F445599
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 445 | 253 | 433 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0072393|Ga0496117_0072393_1329_2090 |
| Length | 253 |
| Sequence | MSAKITALHRRPSRPTRMDRRRDLAIKEGMMKLFIGNKAYSSWSLRGWLACKLSGLPFEEVVVPLYDQAWEKRREGDEFAPSSGKVPILWDGDDIVVWDSLAIVEYLNEKSDGDRIWPSDPAARAMARSMAAEMHSSFAALRREHSMNIRQIYAPAPPSTEVEQDIARIMELWAQARARHGGDGEFLFGAFSAADVMFAPVVTRFITYQLPVARFAQAYMHAIIAHPWMQEWIGGAQAEDWIIDKFELPPQTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 5 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 6 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 7 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 8 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 9 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 10 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 11 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 12 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 162 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 163 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 164 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 170 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 208 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 211 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 212 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 213 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 236 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 237 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 238 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 241 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 242 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 243 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 244 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 245 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 246 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 247 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 248 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 249 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 250 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 252 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 253 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.3 |
| Metatranscriptomes | 0 |
| Isolates | 2.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.91 |
| Nodule | 0 |
| Rhizoplane | 1.8 |
| Rhizosphere | 74.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001619 | 3300001904 | Bacteria | 4084 |
| 2 | JGI24736J21556_1003382 | 3300001904 | Bacteria | 2771 |
| 3 | JGI24741J21665_1000001 | 3300001915 | Bacteria | 68427 |
| 4 | JGI24740J21852_10001522 | 3300001979 | Bacteria | 10655 |
| 5 | JGI24739J22299_10000851 | 3300001989 | Bacteria | 11234 |
| 6 | JGI24739J22299_10003297 | 3300001989 | Bacteria | 6151 |
| 7 | JGI24739J22299_10012988 | 3300001989 | Bacteria | 3048 |
| 8 | JGI24739J22299_10078374 | 3300001989 | Bacteria | 1018 |
| 9 | JGI24737J22298_10000719 | 3300001990 | Bacteria | 11649 |
| 10 | JGI24737J22298_10001952 | 3300001990 | Bacteria | 7378 |
| 11 | JGI24737J22298_10048962 | 3300001990 | Bacteria | 1286 |
| 12 | JGI24743J22301_10049196 | 3300001991 | Bacteria | 857 |
| 13 | JGI24735J21928_10004239 | 3300002067 | Bacteria | 4837 |
| 14 | JGI24735J21928_10005935 | 3300002067 | Bacteria | 4034 |
| 15 | JGI24735J21928_10011300 | 3300002067 | Bacteria | 2834 |
| 16 | JGI24735J21928_10012995 | 3300002067 | Bacteria | 2624 |
| 17 | JGI24735J21928_10018808 | 3300002067 | Bacteria | 2128 |
| 18 | JGI24735J21928_10021137 | 3300002067 | Bacteria | 1989 |
| 19 | JGI24735J21928_10029317 | 3300002067 | Bacteria | 1639 |
| 20 | JGI24738J21930_10001250 | 3300002075 | Bacteria | 7142 |
| 21 | JGI24738J21930_10004515 | 3300002075 | Bacteria | 3403 |
| 22 | JGI24738J21930_10005832 | 3300002075 | Bacteria | 2926 |
| 23 | JGI24742J22300_10034976 | 3300002244 | Bacteria | 885 |
| 24 | JGI25165J46597_1000165 | 3300003214 | Bacteria | 104009 |
