050507 Bacteria 4251
419 nmdc:mga05p37_98176_c1 3300050507 Bacteria 3608
420 nmdc:mga09592_135193_c1 3300050508 Bacteria 2123
421 nmdc:mga09592_58589_c1 3300050508 Bacteria 3257
422 nmdc:mga0qj67_192589_c1 3300050509 Bacteria 1657
423 nmdc:mga0qj67_44830_c1 3300050509 Unclassified 3488
424 nmdc:mga0qj67_5338_c1 3300050509 Bacteria 9376
425 nmdc:mga06r32_15734_c1 3300050510 Bacteria 6874
426 nmdc:mga06r32_19596_c1 3300050510 Bacteria 6213
427 nmdc:mga06r32_92971_c1 3300050510 Bacteria 2949
428 nmdc:mga08y16_11864_c1 3300050511 Bacteria 9154
429 nmdc:mga08y16_155579_c1 3300050511 Bacteria 2376
430 nmdc:mga08y16_15557_c1 3300050511 Bacteria 8000
431 nmdc:mga08y16_221_c1 3300050511 Bacteria 51421
432 nmdc:mga08y16_44471_c1 3300050511 Bacteria 4652
433 nmdc:mga08y16_6493_c1 3300050511 Bacteria 12263
434 nmdc:mga08y16_89591_c1 3300050511 Bacteria 3206
435 nmdc:mga0n895_256541_c1 3300050512 Bacteria 1774
436 nmdc:mga0rr50_15738_c1 3300050513 Bacteria 5001
437 nmdc:mga0rr50_64264_c1 3300050513 Unclassified 2775
438 nmdc:mga0a205_109519_c1 3300050515 Bacteria 2660
439 nmdc:mga0a205_12107_c1 3300050515 Bacteria 7972
440 nmdc:mga0a205_157418_c1 3300050515 Bacteria 2170
441 nmdc:mga0a205_290948_c1 3300050515 Bacteria 1508
442 nmdc:mga0a205_4575_c1 3300050515 Bacteria 12402
443 nmdc:mga0a205_81300_c1 3300050515 Bacteria 3130
444 Ga0500641_0000213 3300053096 Bacteria 21875
445 Ga0500568_0012526 3300053139 Bacteria 3895
446 Ga0530510_0098101 3300061734 Bacteria 2142
447 Ga0111539_10261266
448 JGI24751J29686_10000017
449 JGI25406J46586_10008775
450 Ga0065714_10002213
451 Ga0065704_10002984
452 Ga0065704_10103463
453 Ga0065712_10000144
454 Ga0065715_10002428
455 Ga0065715_10089504
456 Ga0065715_10136792
457 Ga0065707_10003348
458 Ga0065707_10005788
459 Ga0070690_100008883
460 Ga0070690_100019400
461 Ga0070670_100000761
462 Ga0070670_100002102
463 Ga0070670_100008471
464 Ga0070670_100015172
465 Ga0070670_100039845
466 Ga0070670_100244270
467 Ga0068869_100123417
468 Ga0070680_100004103
469 Ga0070680_100051816
470 Ga0070680_100095743
471 Ga0070682_100000059
472 Ga0070682_100005386
473 Ga0070682_100024748
474 Ga0068868_100035000
475 Ga0070660_100026314
476 Ga0070689_100006223
477 Ga0070689_100007077
478 Ga0070689_100066198
479 Ga0070689_100116039
480 Ga0070689_100134650
481 Ga0070661_100056457
482 Ga0070692_10030500
483 Ga0070669_100002600
484 Ga0070669_100004869
485 Ga0070669_100036945
486 Ga0070669_100037865
487 Ga0070675_100069251
488 Ga0070675_100093613
489 Ga0070675_100193532
490 Ga0070671_100002555
491 Ga0070671_100014020
492 Ga0070671_100042978
493 Ga0070674_100008722
494 Ga0070674_100156104
495 Ga0070673_100004270
496 Ga0070673_100061136
497 Ga0070673_100247993
498 Ga0070667_100195166
499 Ga0070703_10001621
500 Ga0070705_100016967
501 Ga0070705_100065058
502 Ga0070705_100119867
503 Ga0070700_100000308
504 Ga0070700_100003350
505 Ga0070700_100008043
506 Ga0070700_100013664
507 Ga0070694_100001085
508 Ga0070694_100007541
509 Ga0070694_100010419
510 Ga0070694_100066785
511 Ga0070694_100067610
512 Ga0070694_100074483
513 Ga0070694_100182876
514 Ga0070663_100027374
515 Ga0070663_100031865
516 Ga0070678_100205324
517 Ga0070662_100157756
518 Ga0070681_10000254
519 Ga0070681_10000807
520 Ga0070681_10088091
521 Ga0068867_100015512
522 Ga0070706_100000088
523 Ga0070706_100010705
524 Ga0070707_100018867
525 Ga0070698_100004385
526 Ga0070698_100008286
