F445679

General Info

Members Datasets Scaffolds Average Seq Length
446 262 892 240

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100180660|Ga0068857_1001806602
Length 267
Sequence MTETRLDSAAGEPTRSVGPGRELAGQVAYVTGGATGIGLAISHALAARGASVAIFARNGARAEEAATAXXXXGGQVHAWAADITRSEDVDAAFAKALEQLGRVDILVNNAGLTRDGLFVRMSDEQWSQVIDTNLTGAFRCSRAVARTMMKARYGRIVNVSSVVGLMGNAGQANYSASKAGLLGLTKSLARELASRAVTVNAVCPGYITTEMTAQLPEAAQKELQARIPLGRLGMPEDVAEVVAFLASPRAGYVTGQTWTVDGGMVME

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
250 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
251 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
252 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
253 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
254 2643221711 Terrabacter sp. Root85 Isolate Unclassified
255 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
256 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
257 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
258 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
259 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
260 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
261 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
262 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.95
Metatranscriptomes 2.91
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 9.19
Rhizosphere 85.65
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100180660 3300005577 Bacteria 1920
2 Ga0006562J51391_1022947 3300003578 Bacteria 2640
3 Ga0055532_1001968 3300003758 Bacteria 4803
4 Ga0070676_10199295 3300005328 Bacteria 1311
5 Ga0070683_100523490 3300005329 Bacteria 1133
6 Ga0070670_100280295 3300005331 Bacteria 1455
7 Ga0068869_100152105 3300005334 Bacteria 1795
8 Ga0070666_10244078 3300005335 Bacteria 1270
9 Ga0070682_100151923 3300005337 Bacteria 1590
10 Ga0070682_100180641 3300005337 Bacteria 1474
11 Ga0068868_100049844 3300005338 Bacteria 3287
12 Ga0070660_100000818 3300005339 Bacteria 20629
13 Ga0070689_100020450 3300005340 Bacteria 4912
14 Ga0070689_100050892 3300005340 Bacteria 3201
15 Ga0070689_100181012 3300005340 Bacteria 1712
16 Ga0070687_100340015 3300005343 Bacteria 965
17 Ga0070692_10018382 3300005345 Bacteria 3361
18 Ga0070692_10262447 3300005345 Bacteria 1039
19 Ga0070669_100152530 3300005353 Bacteria 1790
20 Ga0070669_100332347 3300005353 Bacteria 1229
21 Ga0070675_100034558 3300005354 Bacteria 4104
22 Ga0070675_100256560 3300005354 Bacteria 1531
23 Ga0070688_100041618 3300005365 Bacteria 2822
24 Ga0070688_100137719 3300005365 Bacteria 1655
25 Ga0070659_100271771 3300005366 Bacteria 1408
26 Ga0070667_100029425 3300005367 Bacteria 4576
27 Ga0070701_10051675 3300005438 Bacteria 2133
28 Ga0070701_10193778 3300005438 Bacteria 1197
29 Ga0070705_100115926 3300005440 Bacteria 1721
30 Ga0070700_100045791 3300005441 Bacteria 2700
31 Ga0070700_100174072 3300005441 Bacteria 1492
32 Ga0070694_100022296 3300005444 Bacteria 4057
33 Ga0070662_100227887 3300005457 Bacteria 1489
34 Ga0070662_100237533 3300005457 Bacteria 1460
35 Ga0068867_100006847 3300005459 Bacteria 8059
36 Ga0070706_100182650 3300005467 Bacteria 1959
37 Ga0070706_100372375 3300005467 Bacteria 1331
38 Ga0070707_100168898 3300005468 Bacteria 2132
39 Ga0070707_100829858 3300005468 Bacteria 888
40 Ga0070698_100191789 3300005471 Bacteria 1981
41 Ga0070698_100390862 3300005471 Bacteria 1324
42 Ga0070699_100100237 3300005518 Bacteria 2538
43 Ga0070679_100087182 3300005530 Bacteria 3108
44 Ga0070679_100162153 3300005530 Bacteria 2210
45 Ga0070684_100302926 3300005535 Bacteria 1467
46 Ga0070684_100584728 3300005535 Bacteria 1038
47 Ga0070697_100326740 3300005536 Bacteria 1322
48 Ga0068853_100384508 3300005539 Bacteria 1311
49 Ga0070672_100453556 3300005543 Bacteria 1105
50 Ga0070686_100162270 3300005544 Bacteria 1575
51 Ga0070695_100004297 3300005545 Bacteria 8341
52 Ga0070696_100062130 3300005546 Bacteria 2614
53 Ga0070696_100534998 3300005546 Bacteria 937
54 Ga0070665_100058253 3300005548 Bacteria 3873
55 Ga0070665_100789482 3300005548 Bacteria 962
56 Ga0070704_100275223 3300005549 Bacteria 1392
57 Ga0070704_100302984 3300005549 Bacteria 1332
58 Ga0068855_100000854 3300005563 Bacteria 37817
59 Ga0070664_100541502 3300005564 Bacteria 1076
60 Ga0068857_100212924 3300005577 Bacteria 1764