| 25 | rootH2_10155443 | 3300003320 | Bacteria | 2341 |
| 26 | rootL2_10076898 | 3300003322 | Bacteria | 3607 |
| 27 | rootL2_10155331 | 3300003322 | Bacteria | 1139 |
| 28 | rootH1_10106799 | 3300003323 | Bacteria | 2604 |
| 29 | rootH1_10262695 | 3300003323 | Bacteria | 2354 |
| 30 | Ga0055542_1009332 | 3300003762 | Bacteria | 1858 |
| 31 | Ga0055529_1005504 | 3300003763 | Bacteria | 1824 |
| 32 | Ga0055536_1009163 | 3300003781 | Bacteria | 4138 |
| 33 | Ga0055536_1012735 | 3300003781 | Bacteria | 3093 |
| 34 | Ga0055536_1019914 | 3300003781 | Bacteria | 2092 |
| 35 | Ga0055534_1005827 | 3300003784 | Bacteria | 3223 |
| 36 | Ga0055530_10000197 | 3300003791 | Bacteria | 54281 |
| 37 | Ga0055531_10008524 | 3300003794 | Bacteria | 5383 |
| 38 | Ga0065704_10001961 | 3300005289 | Bacteria | 10690 |
| 39 | Ga0065704_10003935 | 3300005289 | Bacteria | 8288 |
| 40 | Ga0065704_10113709 | 3300005289 | Bacteria | 1902 |
| 41 | Ga0065704_10164837 | 3300005289 | Bacteria | 1321 |
| 42 | Ga0065707_10166599 | 3300005295 | Bacteria | 1517 |
| 43 | Ga0070658_10000062 | 3300005327 | Bacteria | 107844 |
| 44 | Ga0070658_10004018 | 3300005327 | Bacteria | 12053 |
| 45 | Ga0070658_10004565 | 3300005327 | Bacteria | 11251 |
| 46 | Ga0070658_10037040 | 3300005327 | Bacteria | 3931 |
| 47 | Ga0070658_10067181 | 3300005327 | Bacteria | 2929 |
| 48 | Ga0070658_10217520 | 3300005327 | Bacteria | 1615 |
| 49 | Ga0070676_10000416 | 3300005328 | Bacteria | 20088 |
| 50 | Ga0070683_100458475 | 3300005329 | Bacteria | 1217 |
| 51 | Ga0070670_100083167 | 3300005331 | Bacteria | 2751 |
| 52 | Ga0070670_100155196 | 3300005331 | Bacteria | 1982 |
| 53 | Ga0068869_100015254 | 3300005334 | Bacteria | 5150 |
| 54 | Ga0070660_100000377 | 3300005339 | Bacteria | 29678 |
| 55 | Ga0070660_100002444 | 3300005339 | Bacteria | 12761 |
| 56 | Ga0070660_100014500 | 3300005339 | Bacteria | 5679 |
| 57 | Ga0070660_100019488 | 3300005339 | Bacteria | 4972 |
| 58 | Ga0070660_100033044 | 3300005339 | Bacteria | 3897 |
| 59 | Ga0070668_100000019 | 3300005347 | Bacteria | 98356 |
| 60 | Ga0070668_100053308 | 3300005347 | Bacteria | 3119 |
| 61 | Ga0070669_100004351 | 3300005353 | Bacteria | 10225 |
| 62 | Ga0070669_100160160 | 3300005353 | Bacteria | 1748 |
| 63 | Ga0070675_100150155 | 3300005354 | Bacteria | 1997 |
| 64 | Ga0070671_100030999 | 3300005355 | Bacteria | 4415 |
| 65 | Ga0070671_100067672 | 3300005355 | Bacteria | 2978 |
| 66 | Ga0070673_100000002 | 3300005364 | Bacteria | 225084 |
| 67 | Ga0070688_100473021 | 3300005365 | Bacteria | 941 |
| 68 | Ga0070659_100006403 | 3300005366 | Bacteria | 8501 |
| 69 | Ga0070659_100036509 | 3300005366 | Bacteria | 3831 |
| 70 | Ga0070659_100254525 | 3300005366 | Bacteria | 1456 |
| 71 | Ga0070659_100461694 | 3300005366 | Bacteria | 1078 |
| 72 | Ga0070667_100000094 | 3300005367 | Bacteria | 111140 |
| 73 | Ga0070701_10045151 | 3300005438 | Bacteria | 2260 |
| 74 | Ga0070662_100029502 | 3300005457 | Bacteria | 3828 |
| 75 | Ga0070662_100041043 | 3300005457 | Bacteria | 3299 |
| 76 | Ga0070662_100146476 | 3300005457 | Bacteria | 1835 |
| 77 | Ga0070662_100267170 | 3300005457 | Bacteria | 1380 |
| 78 | Ga0068867_100000012 | 3300005459 | Bacteria | 118831 |
| 79 | Ga0070685_10161641 | 3300005466 | Bacteria | 1428 |
| 80 | Ga0070698_100748439 | 3300005471 | Bacteria | 920 |
| 81 | Ga0068853_100041194 | 3300005539 | Bacteria | 3943 |
| 82 | Ga0068853_100111734 | 3300005539 | Bacteria | 2428 |
| 83 | Ga0068853_100279663 | 3300005539 | Bacteria | 1538 |
| 84 | Ga0070686_100117382 | 3300005544 | Bacteria | 1822 |
| 85 | Ga0070693_100020120 | 3300005547 | Bacteria | 3514 |
| 86 | Ga0070665_100028448 | 3300005548 | Bacteria | 5628 |
| 87 | Ga0068855_100000095 | 3300005563 | Bacteria | 106561 |
| 88 | Ga0068855_100071449 | 3300005563 | Bacteria | 4036 |
| 89 | Ga0068855_100114092 | 3300005563 | Bacteria | 3098 |
| 90 | Ga0070664_100028935 | 3300005564 | Bacteria | 4615 |
| 91 | Ga0070664_100273443 | 3300005564 | Bacteria | 1522 |
| 92 | Ga0068857_100024736 | 3300005577 | Bacteria | 5289 |