527 Ga0070698_100010486
528 Ga0070698_100026408
529 Ga0070698_100085489
530 Ga0070698_100232444
531 Ga0070699_100002231
532 Ga0070679_100000029
533 Ga0070697_100000018
534 Ga0070697_100000293
535 Ga0070697_100052367
536 Ga0068853_100063487
537 Ga0070686_100030024
538 Ga0070695_100041458
539 Ga0070695_100042997
540 Ga0070695_100067960
541 Ga0070695_100075760
542 Ga0070695_100161812
543 Ga0070696_100012327
544 Ga0070693_100029427
545 Ga0070693_100085238
546 Ga0070704_100005514
547 Ga0070704_100010237
548 Ga0070704_100047046
549 Ga0070704_100075474
550 Ga0068855_100006411
551 Ga0070664_100001444
552 Ga0068857_100004076
553 Ga0068857_100031985
554 Ga0068857_100242153
555 Ga0068856_100019538
556 Ga0070702_100012671
557 Ga0068859_100004015
558 Ga0068859_100006232
559 Ga0068859_100008500
560 Ga0068859_100021079
561 Ga0068859_100027598
562 Ga0068864_100022782
563 Ga0068864_100066672
564 Ga0068864_100072855
565 Ga0068864_100171311
566 Ga0068864_100196575
567 Ga0068861_100011701
568 Ga0068861_100048610
569 Ga0068861_100095681
570 Ga0068861_100103424
571 Ga0068861_100178591
572 Ga0068851_10020073
573 Ga0068863_100173034
574 Ga0068858_100057473
575 Ga0068858_100076486
576 Ga0068858_100212500
577 Ga0068860_100028378
578 Ga0068860_100048220
579 Ga0068860_100069825
580 Ga0068862_100044848
581 Ga0068862_100073369
582 Ga0081539_10001175
583 Ga0081539_10002761
584 Ga0081539_10003574
585 Ga0075364_10025354
586 Ga0075364_10136613
587 Ga0070716_100039173
588 Ga0075367_10026763
589 Ga0075367_10061927
590 Ga0068871_100002635
591 Ga0068871_100007595
592 Ga0075428_100002028
593 Ga0075428_100013643
594 Ga0075428_100024924
595 Ga0075428_100046177
596 Ga0075428_100102298
597 Ga0075428_100149689
598 Ga0075430_100000917
599 Ga0075430_100001495
600 Ga0075430_100019829
601 Ga0075430_100042541
602 Ga0075430_100145779
603 Ga0075431_100002545
604 Ga0075431_100046745
605 Ga0075431_100061441
606 Ga0075431_100290272
607 Ga0075433_10017765
608 Ga0075433_10020442
609 Ga0075433_10068809
610 Ga0075433_10088075
611 Ga0075433_10124332
612 Ga0075433_10226989
613 Ga0075434_100146261
614 Ga0075434_100227926
615 Ga0075429_100002259
616 Ga0075429_100003266
617 Ga0075429_100012444
618 Ga0075429_100047324
619 Ga0075429_100113385
620 Ga0097620_100004015
621 Ga0097620_100006233
622 Ga0097620_100008500
623 Ga0097620_100021079
624 Ga0097620_100027598
625 Ga0075435_100060161
626 Ga0075435_100084836
627 Ga0105240_10178245
628 Ga0111539_10000530
629 Ga0111539_10005553
630 Ga0111539_10008122
631 Ga0111539_10010118
632 Ga0111539_10031647
633 Ga0111539_10037387
634 Ga0111539_10056776
635 Ga0111539_10061027
636 Ga0111539_10116083
637 Ga0111539_10142186
638 Ga0111539_10153240
639 Ga0111539_10160113
640 Ga0111539_10268312
641 Ga0105245_10009600
642 Ga0105245_10059045
643 Ga0105247_10000421
644 Ga0114129_10000204
645 Ga0114129_10007241
646 Ga0114129_10021219
647 Ga0114129_10035854
648 Ga0114129_10054854
649 Ga0114129_10069560
650 Ga0114129_10086380
651 Ga0114129_10210177
652 Ga0114129_10231552
653 Ga0114129_10248838
654 Ga0114129_10268413
655 Ga0114129_10287133
656 Ga0105243_10000044
657 Ga0105243_10010518
658 Ga0105243_10048990
659 Ga0105242_10000012
660 Ga0105248_10019375
661 Ga0105248_10021504
662 Ga0105248_10023543
663 Ga0105248_10028957
664 Ga0105248_10036906
665 Ga0105248_10049157
666 Ga0105248_10054584
667 Ga0105248_10160016
668 Ga0105248_10226107
669 Ga0105237_10000438
670 Ga0105238_10012805