61 Ga0068857_100426893 3300005577 Bacteria 1236
62 Ga0068854_100008835 3300005578 Bacteria 6484
63 Ga0068854_100365098 3300005578 Bacteria 1185
64 Ga0068856_100440437 3300005614 Bacteria 1323
65 Ga0070702_100018159 3300005615 Bacteria 3644
66 Ga0070702_100170957 3300005615 Bacteria 1413
67 Ga0068852_100504990 3300005616 Bacteria 1204
68 Ga0068859_100061778 3300005617 Bacteria 3776
69 Ga0068859_100652658 3300005617 Bacteria 1144
70 Ga0068866_10029598 3300005718 Bacteria 2621
71 Ga0068861_100041470 3300005719 Bacteria 3448
72 Ga0068861_100160591 3300005719 Bacteria 1853
73 Ga0068870_10067361 3300005840 Bacteria 1942
74 Ga0068870_10068453 3300005840 Bacteria 1929
75 Ga0068863_100038345 3300005841 Bacteria 4560
76 Ga0068858_100483004 3300005842 Bacteria 1196
77 Ga0081455_10034614 3300005937 Bacteria 4524
78 Ga0081538_10035296 3300005981 Bacteria 3287
79 Ga0081538_10053423 3300005981 Bacteria 2402
80 Ga0081539_10057774 3300005985 Bacteria 2144
81 Ga0075370_10154354 3300006353 Bacteria 1346
82 Ga0075428_100007996 3300006844 Bacteria 11729
83 Ga0075428_100017805 3300006844 Bacteria 7850
84 Ga0075428_100031987 3300006844 Bacteria 5812
85 Ga0075428_100290499 3300006844 Bacteria 1759
86 Ga0075428_100636779 3300006844 Bacteria 1137
87 Ga0075430_100019794 3300006846 Bacteria 5725
88 Ga0075431_100052423 3300006847 Bacteria 4207
89 Ga0075431_100455353 3300006847 Bacteria 1275
90 Ga0075433_10086743 3300006852 Bacteria 2764
91 Ga0075434_100040933 3300006871 Bacteria 4588
92 Ga0075434_100207975 3300006871 Bacteria 1978
93 Ga0075429_100004732 3300006880 Bacteria 11714
94 Ga0075429_100019960 3300006880 Bacteria 5812
95 Ga0075429_100028522 3300006880 Bacteria 4846
96 Ga0075429_100193935 3300006880 Bacteria 1779
97 Ga0075429_100234865 3300006880 Bacteria 1606
98 Ga0075429_100700949 3300006880 Bacteria 887
99 Ga0097620_100061777 3300006931 Bacteria 3776
100 Ga0097620_100652557 3300006931 Bacteria 1144
101 Ga0075435_100404657 3300007076 Bacteria 1174
102 Ga0075435_100649151 3300007076 Bacteria 916
103 Ga0111539_10012947 3300009094 Bacteria 10438
104 Ga0111539_10043497 3300009094 Bacteria 5384
105 Ga0111539_10113447 3300009094 Bacteria 3179
106 Ga0111539_10251958 3300009094 Bacteria 2056
107 Ga0111539_10537411 3300009094 Bacteria 1362
108 Ga0111539_11228672 3300009094 Bacteria 870
109 Ga0105245_10071589 3300009098 Bacteria 3148
110 Ga0105247_10120326 3300009101 Bacteria 1700
111 Ga0114129_10000016 3300009147 Bacteria 127415
112 Ga0114129_10023083 3300009147 Bacteria 8824
113 Ga0114129_10241777 3300009147 Bacteria 2427
114 Ga0114129_10253548 3300009147 Bacteria 2361
115 Ga0114129_10378190 3300009147 Bacteria 1871
116 Ga0105243_10015660 3300009148 Bacteria 5733
117 Ga0105243_10455268 3300009148 Bacteria 1202
118 Ga0105243_10462512 3300009148 Bacteria 1193
119 Ga0105238_10688988 3300009551 Bacteria 1034
120 Ga0105249_10016232 3300009553 Bacteria 6604
121 Ga0105249_10730137 3300009553 Bacteria 1052
122 Ga0157369_10112476 3300013105 Bacteria 2892
123 Ga0157369_10201312 3300013105 Bacteria 2090
124 Ga0157378_10219159 3300013297 Bacteria 1808
125 Ga0157378_11020582 3300013297 Bacteria 862
126 Ga0163162_10232820 3300013306 Bacteria 1973
127 Ga0163162_10287467 3300013306 Bacteria 1776
128 Ga0163162_10612294 3300013306 Bacteria 1215
129 Ga0157372_10397962 3300013307 Bacteria 1605
130 Ga0157375_10142199 3300013308 Bacteria 2527
131 Ga0157375_10408256 3300013308 Bacteria 1524
132 Ga0157375_10675659 3300013308 Bacteria 1188
133 Ga0163163_10072298 3300014325 Bacteria 3438
134 Ga0163163_10265490 3300014325 Bacteria 1767
135 Ga0163163_10277748 3300014325 Bacteria 1726
136 Ga0157380_10076396 3300014326 Bacteria 2726
137 Ga0157380_10078367 3300014326 Bacteria 2695
138 Ga0157380_10297147 3300014326 Bacteria 1486
139 Ga0163161_10395965 3300017792 Bacteria 1107
140 Ga0206353_11819676 3300020082 Bacteria 806
141 Ga0213873_10059027 3300021358 Bacteria 1034
142 Ga0213876_10035427 3300021384 Bacteria 2632
143 Ga0224712_10058091 3300022467 Bacteria 1531
144 Ga0209147_100082 3300025229 Bacteria 194153
145 Ga0207688_10061765 3300025901 Bacteria 2112
146 Ga0207688_10222553 3300025901 Unclassified 1137
147 Ga0207645_10104383 3300025907 Bacteria 1830
148 Ga0207645_10170664 3300025907 Bacteria 1426
149 Ga0207684_10282373 3300025910 Bacteria 1432
150 Ga0207684_10350388 3300025910 Bacteria 1271