| 93 | Ga0068854_100000265 | 3300005578 | Bacteria | 35689 |
| 94 | Ga0068854_100046578 | 3300005578 | Bacteria | 3088 |
| 95 | Ga0068856_100016744 | 3300005614 | Bacteria | 7101 |
| 96 | Ga0068856_100051628 | 3300005614 | Bacteria | 4054 |
| 97 | Ga0068856_100072555 | 3300005614 | Bacteria | 3408 |
| 98 | Ga0068856_100436920 | 3300005614 | Bacteria | 1329 |
| 99 | Ga0068852_100000586 | 3300005616 | Bacteria | 23996 |
| 100 | Ga0068852_100181971 | 3300005616 | Bacteria | 1977 |
| 101 | Ga0068859_100105153 | 3300005617 | Bacteria | 2882 |
| 102 | Ga0068864_100385107 | 3300005618 | Bacteria | 1330 |
| 103 | Ga0068861_100050543 | 3300005719 | Bacteria | 3152 |
| 104 | Ga0068863_100000057 | 3300005841 | Bacteria | 123606 |
| 105 | Ga0068860_100018154 | 3300005843 | Bacteria | 6847 |
| 106 | Ga0081455_10000187 | 3300005937 | Bacteria | 78623 |
| 107 | Ga0075363_100005054 | 3300006048 | Bacteria | 5835 |
| 108 | Ga0075367_10002832 | 3300006178 | Bacteria | 8060 |
| 109 | Ga0075366_10041128 | 3300006195 | Bacteria | 2736 |
| 110 | Ga0097621_100001128 | 3300006237 | Bacteria | 18562 |
| 111 | Ga0075370_10017804 | 3300006353 | Bacteria | 3844 |
| 112 | Ga0075370_10104550 | 3300006353 | Bacteria | 1641 |
| 113 | Ga0068871_100007431 | 3300006358 | Bacteria | 7829 |
| 114 | Ga0068865_100000004 | 3300006881 | Bacteria | 226236 |
| 115 | Ga0097620_100105147 | 3300006931 | Bacteria | 2882 |
| 116 | Ga0105251_10012849 | 3300009011 | Bacteria | 4714 |
| 117 | Ga0105240_10179929 | 3300009093 | Bacteria | 2496 |
| 118 | Ga0105245_10001027 | 3300009098 | Bacteria | 25355 |
| 119 | Ga0114129_10374160 | 3300009147 | Bacteria | 1882 |
| 120 | Ga0105243_10000146 | 3300009148 | Bacteria | 81008 |
| 121 | Ga0105241_10006190 | 3300009174 | Bacteria | 8828 |
| 122 | Ga0105242_10000497 | 3300009176 | Bacteria | 31053 |
| 123 | Ga0105237_10015961 | 3300009545 | Bacteria | 7808 |
| 124 | Ga0105237_10052574 | 3300009545 | Bacteria | 4088 |
| 125 | Ga0105249_10015630 | 3300009553 | Bacteria | 6720 |
| 126 | Ga0105249_10436507 | 3300009553 | Bacteria | 1346 |
| 127 | Ga0105249_10635172 | 3300009553 | Bacteria | 1124 |
| 128 | Ga0105148_100146 | 3300009978 | Bacteria | 10542 |
| 129 | Ga0105239_10141816 | 3300010375 | Bacteria | 2678 |
| 130 | Ga0105239_10491278 | 3300010375 | Bacteria | 1395 |
| 131 | Ga0105239_10508456 | 3300010375 | Bacteria | 1370 |
| 132 | Ga0105246_10000138 | 3300011119 | Bacteria | 33809 |
| 133 | Ga0157373_10003665 | 3300013100 | Bacteria | 11612 |
| 134 | Ga0157373_10043196 | 3300013100 | Bacteria | 3220 |
| 135 | Ga0157373_10045347 | 3300013100 | Bacteria | 3138 |
| 136 | Ga0157371_10214174 | 3300013102 | Bacteria | 1383 |
| 137 | Ga0157370_10000096 | 3300013104 | Bacteria | 99163 |
| 138 | Ga0157370_10091181 | 3300013104 | Bacteria | 2861 |
| 139 | Ga0157370_10096868 | 3300013104 | Bacteria | 2767 |
| 140 | Ga0157369_10022918 | 3300013105 | Bacteria | 6962 |
| 141 | Ga0157369_10187251 | 3300013105 | Bacteria | 2176 |
| 142 | Ga0157369_10282891 | 3300013105 | Bacteria | 1727 |
| 143 | Ga0157374_10001104 | 3300013296 | Bacteria | 23221 |
| 144 | Ga0157374_10010449 | 3300013296 | Bacteria | 7984 |
| 145 | Ga0157378_10812021 | 3300013297 | Bacteria | 962 |
| 146 | Ga0157372_10034063 | 3300013307 | Bacteria | 5596 |
| 147 | Ga0157372_10060755 | 3300013307 | Bacteria | 4229 |
| 148 | Ga0157372_10081266 | 3300013307 | Bacteria | 3668 |
| 149 | Ga0157372_10725164 | 3300013307 | Bacteria | 1156 |
| 150 | Ga0157372_10737957 | 3300013307 | Bacteria | 1145 |
| 151 | Ga0157375_10000587 | 3300013308 | Bacteria | 32327 |
| 152 | Ga0157375_10063387 | 3300013308 | Bacteria | 3677 |
| 153 | Ga0157380_10259160 | 3300014326 | Bacteria | 1578 |
| 154 | Ga0157376_10000131 | 3300014969 | Bacteria | 51790 |
| 155 | Ga0163161_10002898 | 3300017792 | Bacteria | 12137 |
| 156 | Ga0163161_10030610 | 3300017792 | Bacteria | 3832 |
| 157 | Ga0163161_10212334 | 3300017792 | Bacteria | 1495 |
| 158 | Ga0163161_10399733 | 3300017792 | Bacteria | 1101 |