671 Ga0105249_10000201
672 Ga0105249_10006943
673 Ga0105249_10030801
674 Ga0105249_10035974
675 Ga0105249_10039509
676 Ga0105246_10059825
677 Ga0157373_10004729
678 Ga0157378_10021347
679 Ga0163162_10000128
680 Ga0163162_10019473
681 Ga0163162_10060812
682 Ga0157375_10063350
683 Ga0163163_10002106
684 Ga0163163_10004294
685 Ga0163163_10054226
686 Ga0163163_10059828
687 Ga0163163_10145345
688 Ga0163163_10155411
689 Ga0163163_10230136
690 Ga0157380_10000470
691 Ga0157380_10029215
692 Ga0157380_10029502
693 Ga0157380_10029718
694 Ga0157377_10068740
695 Ga0207697_10001751
696 Ga0207697_10022501
697 Ga0207656_10013023
698 Ga0207653_10001864
699 Ga0207642_10030385
700 Ga0207710_10000553
701 Ga0207688_10000902
702 Ga0207647_10016890
703 Ga0207643_10004553
704 Ga0207684_10000170
705 Ga0207684_10095122
706 Ga0207654_10125781
707 Ga0207707_10000060
708 Ga0207707_10062036
709 Ga0207695_10149263
710 Ga0207671_10001676
711 Ga0207652_10000073
712 Ga0207646_10091972
713 Ga0207681_10010142
714 Ga0207681_10011147
715 Ga0207681_10011236
716 Ga0207681_10087135
717 Ga0207681_10173898
718 Ga0207694_10010874
719 Ga0207694_10015806
720 Ga0207650_10000005
721 Ga0207650_10002542
722 Ga0207650_10010275
723 Ga0207650_10013570
724 Ga0207659_10151397
725 Ga0207687_10042903
726 Ga0207690_10031533
727 Ga0207686_10000445
728 Ga0207709_10000029
729 Ga0207709_10004720
730 Ga0207709_10064057
731 Ga0207670_10003377
732 Ga0207670_10023215
733 Ga0207669_10090145
734 Ga0207665_10029076
735 Ga0207711_10013354
736 Ga0207711_10053846
737 Ga0207711_10218790
738 Ga0207689_10107637
739 Ga0207667_10332224
740 Ga0207651_10096360
741 Ga0207712_10001036
742 Ga0207712_10069079
743 Ga0207712_10107211
744 Ga0207677_10168193
745 Ga0207703_10024114
746 Ga0207703_10122309
747 Ga0207639_10061021
748 Ga0207678_10047816
749 Ga0207708_10000043
750 Ga0207708_10001112
751 Ga0207708_10019983
752 Ga0207708_10022614
753 Ga0207708_10043935
754 Ga0207708_10096941
755 Ga0207641_10009900
756 Ga0207641_10042650
757 Ga0207641_10234627
758 Ga0207648_10050104
759 Ga0207648_10083319
760 Ga0207676_10049101
761 Ga0207674_10000332
762 Ga0207674_10010508
763 Ga0207674_10083668
764 Ga0207674_10146812
765 Ga0207675_100071967
766 Ga0207675_100073154
767 Ga0207675_100093516
768 Ga0207675_100096697
769 Ga0207675_100127074
770 Ga0207675_100130615
771 Ga0207675_100195632
772 Ga0207683_10026091
773 Ga0207698_10108212
774 Ga0207428_10002189
775 Ga0207428_10002464
776 Ga0207428_10034521
777 Ga0207428_10125386
778 Ga0268265_10044896
779 Ga0268265_10087271
780 Ga0268265_10228006
781 Ga0268264_10032662
782 Ga0268264_10107395
783 Ga0307513_10004715
784 Ga0307408_100035181
785 Ga0307408_100041313
786 Ga0316576_10000684
787 Ga0307405_10013135
788 Ga0307405_10036961
789 Ga0307406_10003367
790 Ga0307406_10034548
791 Ga0307409_100052567
792 Ga0307416_100024713
793 Ga0307416_100076644
794 Ga0307416_100094632
795 Ga0307416_100095945
796 Ga0307416_100151437
797 Ga0307416_100207705
798 Ga0307414_10005530
799 Ga0307411_10069768
800 Ga0307415_100003564
801 Ga0307415_100020687
802 Ga0373951_0004259
803 Ga0242420_000552
804 Ga0450920_002449
805 Ga0439435_0023742
806 Ga0439464_0012119
807 Ga0439460_0008885
808 Ga0439460_0010868
809 Ga0450918_006998
810 Ga0451576_0338205
811 Ga0495580_0150218
812 Ga0495598_0000375
813 Ga0495621_0001772
814 Ga0495604_0167081
815 Ga0496106_0051661
816 Ga0496106_0068344
817 Ga0496109_0318880
818 Ga0496110_0046305