151 Ga0207684_10509054 3300025910 Bacteria 1032
152 Ga0207657_10003982 3300025919 Bacteria 15701
153 Ga0207646_10238486 3300025922 Bacteria 1643
154 Ga0207681_10039596 3300025923 Bacteria 3131
155 Ga0207681_10172898 3300025923 Bacteria 1639
156 Ga0207650_10293372 3300025925 Bacteria 1326
157 Ga0207659_10044060 3300025926 Bacteria 3137
158 Ga0207659_10232368 3300025926 Bacteria 1488
159 Ga0207659_10580474 3300025926 Bacteria 954
160 Ga0207687_10037311 3300025927 Bacteria 3315
161 Ga0207690_10139617 3300025932 Bacteria 1784
162 Ga0207706_10099990 3300025933 Bacteria 2552
163 Ga0207706_10108549 3300025933 Bacteria 2442
164 Ga0207706_10597636 3300025933 Bacteria 948
165 Ga0207670_10144317 3300025936 Bacteria 1758
166 Ga0207704_10256896 3300025938 Bacteria 1315
167 Ga0207691_10130223 3300025940 Bacteria 2223
168 Ga0207691_10171714 3300025940 Bacteria 1898
169 Ga0207661_10516202 3300025944 Bacteria 1092
170 Ga0207679_10454890 3300025945 Bacteria 1136
171 Ga0207679_10505485 3300025945 Bacteria 1079
172 Ga0207667_10002571 3300025949 Bacteria 22570
173 Ga0207712_10275875 3300025961 Bacteria 1370
174 Ga0207668_10133941 3300025972 Bacteria 1896
175 Ga0207640_10108989 3300025981 Bacteria 1958
176 Ga0207658_10494255 3300025986 Bacteria 1089
177 Ga0207677_10053665 3300026023 Bacteria 2745
178 Ga0207703_10660767 3300026035 Bacteria 992
179 Ga0207639_10185354 3300026041 Bacteria 1774
180 Ga0207678_10314469 3300026067 Bacteria 1347
181 Ga0207678_10327151 3300026067 Bacteria 1319
182 Ga0207708_10032294 3300026075 Bacteria 3977
183 Ga0207708_10050608 3300026075 Bacteria 3162
184 Ga0207708_10174763 3300026075 Bacteria 1703
185 Ga0207708_10253061 3300026075 Bacteria 1420
186 Ga0207708_10631164 3300026075 Bacteria 910
187 Ga0207641_10116392 3300026088 Bacteria 2378
188 Ga0207648_10027535 3300026089 Bacteria 5046
189 Ga0207648_10401267 3300026089 Bacteria 1242
190 Ga0207674_10035541 3300026116 Bacteria 5200
191 Ga0207674_10092809 3300026116 Bacteria 3008
192 Ga0207674_10118988 3300026116 Bacteria 2611
193 Ga0207674_10250381 3300026116 Bacteria 1719
194 Ga0207675_100019532 3300026118 Bacteria 6325
195 Ga0207675_100036289 3300026118 Bacteria 4599
196 Ga0207675_100462393 3300026118 Bacteria 1259
197 Ga0207428_10021378 3300027907 Bacteria 5479
198 Ga0207428_10058340 3300027907 Bacteria 3063
199 Ga0268266_10343433 3300028379 Bacteria 1402
200 Ga0268265_10196858 3300028380 Bacteria 1745
201 Ga0268264_10021460 3300028381 Bacteria 5273
202 Ga0268264_10488099 3300028381 Bacteria 1199
203 Ga0307515_10000901 3300028794 Bacteria 68376
204 Ga0265338_10021752 3300028800 Bacteria 6670
205 Ga0307509_10002143 3300031507 Bacteria 32441
206 Ga0307408_100066933 3300031548 Bacteria 2640
207 Ga0316579_10001075 3300031691 Bacteria 9661
208 Ga0316579_10007468 3300031691 Bacteria 4516
209 Ga0316579_10103783 3300031691 Bacteria 1362
210 Ga0316576_10164343 3300031727 Bacteria 1674
211 Ga0316578_10038999 3300031728 Bacteria 2742
212 Ga0316578_10091517 3300031728 Bacteria 1817
213 Ga0307405_10048242 3300031731 Bacteria 2626
214 Ga0307405_10203114 3300031731 Bacteria 1441
215 Ga0316577_10021608 3300031733 Bacteria 3571
216 Ga0316577_10202988 3300031733 Bacteria 1120
217 Ga0307413_10126725 3300031824 Bacteria 1740
218 Ga0307413_10637121 3300031824 Bacteria 877
219 Ga0307410_10001308 3300031852 Bacteria 11123
220 Ga0307410_10266201 3300031852 Bacteria 1339
221 Ga0307410_10340930 3300031852 Bacteria 1195
222 Ga0307407_10122152 3300031903 Bacteria 1653
223 Ga0307407_10137103 3300031903 Bacteria 1574
224 Ga0307412_10422316 3300031911 Bacteria 1091
225 Ga0307412_10802105 3300031911 Bacteria 817
226 Ga0307409_100174575 3300031995 Bacteria 1895
227 Ga0307409_100314602 3300031995 Bacteria 1463
228 Ga0307416_100128191 3300032002 Bacteria 2277
229 Ga0307416_100403728 3300032002 Bacteria 1405
230 Ga0307416_100446191 3300032002 Bacteria 1345
231 Ga0307414_10380015 3300032004 Bacteria 1221
232 Ga0307411_10095393 3300032005 Bacteria 2088
233 Ga0307415_100071545 3300032126 Bacteria 2439
234 Ga0307415_100297034 3300032126 Bacteria 1336
235 Ga0307415_100578410 3300032126 Bacteria 996
236 Ga0316585_10022232 3300032137 Bacteria 1950
237 Ga0316580_10003049 3300032139 Bacteria 4715
238 Ga0316593_10001753 3300032168 Bacteria 4924
239 Ga0316593_10002750 3300032168 Bacteria 4245