| 159 | Ga0209147_100815 | 3300025229 | Bacteria | 14909 |
| 160 | Ga0207427_100557 | 3300025231 | Bacteria | 18931 |
| 161 | Ga0209026_1001831 | 3300025250 | Bacteria | 8716 |
| 162 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 163 | Ga0209148_1001194 | 3300025254 | Bacteria | 14881 |
| 164 | Ga0209233_1000098 | 3300025261 | Bacteria | 294111 |
| 165 | Ga0209455_1000574 | 3300025272 | Bacteria | 24064 |
| 166 | Ga0209455_1039272 | 3300025272 | Bacteria | 732 |
| 167 | Ga0209675_1000162 | 3300025291 | Bacteria | 83810 |
| 168 | Ga0209676_1000113 | 3300025292 | Bacteria | 207931 |
| 169 | Ga0209676_1000146 | 3300025292 | Bacteria | 174095 |
| 170 | Ga0209676_1002307 | 3300025292 | Bacteria | 13898 |
| 171 | Ga0209676_1059602 | 3300025292 | Bacteria | 957 |
| 172 | Ga0209025_1035622 | 3300025294 | Bacteria | 2245 |
| 173 | Ga0209050_1000126 | 3300025298 | Bacteria | 188438 |
| 174 | Ga0209050_1013537 | 3300025298 | Bacteria | 3612 |
| 175 | Ga0209050_1021825 | 3300025298 | Bacteria | 2317 |
| 176 | Ga0209257_1000256 | 3300025304 | Bacteria | 123057 |
| 177 | Ga0209257_1002572 | 3300025304 | Bacteria | 17649 |
| 178 | Ga0209257_1002727 | 3300025304 | Bacteria | 16784 |
| 179 | Ga0207688_10184696 | 3300025901 | Bacteria | 1245 |
| 180 | Ga0207680_10053509 | 3300025903 | Bacteria | 2424 |
| 181 | Ga0207647_10004165 | 3300025904 | Bacteria | 10726 |
| 182 | Ga0207647_10012219 | 3300025904 | Bacteria | 5985 |
| 183 | Ga0207647_10020602 | 3300025904 | Bacteria | 4419 |
| 184 | Ga0207647_10082489 | 3300025904 | Bacteria | 1926 |
| 185 | Ga0207647_10095278 | 3300025904 | Bacteria | 1772 |
| 186 | Ga0207645_10004384 | 3300025907 | Bacteria | 10452 |
| 187 | Ga0207705_10000055 | 3300025909 | Bacteria | 160436 |
| 188 | Ga0207705_10000179 | 3300025909 | Bacteria | 66765 |
| 189 | Ga0207705_10007178 | 3300025909 | Bacteria | 8207 |
| 190 | Ga0207705_10049148 | 3300025909 | Bacteria | 3036 |
| 191 | Ga0207705_10440011 | 3300025909 | Bacteria | 1010 |
| 192 | Ga0207705_10564913 | 3300025909 | Bacteria | 884 |
| 193 | Ga0207695_10005778 | 3300025913 | Bacteria | 16288 |
| 194 | Ga0207671_10014180 | 3300025914 | Bacteria | 6309 |
| 195 | Ga0207671_10090510 | 3300025914 | Bacteria | 2304 |
| 196 | Ga0207657_10000791 | 3300025919 | Bacteria | 33627 |
| 197 | Ga0207657_10004951 | 3300025919 | Bacteria | 14018 |
| 198 | Ga0207657_10010795 | 3300025919 | Bacteria | 9092 |
| 199 | Ga0207657_10013332 | 3300025919 | Bacteria | 8064 |
| 200 | Ga0207681_10002127 | 3300025923 | Bacteria | 12647 |
| 201 | Ga0207681_10331354 | 3300025923 | Bacteria | 1213 |
| 202 | Ga0207681_10393024 | 3300025923 | Bacteria | 1119 |
| 203 | Ga0207694_10061897 | 3300025924 | Bacteria | 2913 |
| 204 | Ga0207650_10108279 | 3300025925 | Bacteria | 2148 |
| 205 | Ga0207650_10129821 | 3300025925 | Bacteria | 1971 |
| 206 | Ga0207644_10113154 | 3300025931 | Bacteria | 2055 |
| 207 | Ga0207644_10126625 | 3300025931 | Bacteria | 1950 |
| 208 | Ga0207644_10164538 | 3300025931 | Bacteria | 1727 |
| 209 | Ga0207706_10010431 | 3300025933 | Bacteria | 8489 |
| 210 | Ga0207706_10017733 | 3300025933 | Bacteria | 6413 |
| 211 | Ga0207706_10036405 | 3300025933 | Bacteria | 4371 |
| 212 | Ga0207706_10037963 | 3300025933 | Bacteria | 4274 |
| 213 | Ga0207706_10053390 | 3300025933 | Bacteria | 3568 |
| 214 | Ga0207706_10162190 | 3300025933 | Bacteria | 1965 |
| 215 | Ga0207686_10004317 | 3300025934 | Bacteria | 7623 |
| 216 | Ga0207709_10000314 | 3300025935 | Bacteria | 52842 |
| 217 | Ga0207670_10032957 | 3300025936 | Bacteria | 3335 |
| 218 | Ga0207704_10000005 | 3300025938 | Bacteria | 225353 |
| 219 | Ga0207704_10519372 | 3300025938 | Bacteria | 963 |
| 220 | Ga0207691_10031510 | 3300025940 | Bacteria | 4947 |
| 221 | Ga0207689_10001653 | 3300025942 | Bacteria | 21135 |
| 222 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 223 | Ga0207667_10079777 | 3300025949 | Bacteria | 3392 |
| 224 | Ga0207667_10251436 | 3300025949 | Bacteria | 1808 |
| 225 | Ga0207651_10000007 | 3300025960 | Bacteria | 225286 |