819 Ga0496112_0033175
820 Ga0496112_0221533
821 Ga0496113_0148345
822 Ga0501032_0120105
823 Ga0501036_0101912
824 Ga0501038_0000398
825 Ga0501039_0112566
826 Ga0501040_0124899
827 Ga0501041_0043999
828 Ga0501048_0027961
829 Ga0501071_0003331
830 Ga0501071_0026778
831 Ga0501071_0219608
832 Ga0501072_0023909
833 Ga0501072_0163940
834 Ga0501073_0001111
835 Ga0501075_0013332
836 Ga0501075_0036891
837 Ga0501075_0083041
838 Ga0501076_0004460
839 Ga0501076_0012747
840 Ga0501076_0049986
841 Ga0501076_0105387
842 Ga0501077_0082060
843 Ga0501223_009470
844 Ga0501234_001625
845 Ga0501080_0186683
846 Ga0501081_0030789
847 Ga0501283_003336
848 Ga0501035_0159589
849 Ga0501035_0175039
850 Ga0501045_0145650
851 Ga0501045_0202557
852 nmdc:mga07m45_36792_c1
853 nmdc:mga05p37_109691_c1
854 nmdc:mga05p37_109958_c1
855 nmdc:mga05p37_129191_c1
856 nmdc:mga05p37_166212_c1
857 nmdc:mga05p37_173171_c1
858 nmdc:mga05p37_195892_c1
859 nmdc:mga05p37_195941_c1
860 nmdc:mga05p37_207800_c1
861 nmdc:mga05p37_445699_c1
862 nmdc:mga05p37_54871_c1
863 nmdc:mga05p37_6877_c1
864 nmdc:mga05p37_72064_c1
865 nmdc:mga05p37_98176_c1
866 nmdc:mga09592_135193_c1
867 nmdc:mga09592_58589_c1
868 nmdc:mga0qj67_192589_c1
869 nmdc:mga0qj67_44830_c1
870 nmdc:mga0qj67_5338_c1
871 nmdc:mga06r32_15734_c1
872 nmdc:mga06r32_19596_c1
873 nmdc:mga06r32_92971_c1
874 nmdc:mga08y16_11864_c1
875 nmdc:mga08y16_155579_c1
876 nmdc:mga08y16_15557_c1
877 nmdc:mga08y16_221_c1
878 nmdc:mga08y16_44471_c1
879 nmdc:mga08y16_6493_c1
880 nmdc:mga08y16_89591_c1
881 nmdc:mga0n895_256541_c1
882 nmdc:mga0rr50_15738_c1
883 nmdc:mga0rr50_64264_c1
884 nmdc:mga0a205_109519_c1
885 nmdc:mga0a205_12107_c1
886 nmdc:mga0a205_157418_c1
887 nmdc:mga0a205_290948_c1
888 nmdc:mga0a205_4575_c1
889 nmdc:mga0a205_81300_c1
890 Ga0500641_0000213
891 Ga0500568_0012526
892 Ga0530510_0098101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

105

484

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i3x-assembly2.cif.gz_C structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetate and cofactor nad+ 0.815 3 448
5x5t-assembly1.cif.gz_A crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense 0.8121 3 466
1ag8-assembly1.cif.gz_D aldehyde dehydrogenase from bovine mitochondria 0.8095 2 449
3efv-assembly1.cif.gz_A crystal structure of a putative succinate-semialdehyde dehydrogenase from salmonella typhimurium lt2 with bound nad 0.8065 18 462
4o6r-assembly1.cif.gz_D crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia 0.806 1 466
ID Description Score Start End Superfamily
4qf6B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.8407 255 449 3.40.309.10
4qf6B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.8368 255 449 3.40.309.10
4o5hD02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.832 255 449 3.40.309.10
3k2wA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.8285 253 440 3.40.309.10
4o5hD02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.8281 255 449 3.40.309.10
ID Description Score Start End GO Terms
AF-A0A6N6Q2X6-F1-model_v4 Aldehyde dehydrogenase 0.9912 1 471 GO:0016620
AF-A0A3D5K0G2-F1-model_v4 Aldehyde dehydrogenase 0.9905 2 473 GO:0016620
AF-A0A838YD59-F1-model_v4 Aldehyde dehydrogenase family protein 0.9893 1 471 GO:0016620
AF-B4D7Z5-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9886 1 470 GO:0016620
AF-A0A2D6QE39-F1-model_v4 Aldehyde dehydrogenase 0.9882 2 474 GO:0016620

Map