240 Ga0316593_10005591 3300032168 Bacteria 3328
241 Ga0373934_0003162 3300035086 Bacteria 6010
242 Ga0373954_0006874 3300035118 Bacteria 4967
243 Ga0373956_0002550 3300035119 Bacteria 7406
244 Ga0373955_0016781 3300035172 Bacteria 3609
245 Ga0316574_0048910 3300035398 Bacteria 2627
246 Ga0373933_0016681 3300035724 Bacteria 4112
247 Ga0373937_0153413 3300036401 Bacteria 2158
248 Ga0316582_0027641 3300036647 Bacteria 3429
249 Ga0316582_0146370 3300036647 Unclassified 1595
250 Ga0316582_0323379 3300036647 Bacteria 1060
251 Ga0316584_0213125 3300036712 Bacteria 1421
252 Ga0395899_0078207 3300037312 Bacteria 2411
253 Ga0395900_0004598 3300037418 Bacteria 14562
254 Ga0395900_0285109 3300037418 Bacteria 1642
255 Ga0395898_0000549 3300037466 Bacteria 70801
256 Ga0395898_0035332 3300037466 Bacteria 4971
257 Ga0395898_0156275 3300037466 Bacteria 2182
258 Ga0395898_0415499 3300037466 Bacteria 1282
259 Ga0395905_0003109 3300037471 Bacteria 17921
260 Ga0395905_0054081 3300037471 Bacteria 3757
261 Ga0395905_0173508 3300037471 Bacteria 2025
262 Ga0316581_0007736 3300037588 Bacteria 2897
263 Ga0395901_0000238 3300038443 Bacteria 69147
264 Ga0395901_0013193 3300038443 Bacteria 8390
265 Ga0395901_0016256 3300038443 Bacteria 7580
266 Ga0395901_0035242 3300038443 Bacteria 5170
267 Ga0395901_0055392 3300038443 Bacteria 4124
268 Ga0395901_0346735 3300038443 Bacteria 1533
269 Ga0395901_0574007 3300038443 Bacteria 1140
270 Ga0436365_0396298 3300039437 Bacteria 7637
271 Ga0436362_0469196 3300039453 Bacteria 2427
272 Ga0451837_0450972 3300041494 Bacteria 1269
273 Ga0451845_0195175 3300041501 Bacteria 865
274 Ga0466963_0072723 3300044694 Bacteria 2316
275 Ga0466963_0311080 3300044694 Bacteria 1108
276 Ga0466963_0325655 3300044694 Bacteria 1081
277 Ga0453684_0027621 3300044712 Bacteria 8128
278 Ga0453684_0103149 3300044712 Bacteria 3486
279 Ga0466971_0004687 3300044719 Bacteria 5909
280 Ga0466957_0049958 3300044842 Bacteria 2544
281 Ga0466960_0030602 3300044901 Bacteria 2478
282 Ga0466960_0154050 3300044901 Bacteria 1230
283 Ga0466960_0163809 3300044901 Bacteria 1196
284 Ga0451576_0059266 3300045051 Bacteria 3997
285 Ga0451576_0067191 3300045051 Bacteria 3731
286 Ga0466967_0010057 3300045976 Bacteria 7069
287 Ga0466967_0016734 3300045976 Bacteria 5795
288 Ga0466967_0100780 3300045976 Bacteria 2639
289 Ga0495592_0003973 3300046454 Bacteria 10717
290 Ga0495603_0112722 3300046455 Bacteria 1586
291 Ga0495641_0013965 3300046461 Bacteria 4372
292 Ga0495651_0310618 3300046462 Bacteria 1054
293 Ga0495653_0178396 3300046463 Bacteria 1460
294 Ga0495653_0243727 3300046463 Bacteria 1196
295 Ga0495594_0272555 3300046499 Bacteria 964
296 Ga0495608_0001370 3300046511 Bacteria 17367
297 Ga0495618_0000978 3300046514 Bacteria 19580
298 Ga0495628_0046390 3300046516 Bacteria 3451
299 Ga0495630_0157960 3300046517 Bacteria 1726
300 Ga0495652_0423510 3300046529 Bacteria 938
301 Ga0495586_0353303 3300046535 Bacteria 844
302 Ga0495635_0069628 3300046663 Bacteria 2412
303 Ga0495657_0004189 3300046675 Bacteria 11545
304 Ga0495658_0311546 3300046683 Bacteria 997
305 Ga0495600_0051469 3300046809 Bacteria 2688
306 Ga0495581_0056870 3300047315 Bacteria 2258
307 Ga0495680_0070380 3300047322 Bacteria 2668
308 Ga0495675_0004092 3300047444 Bacteria 8836
309 Ga0495675_0138198 3300047444 Bacteria 1512
310 Ga0495684_0238116 3300047471 Bacteria 1329
311 Ga0496100_0007961 3300048903 Bacteria 5886
312 Ga0496100_0431230 3300048903 Bacteria 1008
313 Ga0496101_0090523 3300048904 Bacteria 2275
314 Ga0496101_0122078 3300048904 Bacteria 1970
315 Ga0496101_0168155 3300048904 Bacteria 1684
316 Ga0496101_0459407 3300048904 Bacteria 1005
317 Ga0496102_0008045 3300048905 Bacteria 9017
318 Ga0496102_0009907 3300048905 Bacteria 8195
319 Ga0496102_0035028 3300048905 Bacteria 4518
320 Ga0496102_0256938 3300048905 Bacteria 1647
321 Ga0496102_0355584 3300048905 Bacteria 1379
322 Ga0496103_0027168 3300048906 Bacteria 3466
323 Ga0496104_0008504 3300048907 Bacteria 9125
324 Ga0496104_0193778 3300048907 Bacteria 1944
325 Ga0496104_0207815 3300048907 Bacteria 1869
326 Ga0496104_0598066 3300048907 Bacteria 1013
327 Ga0496105_0079636 3300048908 Bacteria 2705
328 Ga0496105_0275308 3300048908 Bacteria 1358
329 Ga0496105_0346192 3300048908 Bacteria 1188
330 Ga0496106_0067492 3300048909 Bacteria 2727