| 226 | Ga0207712_10007902 | 3300025961 | Bacteria | 6720 |
| 227 | Ga0207712_10095408 | 3300025961 | Bacteria | 2199 |
| 228 | Ga0207668_10000296 | 3300025972 | Bacteria | 32653 |
| 229 | Ga0207668_10036012 | 3300025972 | Bacteria | 3301 |
| 230 | Ga0207640_10000139 | 3300025981 | Bacteria | 53517 |
| 231 | Ga0207640_10024737 | 3300025981 | Bacteria | 3628 |
| 232 | Ga0207658_10000072 | 3300025986 | Bacteria | 112469 |
| 233 | Ga0207677_10000085 | 3300026023 | Bacteria | 78393 |
| 234 | Ga0207639_10047804 | 3300026041 | Bacteria | 3235 |
| 235 | Ga0207639_10057513 | 3300026041 | Bacteria | 2986 |
| 236 | Ga0207678_10035760 | 3300026067 | Bacteria | 4324 |
| 237 | Ga0207678_10036634 | 3300026067 | Bacteria | 4270 |
| 238 | Ga0207708_10219575 | 3300026075 | Bacteria | 1522 |
| 239 | Ga0207702_10005342 | 3300026078 | Bacteria | 11261 |
| 240 | Ga0207702_10018661 | 3300026078 | Bacteria | 5738 |
| 241 | Ga0207702_10383110 | 3300026078 | Bacteria | 1353 |
| 242 | Ga0207641_10000096 | 3300026088 | Bacteria | 123585 |
| 243 | Ga0207648_10000005 | 3300026089 | Bacteria | 225083 |
| 244 | Ga0207674_10006242 | 3300026116 | Bacteria | 14046 |
| 245 | Ga0207674_10017443 | 3300026116 | Bacteria | 7835 |
| 246 | Ga0207675_100028654 | 3300026118 | Bacteria | 5187 |
| 247 | Ga0207698_10000294 | 3300026142 | Bacteria | 30242 |
| 248 | Ga0207698_10010421 | 3300026142 | Bacteria | 5971 |
| 249 | Ga0207698_10056740 | 3300026142 | Bacteria | 3025 |
| 250 | Ga0209813_10000020 | 3300027866 | Bacteria | 75376 |
| 251 | Ga0268266_10135170 | 3300028379 | Bacteria | 2208 |
| 252 | Ga0268264_10012832 | 3300028381 | Bacteria | 6896 |
| 253 | Ga0307408_100027647 | 3300031548 | Bacteria | 3911 |
| 254 | Ga0307405_10048066 | 3300031731 | Bacteria | 2629 |
| 255 | Ga0307405_10146823 | 3300031731 | Bacteria | 1653 |
| 256 | Ga0307413_10086671 | 3300031824 | Bacteria | 2025 |
| 257 | Ga0307406_10085972 | 3300031901 | Bacteria | 2104 |
| 258 | Ga0307406_10105751 | 3300031901 | Bacteria | 1926 |
| 259 | Ga0307406_10393431 | 3300031901 | Bacteria | 1096 |
| 260 | Ga0307412_10001306 | 3300031911 | Bacteria | 13981 |
| 261 | Ga0307412_10001453 | 3300031911 | Bacteria | 13173 |
| 262 | Ga0307412_10020708 | 3300031911 | Bacteria | 4006 |
| 263 | Ga0307412_10091719 | 3300031911 | Bacteria | 2127 |
| 264 | Ga0307412_10098664 | 3300031911 | Bacteria | 2060 |
| 265 | Ga0307414_10000607 | 3300032004 | Bacteria | 18398 |
| 266 | Ga0307414_10012355 | 3300032004 | Bacteria | 5046 |
| 267 | Ga0307414_10079396 | 3300032004 | Bacteria | 2395 |
| 268 | Ga0307414_10102825 | 3300032004 | Bacteria | 2154 |
| 269 | Ga0307414_10216193 | 3300032004 | Bacteria | 1570 |
| 270 | Ga0307411_10043443 | 3300032005 | Bacteria | 2875 |
| 271 | Ga0307415_100677333 | 3300032126 | Bacteria | 928 |
| 272 | Ga0395899_0001254 | 3300037312 | Bacteria | 22064 |
| 273 | Ga0395900_0090023 | 3300037418 | Bacteria | 3154 |
| 274 | Ga0395900_0366027 | 3300037418 | Bacteria | 1412 |
| 275 | Ga0395905_0095441 | 3300037471 | Bacteria | 2791 |
| 276 | Ga0395905_0224836 | 3300037471 | Bacteria | 1756 |
| 277 | Ga0395901_0998747 | 3300038443 | Bacteria | 813 |
| 278 | Ga0439448_0000954 | 3300042005 | Bacteria | 7133 |
| 279 | Ga0439448_0002340 | 3300042005 | Bacteria | 5139 |
| 280 | Ga0439448_0003467 | 3300042005 | Bacteria | 4370 |
| 281 | Ga0439448_0005772 | 3300042005 | Bacteria | 3536 |
| 282 | Ga0439455_0000109 | 3300042012 | Bacteria | 8273 |
| 283 | Ga0439455_0000505 | 3300042012 | Bacteria | 5435 |
| 284 | Ga0439455_0002132 | 3300042012 | Bacteria | 3535 |
| 285 | Ga0439458_0000632 | 3300042157 | Bacteria | 9121 |
| 286 | Ga0439458_0001013 | 3300042157 | Bacteria | 7188 |
| 287 | Ga0466972_0010990 | 3300044658 | Bacteria | 4545 |
| 288 | Ga0466965_0027007 | 3300044683 | Bacteria | 2784 |
| 289 | Ga0466966_0011213 | 3300044684 | Bacteria | 5949 |
| 290 | Ga0466961_0011581 | 3300044693 | Bacteria | 5637 |
| 291 | Ga0466963_0049425 | 3300044694 | Bacteria | 2781 |
| 292 | Ga0466964_0013581 | 3300044706 | Bacteria | 3089 |
| 293 | Ga0466971_0022878 | 3300044719 | Bacteria | 2785 |
| 294 | Ga0466970_0004968 | 3300044765 | Bacteria | 6570 |
| 295 | Ga0466957_0036824 | 3300044842 | Bacteria | 2943 |
| 296 | Ga0466957_0102411 | 3300044842 | Bacteria | 1806 |
| 297 | Ga0466960_0101204 | 3300044901 | Bacteria | 1484 |
| 298 | Ga0466959_0035767 | 3300045049 | Bacteria | 3670 |
| 299 | Ga0466958_0021853 | 3300045836 | Bacteria | 3742 |
| 300 | Ga0466967_0029296 | 3300045976 | Bacteria | 4606 |
| 301 | Ga0466967_1033346 | 3300045976 | Bacteria | 818 |
| 302 | Ga0495627_000941 | 3300046453 | Bacteria | 20026 |
| 303 | Ga0495627_002847 | 3300046453 | Bacteria | 7993 |
| 304 | Ga0495638_0000014 | 3300046460 | Bacteria | 417060 |
| 305 | Ga0495638_0048227 | 3300046460 | Bacteria | 2667 |
| 306 | Ga0495638_0280838 | 3300046460 | Bacteria | 905 |
| 307 | Ga0495650_0001110 | 3300046471 | Bacteria | 29443 |
| 308 | Ga0495584_0128531 | 3300046491 | Bacteria | 1285 |
| 309 | Ga0495583_0000072 | 3300046506 | Bacteria | 182057 |
| 310 | Ga0495583_0000201 | 3300046506 | Bacteria | 100380 |
| 311 | Ga0495606_0000842 | 3300046507 | Bacteria | 46207 |
| 312 | Ga0495610_0000127 | 3300046512 | Bacteria | 84143 |
| 313 | Ga0495631_0029609 | 3300046518 | Bacteria | 2489 |
| 314 | Ga0495632_0000048 | 3300046519 | Bacteria | 137883 |
| 315 | Ga0495632_0000171 | 3300046519 | Bacteria | 66639 |
| 316 | Ga0495637_0000423 | 3300046520 | Bacteria | 30963 |
| 317 | Ga0495637_0009504 | 3300046520 | Bacteria | 4739 |
| 318 | Ga0495643_0000030 | 3300046522 | Bacteria | 260229 |
| 319 | Ga0495643_0010369 | 3300046522 | Bacteria | 5737 |
| 320 | Ga0495648_0000021 | 3300046524 | Bacteria | 246945 |
| 321 | Ga0495648_0021069 | 3300046524 | Bacteria | 4525 |
| 322 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 323 | Ga0495654_0045118 | 3300046530 | Bacteria | 2176 |
| 324 | Ga0495633_0003052 | 3300046558 | Bacteria | 11397 |
| 325 | Ga0495633_0006472 | 3300046558 | Bacteria | 6932 |
| 326 | Ga0495633_0028739 | 3300046558 | Bacteria | 2707 |
| 327 | Ga0495633_0068294 | 3300046558 | Bacteria | 1659 |
| 328 | Ga0495668_0000015 | 3300046616 | Bacteria | 441932 |
| 329 | Ga0495611_0008401 | 3300046648 | Bacteria | 4373 |
| 330 | Ga0495625_0002061 | 3300046660 | Bacteria | 22521 |
| 331 | Ga0495625_0070549 | 3300046660 | Bacteria | 2453 |
| 332 | Ga0495671_0000028 | 3300046692 | Bacteria | 234938 |
| 333 | Ga0495671_0000043 | 3300046692 | Bacteria | 163036 |
| 334 | Ga0495671_0080243 | 3300046692 | Bacteria | 1599 |
| 335 | Ga0495687_099181 | 3300047443 | Bacteria | 1097 |
| 336 | Ga0495673_0000058 | 3300047469 | Bacteria | 235044 |
| 337 | Ga0495673_0075903 | 3300047469 | Bacteria | 1403 |
| 338 | Ga0495681_0000155 | 3300047470 | Bacteria | 57469 |
| 339 | Ga0495681_0000983 | 3300047470 | Bacteria | 21816 |
| 340 | Ga0495686_0000368 | 3300047472 | Bacteria | 73088 |
| 341 | Ga0495686_0000518 | 3300047472 | Bacteria | 55768 |
| 342 | Ga0495686_0001904 | 3300047472 | Bacteria | 20835 |
| 343 | Ga0495686_0003497 | 3300047472 | Bacteria | 13569 |
| 344 | Ga0495686_0031280 | 3300047472 | Bacteria | 3452 |
| 345 | Ga0495686_0094738 | 3300047472 | Bacteria | 1809 |
| 346 | Ga0496102_0000345 | 3300048905 | Bacteria | 56618 |
| 347 | Ga0496103_0005035 | 3300048906 | Bacteria | 7969 |
| 348 | Ga0496108_0000875 | 3300048911 | Bacteria | 23492 |
| 349 | Ga0496109_0019845 | 3300048912 | Bacteria | 5932 |
| 350 | Ga0496110_0008352 | 3300048913 | Bacteria | 8331 |
| 351 | Ga0496110_0042254 | 3300048913 | Bacteria | 3979 |
| 352 | Ga0496111_0024561 | 3300048914 | Bacteria | 4246 |
| 353 | Ga0496113_0018744 | 3300048916 | Bacteria | 4826 |
| 354 | Ga0496116_0011662 | 3300048919 | Bacteria | 7247 |
| 355 | Ga0496117_0000633 | 3300048920 | Bacteria | 56618 |
| 356 | Ga0496117_0072393 | 3300048920 | Bacteria | 2304 |
| 357 | Ga0496117_0110348 | 3300048920 | Bacteria | 1715 |
| 358 | Ga0496117_0168034 | 3300048920 | Bacteria | 1276 |
| 359 | Ga0496117_0187258 | 3300048920 | Bacteria | 1183 |