331 Ga0496106_0257063 3300048909 Bacteria 1397
332 Ga0496106_0505521 3300048909 Bacteria 971
333 Ga0496108_0149133 3300048911 Bacteria 2018
334 Ga0496108_0286019 3300048911 Bacteria 1435
335 Ga0496109_0019127 3300048912 Bacteria 6033
336 Ga0496109_0067998 3300048912 Bacteria 3265
337 Ga0496109_0138567 3300048912 Bacteria 2275
338 Ga0496110_0037356 3300048913 Bacteria 4222
339 Ga0496110_0096454 3300048913 Bacteria 2650
340 Ga0496110_0302651 3300048913 Bacteria 1456
341 Ga0496111_0029367 3300048914 Bacteria 3905
342 Ga0496111_0458427 3300048914 Bacteria 940
343 Ga0496111_0534585 3300048914 Bacteria 861
344 Ga0496112_0231042 3300048915 Bacteria 1804
345 Ga0496112_0314281 3300048915 Bacteria 1511
346 Ga0496112_0492800 3300048915 Bacteria 1161
347 Ga0496113_0008191 3300048916 Bacteria 6792
348 Ga0496114_0007476 3300048917 Bacteria 8638
349 Ga0496114_0044073 3300048917 Bacteria 3700
350 Ga0496114_0049505 3300048917 Bacteria 3496
351 Ga0496115_0154524 3300048918 Bacteria 1895
352 Ga0496121_0174456 3300048924 Bacteria 1558
353 Ga0501311_013849 3300049527 Bacteria 1023
354 Ga0501313_015384 3300049529 Bacteria 912
355 Ga0501315_013113 3300049531 Bacteria 1034
356 Ga0501317_017316 3300049533 Bacteria 944
357 Ga0501317_024023 3300049533 Bacteria 845
358 Ga0501320_002092 3300049536 Bacteria 1563
359 Ga0501323_015748 3300049539 Bacteria 957
360 Ga0501031_0045892 3300049568 Bacteria 2851
361 Ga0501031_0217473 3300049568 Bacteria 1244
362 Ga0501032_0043486 3300049569 Bacteria 3042
363 Ga0501033_0224561 3300049570 Bacteria 1336
364 Ga0501034_0718057 3300049571 Bacteria 897
365 Ga0501036_0014628 3300049572 Bacteria 6537
366 Ga0501036_0132829 3300049572 Bacteria 2101
367 Ga0501036_0567250 3300049572 Bacteria 943
368 Ga0501037_0139030 3300049573 Bacteria 1739
369 Ga0501038_0001144 3300049574 Bacteria 24032
370 Ga0501038_0296561 3300049574 Bacteria 1269
371 Ga0501039_0026930 3300049575 Bacteria 4419
372 Ga0501039_0031784 3300049575 Bacteria 4070
373 Ga0501041_0000946 3300049577 Bacteria 15751
374 Ga0501041_0085845 3300049577 Bacteria 1941
375 Ga0501042_0017248 3300049578 Bacteria 4977
376 Ga0501043_0013447 3300049579 Bacteria 6401
377 Ga0501048_0021968 3300049582 Bacteria 4670
378 Ga0501048_0166624 3300049582 Bacteria 1560
379 Ga0501048_0317402 3300049582 Bacteria 1110
380 Ga0501048_0453065 3300049582 Bacteria 919
381 Ga0501069_0459925 3300049585 Bacteria 757
382 Ga0501071_0159439 3300049587 Bacteria 1686
383 Ga0501072_0027456 3300049588 Bacteria 4440
384 Ga0501072_0058182 3300049588 Bacteria 3047
385 Ga0501073_0374979 3300049589 Bacteria 983
386 Ga0501074_0026253 3300049590 Bacteria 4223
387 Ga0501074_0063411 3300049590 Bacteria 2662
388 Ga0501075_0035124 3300049591 Bacteria 3737
389 Ga0501076_0030916 3300049592 Bacteria 4172
390 Ga0501079_0008527 3300049741 Bacteria 7774
391 Ga0501079_0145437 3300049741 Bacteria 1847
392 Ga0501080_0003678 3300049742 Bacteria 13522
393 Ga0501080_0057953 3300049742 Bacteria 3606
394 Ga0501081_0002354 3300049743 Bacteria 11903
395 Ga0501083_0194996 3300049744 Bacteria 1322
396 Ga0501083_0255924 3300049744 Bacteria 1139
397 Ga0501035_0071245 3300049822 Bacteria 3078
398 Ga0501035_0460762 3300049822 Bacteria 1051
399 Ga0501044_0070544 3300049823 Bacteria 3554
400 Ga0501045_0002442 3300049824 Bacteria 12629
401 Ga0501045_0150976 3300049824 Bacteria 1728
402 nmdc:mga0yw44_450784_c1 3300050492 Unclassified 872
403 nmdc:mga07m45_201703_c1 3300050496 Bacteria 1157
404 nmdc:mga05p37_106011_c1 3300050507 Bacteria 3457
405 nmdc:mga05p37_445666_c1 3300050507 Bacteria 1500
406 nmdc:mga05p37_546223_c1 3300050507 Bacteria 1320
407 nmdc:mga05p37_767_c1 3300050507 Bacteria 35697
408 nmdc:mga09592_120890_c1 3300050508 Bacteria 2250
409 nmdc:mga09592_164324_c1 3300050508 Bacteria 1918
410 nmdc:mga09592_1_c1 3300050508 Bacteria 201102
411 nmdc:mga09592_297148_c1 3300050508 Bacteria 1400
412 nmdc:mga09592_33677_c1 3300050508 Bacteria 4279
413 nmdc:mga09592_604553_c1 3300050508 Bacteria 939
414 nmdc:mga09592_6361_c1 3300050508 Bacteria 9622
415 nmdc:mga0qj67_12233_c1 3300050509 Bacteria 4024
416 nmdc:mga0qj67_123_c1 3300050509 Bacteria 51004
417 nmdc:mga06r32_7_c2 3300050510 Bacteria 19902
418 nmdc:mga08y16_14401_c1 3300050511 Bacteria 8322
419 nmdc:mga08y16_578854_c1 3300050511 Bacteria 1134
420 nmdc:mga08y16_68709_c1 3300050511 Bacteria 3694