| 360 | Ga0496118_0000654 | 3300048921 | Bacteria | 56618 |
| 361 | Ga0496118_0010750 | 3300048921 | Bacteria | 9024 |
| 362 | Ga0496118_0024851 | 3300048921 | Bacteria | 5158 |
| 363 | Ga0496118_0070052 | 3300048921 | Bacteria | 2535 |
| 364 | Ga0496118_0187737 | 3300048921 | Bacteria | 1240 |
| 365 | Ga0496118_0217337 | 3300048921 | Bacteria | 1116 |
| 366 | Ga0496119_0010246 | 3300048922 | Bacteria | 7902 |
| 367 | Ga0496120_0017741 | 3300048923 | Bacteria | 4603 |
| 368 | Ga0496120_0102992 | 3300048923 | Bacteria | 1505 |
| 369 | Ga0496121_0000454 | 3300048924 | Bacteria | 80561 |
| 370 | Ga0496121_0071532 | 3300048924 | Bacteria | 2789 |
| 371 | Ga0496121_0113228 | 3300048924 | Bacteria | 2065 |
| 372 | Ga0496122_0001352 | 3300048925 | Bacteria | 39977 |
| 373 | Ga0496122_0036640 | 3300048925 | Bacteria | 3962 |
| 374 | Ga0496122_0070406 | 3300048925 | Bacteria | 2499 |
| 375 | Ga0496122_0093525 | 3300048925 | Bacteria | 2039 |
| 376 | Ga0496123_0000465 | 3300048926 | Bacteria | 70986 |
| 377 | Ga0496123_0022020 | 3300048926 | Bacteria | 4930 |
| 378 | Ga0496123_0029963 | 3300048926 | Bacteria | 3994 |
| 379 | Ga0496123_0045638 | 3300048926 | Bacteria | 2983 |
| 380 | Ga0496123_0064154 | 3300048926 | Bacteria | 2342 |
| 381 | Ga0496124_0000664 | 3300048927 | Bacteria | 56618 |
| 382 | Ga0496124_0002038 | 3300048927 | Bacteria | 27462 |
| 383 | Ga0496124_0008038 | 3300048927 | Bacteria | 11091 |
| 384 | Ga0496124_0102915 | 3300048927 | Bacteria | 2310 |
| 385 | Ga0496124_0106034 | 3300048927 | Bacteria | 2269 |
| 386 | Ga0496124_0177029 | 3300048927 | Bacteria | 1645 |
| 387 | Ga0496124_0238196 | 3300048927 | Bacteria | 1355 |
| 388 | Ga0496125_0018322 | 3300048928 | Bacteria | 6653 |
| 389 | Ga0496125_0024468 | 3300048928 | Bacteria | 5552 |
| 390 | Ga0496125_0076136 | 3300048928 | Bacteria | 2592 |
| 391 | Ga0496125_0132936 | 3300048928 | Bacteria | 1747 |
| 392 | Ga0496126_0030460 | 3300048929 | Bacteria | 5111 |
| 393 | Ga0496126_0093505 | 3300048929 | Bacteria | 2640 |
| 394 | Ga0496126_0180428 | 3300048929 | Bacteria | 1794 |
| 395 | Ga0495682_0023125 | 3300049460 | Bacteria | 2322 |
| 396 | Ga0501031_0130277 | 3300049568 | Bacteria | 1643 |
| 397 | Ga0501032_0062790 | 3300049569 | Bacteria | 2488 |
| 398 | Ga0501033_0010630 | 3300049570 | Bacteria | 7057 |
| 399 | Ga0501034_0075887 | 3300049571 | Bacteria | 3368 |
| 400 | Ga0501036_0044978 | 3300049572 | Bacteria | 3740 |
| 401 | Ga0501037_0066682 | 3300049573 | Bacteria | 2621 |
| 402 | Ga0501038_0025913 | 3300049574 | Bacteria | 5223 |
| 403 | Ga0501039_0015976 | 3300049575 | Bacteria | 5748 |
| 404 | Ga0501043_0220013 | 3300049579 | Bacteria | 1469 |
| 405 | Ga0501046_0297272 | 3300049580 | Bacteria | 1180 |
| 406 | Ga0501047_0125830 | 3300049581 | Bacteria | 2443 |
| 407 | Ga0501048_0194916 | 3300049582 | Bacteria | 1436 |
| 408 | Ga0501223_000021 | 3300049663 | Bacteria | 66697 |
| 409 | Ga0501225_0000011 | 3300049705 | Bacteria | 74084 |
| 410 | Ga0501225_0019452 | 3300049705 | Bacteria | 1879 |
| 411 | Ga0501035_0012696 | 3300049822 | Bacteria | 7783 |
| 412 | Ga0501044_0044360 | 3300049823 | Bacteria | 4613 |
| 413 | nmdc:mga03n38_1172_c1 | 3300050490 | Bacteria | 7301 |
| 414 | nmdc:mga0k408_76067_c1 | 3300050493 | Bacteria | 1962 |
| 415 | nmdc:mga06z11_59_c2 | 3300050494 | Bacteria | 45567 |
| 416 | nmdc:mga04h51_11080_c1 | 3300050495 | Bacteria | 2494 |
| 417 | nmdc:mga05p37_388028_c1 | 3300050507 | Bacteria | 1634 |
| 418 | Ga0500651_0139240 | 3300053093 | Bacteria | 1464 |
| 419 | Ga0500555_015164 | 3300053103 | Bacteria | 2222 |
| 420 | Ga0500562_015571 | 3300053108 | Bacteria | 1951 |
| 421 | Ga0500592_009184 | 3300053116 | Bacteria | 1570 |
| 422 | Ga0500592_016041 | 3300053116 | Bacteria | 1203 |
| 423 | Ga0500597_006565 | 3300053120 | Bacteria | 3874 |
| 424 | Ga0500608_194398 | 3300053122 | Bacteria | 845 |
| 425 | Ga0500568_0003398 | 3300053139 | Bacteria | 8897 |
| 426 | Ga0500604_0074795 | 3300053151 | Bacteria | 1086 |
| 427 | Ga0500616_0071306 | 3300053153 | Bacteria | 1770 |