421 nmdc:mga0n895_312685_c1 3300050512 Bacteria 1592
422 nmdc:mga0n895_559640_c1 3300050512 Bacteria 1149
423 nmdc:mga0n895_9010_c1 3300050512 Bacteria 8702
424 nmdc:mga0rr50_472856_c1 3300050513 Bacteria 1064
425 nmdc:mga0a205_109834_c1 3300050515 Bacteria 2656
426 Ga0495655_0009421 3300053083 Bacteria 1893
427 Ga0495595_0001140 3300053084 Bacteria 10287
428 Ga0500588_0036702 3300053146 Bacteria 1451
429 Ga0501084_0011302 3300054114 Bacteria 7391
430 Ga0501084_0229386 3300054114 Bacteria 1567
431 Ga0501082_0030422 3300060353 Bacteria 4652
432 Ga0530510_0002994 3300061734 Bacteria 11583
433 2515721216 2515154129 Bacteria 5584369
434 2516085992 2515154202 Bacteria 5471270
435 2523385136 2523231044 Bacteria 6434991
436 2643849811 2643221567 Bacteria 4163945
437 2644135813 2643221624 Bacteria 4384879
438 2644611190 2643221711 Bacteria 4865335
439 2772643506 2772190715 Bacteria 6959372
440 2784472241 2784132109 Bacteria 3141763
441 2819427758 2818991318 Bacteria 5266538
442 2819666608 2818991458 Bacteria 4794049
443 2919450455 2919446982 Bacteria 3994487
444 2929224457 2929219909 Bacteria 6984360
445 2996223050 2996221748 Bacteria 6799777
446 8003861366 8003856774 Bacteria 7675274
447 Ga0068857_100180660
448 Ga0006562J51391_1022947
449 Ga0055532_1001968
450 Ga0070676_10199295
451 Ga0070683_100523490
452 Ga0070670_100280295
453 Ga0068869_100152105
454 Ga0070666_10244078
455 Ga0070682_100151923
456 Ga0070682_100180641
457 Ga0068868_100049844
458 Ga0070660_100000818
459 Ga0070689_100020450
460 Ga0070689_100050892
461 Ga0070689_100181012
462 Ga0070687_100340015
463 Ga0070692_10018382
464 Ga0070692_10262447
465 Ga0070669_100152530
466 Ga0070669_100332347
467 Ga0070675_100034558
468 Ga0070675_100256560
469 Ga0070688_100041618
470 Ga0070688_100137719
471 Ga0070659_100271771
472 Ga0070667_100029425
473 Ga0070701_10051675
474 Ga0070701_10193778
475 Ga0070705_100115926
476 Ga0070700_100045791
477 Ga0070700_100174072
478 Ga0070694_100022296
479 Ga0070662_100227887
480 Ga0070662_100237533
481 Ga0068867_100006847
482 Ga0070706_100182650
483 Ga0070706_100372375
484 Ga0070707_100168898
485 Ga0070707_100829858
486 Ga0070698_100191789
487 Ga0070698_100390862
488 Ga0070699_100100237
489 Ga0070679_100087182
490 Ga0070679_100162153
491 Ga0070684_100302926
492 Ga0070684_100584728
493 Ga0070697_100326740
494 Ga0068853_100384508
495 Ga0070672_100453556
496 Ga0070686_100162270
497 Ga0070695_100004297
498 Ga0070696_100062130
499 Ga0070696_100534998
500 Ga0070665_100058253
501 Ga0070665_100789482
502 Ga0070704_100275223
503 Ga0070704_100302984
504 Ga0068855_100000854
505 Ga0070664_100541502
506 Ga0068857_100212924
507 Ga0068857_100426893
508 Ga0068854_100008835
509 Ga0068854_100365098
510 Ga0068856_100440437
511 Ga0070702_100018159
512 Ga0070702_100170957
513 Ga0068852_100504990
514 Ga0068859_100061778
515 Ga0068859_100652658
516 Ga0068866_10029598
517 Ga0068861_100041470
518 Ga0068861_100160591
519 Ga0068870_10067361
520 Ga0068870_10068453
521 Ga0068863_100038345
522 Ga0068858_100483004
523 Ga0081455_10034614
524 Ga0081538_10035296
525 Ga0081538_10053423
526 Ga0081539_10057774
527 Ga0075370_10154354
528 Ga0075428_100007996
529 Ga0075428_100017805
530 Ga0075428_100031987
531 Ga0075428_100290499
532 Ga0075428_100636779
533 Ga0075430_100019794
534 Ga0075431_100052423
535 Ga0075431_100455353
536 Ga0075433_10086743
537 Ga0075434_100040933
538 Ga0075434_100207975
539 Ga0075429_100004732
540 Ga0075429_100019960
541 Ga0075429_100028522
542 Ga0075429_100193935
543 Ga0075429_100234865
544 Ga0075429_100700949
545 Ga0097620_100061777
546 Ga0097620_100652557
547 Ga0075435_100404657
548 Ga0075435_100649151
549 Ga0111539_10012947
550 Ga0111539_10043497
551 Ga0111539_10113447
552 Ga0111539_10251958
553 Ga0111539_10537411
554 Ga0111539_11228672
555 Ga0105245_10071589
556 Ga0105247_10120326
557 Ga0114129_10000016
558 Ga0114129_10023083
559 Ga0114129_10241777
560 Ga0114129_10253548
561 Ga0114129_10378190
562 Ga0105243_10015660
563 Ga0105243_10455268
564 Ga0105243_10462512
565 Ga0105238_10688988
566 Ga0105249_10016232
567 Ga0105249_10730137
568 Ga0157369_10112476
569 Ga0157369_10201312
570 Ga0157378_10219159
571 Ga0157378_11020582
572 Ga0163162_10232820
573 Ga0163162_10287467
574 Ga0163162_10612294
575 Ga0157372_10397962
576 Ga0157375_10142199
577 Ga0157375_10408256
578 Ga0157375_10675659
579 Ga0163163_10072298
580 Ga0163163_10265490
581 Ga0163163_10277748
582 Ga0157380_10076396
583 Ga0157380_10078367
584 Ga0157380_10297147
585 Ga0163161_10395965
586 Ga0206353_11819676
587 Ga0213873_10059027
588 Ga0213876_10035427
589 Ga0224712_10058091
590 Ga0209147_100082
591 Ga0207688_10061765
592 Ga0207688_10222553
593 Ga0207645_10104383
594 Ga0207645_10170664
595 Ga0207684_10282373
596 Ga0207684_10350388
597 Ga0207684_10509054
598 Ga0207657_10003982
599 Ga0207646_10238486
600 Ga0207681_10039596
601 Ga0207681_10172898
602 Ga0207650_10293372
603 Ga0207659_10044060
604 Ga0207659_10232368
605 Ga0207659_10580474
606 Ga0207687_10037311
607 Ga0207690_10139617
608 Ga0207706_10099990
609 Ga0207706_10108549
610 Ga0207706_10597636
611 Ga0207670_10144317
612 Ga0207704_10256896
613 Ga0207691_10130223
614 Ga0207691_10171714
615 Ga0207661_10516202
616 Ga0207679_10454890
617 Ga0207679_10505485
618 Ga0207667_10002571
619 Ga0207712_10275875
620 Ga0207668_10133941
621 Ga0207640_10108989
622 Ga0207658_10494255
623 Ga0207677_10053665
624 Ga0207703_10660767
625 Ga0207639_10185354
626 Ga0207678_10314469
627 Ga0207678_10327151
628 Ga0207708_10032294
629 Ga0207708_10050608
630 Ga0207708_10174763
631 Ga0207708_10253061
632 Ga0207708_10631164
633 Ga0207641_10116392
634 Ga0207648_10027535
635 Ga0207648_10401267
636 Ga0207674_10035541
637 Ga0207674_10092809
638 Ga0207674_10118988
639 Ga0207674_10250381
640 Ga0207675_100019532
641 Ga0207675_100036289
642 Ga0207675_100462393
643 Ga0207428_10021378
644 Ga0207428_10058340
645 Ga0268266_10343433
646 Ga0268265_10196858
647 Ga0268264_10021460
648 Ga0268264_10488099
649 Ga0307515_10000901
650 Ga0265338_10021752
651 Ga0307509_10002143
652 Ga0307408_100066933
653 Ga0316579_10001075
654 Ga0316579_10007468
655 Ga0316579_10103783
656 Ga0316576_10164343
657 Ga0316578_10038999
658 Ga0316578_10091517
659 Ga0307405_10048242
660 Ga0307405_10203114
661 Ga0316577_10021608
662 Ga0316577_10202988
663 Ga0307413_10126725
664 Ga0307413_10637121
665 Ga0307410_10001308
666 Ga0307410_10266201
667 Ga0307410_10340930
668 Ga0307407_10122152
669 Ga0307407_10137103
670 Ga0307412_10422316
671 Ga0307412_10802105
672 Ga0307409_100174575
673 Ga0307409_100314602
674 Ga0307416_100128191
675 Ga0307416_100403728
676 Ga0307416_100446191
677 Ga0307414_10380015
678 Ga0307411_10095393
679 Ga0307415_100071545
680 Ga0307415_100297034
681 Ga0307415_100578410
682 Ga0316585_10022232
683 Ga0316580_10003049
684 Ga0316593_10001753
685 Ga0316593_10002750
686 Ga0316593_10005591
687 Ga0373934_0003162
688 Ga0373954_0006874
689 Ga0373956_0002550
690 Ga0373955_0016781
691 Ga0316574_0048910
692 Ga0373933_0016681
693 Ga0373937_0153413
694 Ga0316582_0027641
695 Ga0316582_0146370
696 Ga0316582_0323379
697 Ga0316584_0213125
698 Ga0395899_0078207
699 Ga0395900_0004598
700 Ga0395900_0285109
701 Ga0395898_0000549
702 Ga0395898_0035332
703 Ga0395898_0156275
704 Ga0395898_0415499
705 Ga0395905_0003109
706 Ga0395905_0054081
707 Ga0395905_0173508
708 Ga0316581_0007736
709 Ga0395901_0000238
710 Ga0395901_0013193
711 Ga0395901_0016256
712 Ga0395901_0035242
713 Ga0395901_0055392
714 Ga0395901_0346735
715 Ga0395901_0574007
716 Ga0436365_0396298
717 Ga0436362_0469196
718 Ga0451837_0450972
719 Ga0451845_0195175
720 Ga0466963_0072723
721 Ga0466963_0311080
722 Ga0466963_0325655
723 Ga0453684_0027621
724 Ga0453684_0103149
725 Ga0466971_0004687
726 Ga0466957_0049958
727 Ga0466960_0030602
728 Ga0466960_0154050
729 Ga0466960_0163809
730 Ga0451576_0059266
731 Ga0451576_0067191
732 Ga0466967_0010057
733 Ga0466967_0016734
734 Ga0466967_0100780
735 Ga0495592_0003973
736 Ga0495603_0112722
737 Ga0495641_0013965
738 Ga0495651_0310618
739 Ga0495653_0178396
740 Ga0495653_0243727
741 Ga0495594_0272555
742 Ga0495608_0001370
743 Ga0495618_0000978
744 Ga0495628_0046390
745 Ga0495630_0157960
746 Ga0495652_0423510
747 Ga0495586_0353303
748 Ga0495635_0069628
749 Ga0495657_0004189
750 Ga0495658_0311546
751 Ga0495600_0051469
752 Ga0495581_0056870
753 Ga0495680_0070380
754 Ga0495675_0004092
755 Ga0495675_0138198
756 Ga0495684_0238116
757 Ga0496100_0007961
758 Ga0496100_0431230
759 Ga0496101_0090523
760 Ga0496101_0122078
761 Ga0496101_0168155
762 Ga0496101_0459407
763 Ga0496102_0008045
764 Ga0496102_0009907
765 Ga0496102_0035028
766 Ga0496102_0256938
767 Ga0496102_0355584
768 Ga0496103_0027168
769 Ga0496104_0008504
770 Ga0496104_0193778
771 Ga0496104_0207815
772 Ga0496104_0598066
773 Ga0496105_0079636
774 Ga0496105_0275308
775 Ga0496105_0346192
776 Ga0496106_0067492
777 Ga0496106_0257063
778 Ga0496106_0505521
779 Ga0496108_0149133
780 Ga0496108_0286019
781 Ga0496109_0019127
782 Ga0496109_0067998
783 Ga0496109_0138567
784 Ga0496110_0037356
785 Ga0496110_0096454
786 Ga0496110_0302651
787 Ga0496111_0029367
788 Ga0496111_0458427
789 Ga0496111_0534585
790 Ga0496112_0231042
791 Ga0496112_0314281
792 Ga0496112_0492800
793 Ga0496113_0008191
794 Ga0496114_0007476
795 Ga0496114_0044073
796 Ga0496114_0049505
797 Ga0496115_0154524
798 Ga0496121_0174456
799 Ga0501311_013849
800 Ga0501313_015384
801 Ga0501315_013113
802 Ga0501317_017316
803 Ga0501317_024023
804 Ga0501320_002092
805 Ga0501323_015748
806 Ga0501031_0045892
807 Ga0501031_0217473
808 Ga0501032_0043486
809 Ga0501033_0224561
810 Ga0501034_0718057
811 Ga0501036_0014628
812 Ga0501036_0132829
813 Ga0501036_0567250
814 Ga0501037_0139030
815 Ga0501038_0001144
816 Ga0501038_0296561
817 Ga0501039_0026930
818 Ga0501039_0031784
819 Ga0501041_0000946
820 Ga0501041_0085845
821 Ga0501042_0017248
822 Ga0501043_0013447
823 Ga0501048_0021968
824 Ga0501048_0166624
825 Ga0501048_0317402
826 Ga0501048_0453065
827 Ga0501069_0459925
828 Ga0501071_0159439
829 Ga0501072_0027456
830 Ga0501072_0058182
831 Ga0501073_0374979
832 Ga0501074_0026253
833 Ga0501074_0063411
834 Ga0501075_0035124
835 Ga0501076_0030916
836 Ga0501079_0008527
837 Ga0501079_0145437
838 Ga0501080_0003678
839 Ga0501080_0057953
840 Ga0501081_0002354
841 Ga0501083_0194996
842 Ga0501083_0255924
843 Ga0501035_0071245
844 Ga0501035_0460762
845 Ga0501044_0070544
846 Ga0501045_0002442
847 Ga0501045_0150976
848 nmdc:mga0yw44_450784_c1
849 nmdc:mga07m45_201703_c1
850 nmdc:mga05p37_106011_c1
851 nmdc:mga05p37_445666_c1
852 nmdc:mga05p37_546223_c1
853 nmdc:mga05p37_767_c1
854 nmdc:mga09592_120890_c1
855 nmdc:mga09592_164324_c1
856 nmdc:mga09592_1_c1
857 nmdc:mga09592_297148_c1
858 nmdc:mga09592_33677_c1
859 nmdc:mga09592_604553_c1
860 nmdc:mga09592_6361_c1
861 nmdc:mga0qj67_12233_c1
862 nmdc:mga0qj67_123_c1
863 nmdc:mga06r32_7_c2
864 nmdc:mga08y16_14401_c1
865 nmdc:mga08y16_578854_c1
866 nmdc:mga08y16_68709_c1
867 nmdc:mga0n895_312685_c1
868 nmdc:mga0n895_559640_c1
869 nmdc:mga0n895_9010_c1
870 nmdc:mga0rr50_472856_c1
871 nmdc:mga0a205_109834_c1
872 Ga0495655_0009421
873 Ga0495595_0001140
874 Ga0500588_0036702
875 Ga0501084_0011302
876 Ga0501084_0229386
877 Ga0501082_0030422
878 Ga0530510_0002994
879 2515721216
880 2516085992
881 2523385136
882 2643849811
883 2644135813
884 2644611190
885 2772643506
886 2784472241
887 2819427758
888 2819666608
889 2919450455
890 2929224457
891 2996223050
892 8003861366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

220

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

265

0.96

PF08659

KR

KR domain

27

205

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

28

203

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ovk-assembly1.cif.gz_A crystal structure maba bound to nadph from m. smegmatis 0.9843 5 239
2ntn-assembly1.cif.gz_B-2 crystal structure of maba-c60v/g139a/s144l 0.9841 5 237
5ovk-assembly1.cif.gz_D crystal structure maba bound to nadph from m. smegmatis 0.9836 5 239
1uzn-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9826 5 239
1uzn-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9821 5 239
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9865 72 235 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9841 5 237 3.40.50.720
5ovlC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9721 5 239 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9685 5 235 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9671 2 172 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A849HE45-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9958 4 239 GO:0016491
AF-A0A7V8YHF9-F1-model_v4 3-oxoacyl-ACP reductase FabG 0.994 6 239 GO:0016616
AF-A0A1Q7VS02-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9939 5 239 GO:0016616
AF-A0A6L6ERZ7-F1-model_v4 SDR family oxidoreductase 0.9926 59 238 GO:0016616
AF-A0A1B1N8D6-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) 0.992 1 239 GO:0004316

Map