| 428 | Ga0500624_000008 | 3300053157 | Bacteria | 181801 |
| 429 | Ga0500624_000012 | 3300053157 | Bacteria | 165895 |
| 430 | Ga0500627_0000028 | 3300053158 | Bacteria | 99118 |
| 431 | Ga0500637_0000101 | 3300053178 | Bacteria | 31079 |
| 432 | Ga0500611_001800 | 3300053727 | Bacteria | 2446 |
| 433 | Ga0466962_0001247 | 3300061719 | Bacteria | 11734 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005617 | Ga0068859_100105153 | Ga0068859_1001051533 | 176 |
| 2 | 3300006931 | Ga0097620_100105147 | Ga0097620_1001051473 | 176 |
| 3 | 3300025936 | Ga0207670_10032957 | Ga0207670_100329571 | 182 |
| 4 | 3300005438 | Ga0070701_10045151 | Ga0070701_100451512 | 186 |
| 5 | 3300005544 | Ga0070686_100117382 | Ga0070686_1001173822 | 186 |
| 6 | 3300005719 | Ga0068861_100050543 | Ga0068861_1000505433 | 186 |
| 7 | 3300013308 | Ga0157375_10063387 | Ga0157375_100633874 | 190 |
| 8 | 3300014326 | Ga0157380_10259160 | Ga0157380_102591603 | 192 |
| 9 | 3300005365 | Ga0070688_100473021 | Ga0070688_1004730211 | 193 |
| 10 | 3300026075 | Ga0207708_10219575 | Ga0207708_102195752 | 193 |
| 11 | 3300026118 | Ga0207675_100028654 | Ga0207675_1000286545 | 200 |
| 12 | 3300053120 | Ga0500597_006565 | Ga0500597_006565_1594_2259 | 200 |
| 13 | 3300053157 | Ga0500624_000008 | Ga0500624_000008_29444_30109 | 200 |
| 14 | 3300053178 | Ga0500637_0000101 | Ga0500637_0000101_16839_17504 | 200 |
| 15 | 3300048925 | Ga0496122_0001352 | Ga0496122_0001352_37738_38412 | 207 |
| 16 | 3300048926 | Ga0496123_0000465 | Ga0496123_0000465_7740_8414 | 207 |
| 17 | 3300048927 | Ga0496124_0008038 | Ga0496124_0008038_8219_8893 | 207 |
| 18 | 3300005289 | Ga0065704_10001961 | Ga0065704_1000196110 | 210 |
| 19 | 3300005295 | Ga0065707_10166599 | Ga0065707_101665992 | 210 |
| 20 | 3300005331 | Ga0070670_100083167 | Ga0070670_1000831674 | 210 |
| 21 | 3300005466 | Ga0070685_10161641 | Ga0070685_101616412 | 210 |
| 22 | 3300005618 | Ga0068864_100385107 | Ga0068864_1003851072 | 210 |
| 23 | 3300009147 | Ga0114129_10374160 | Ga0114129_103741601 | 210 |
| 24 | 3300009553 | Ga0105249_10635172 | Ga0105249_106351721 | 210 |
| 25 | 3300009978 | Ga0105148_100146 | Ga0105148_1001466 | 210 |
| 26 | 3300025925 | Ga0207650_10108279 | Ga0207650_101082791 | 210 |
| 27 | 3300025931 | Ga0207644_10164538 | Ga0207644_101645382 | 210 |
| 28 | 3300048912 | Ga0496109_0019845 | Ga0496109_0019845_4156_4830 | 210 |
| 29 | 3300048913 | Ga0496110_0008352 | Ga0496110_0008352_5577_6251 | 210 |
| 30 | 3300048914 | Ga0496111_0024561 | Ga0496111_0024561_2536_3210 | 210 |
| 31 | 3300048916 | Ga0496113_0018744 | Ga0496113_0018744_1496_2170 | 210 |
| 32 | 3300048926 | Ga0496123_0029963 | Ga0496123_0029963_1931_2605 | 210 |
| 33 | 3300048927 | Ga0496124_0238196 | Ga0496124_0238196_39_713 | 210 |
| 34 | 3300048928 | Ga0496125_0018322 | Ga0496125_0018322_1563_2237 | 210 |
| 35 | 3300049663 | Ga0501223_000021 | Ga0501223_000021_26565_27239 | 210 |
| 36 | 3300049705 | Ga0501225_0000011 | Ga0501225_0000011_26570_27244 | 210 |
| 37 | 3300049705 | Ga0501225_0019452 | Ga0501225_0019452_918_1592 | 210 |
| 38 | 3300050507 | nmdc:mga05p37_388028_c1 | nmdc:mga05p37_388028_c1_29_703 | 210 |
| 39 | 3300048905 | Ga0496102_0000345 | Ga0496102_0000345_52619_53287 | 213 |
| 40 | 3300048906 | Ga0496103_0005035 | Ga0496103_0005035_3970_4638 | 213 |
| 41 | 3300048919 | Ga0496116_0011662 | Ga0496116_0011662_3755_4423 | 213 |
| 42 | 3300048920 | Ga0496117_0000633 | Ga0496117_0000633_3332_4000 | 213 |
| 43 | 3300048921 | Ga0496118_0000654 | Ga0496118_0000654_52619_53287 | 213 |
| 44 | 3300048927 | Ga0496124_0000664 | Ga0496124_0000664_52619_53287 | 213 |
| 45 | 3300005355 | Ga0070671_100030999 | Ga0070671_1000309992 | 216 |
| 46 | 3300005457 | Ga0070662_100146476 | Ga0070662_1001464762 | 216 |
| 47 | 3300013100 | Ga0157373_10043196 | Ga0157373_100431963 | 216 |
| 48 | 3300025931 | Ga0207644_10126625 | Ga0207644_101266253 | 216 |
| 49 | 3300025933 | Ga0207706_10053390 | Ga0207706_100533904 | 216 |
| 50 | 3300042005 | Ga0439448_0005772 | Ga0439448_0005772_755_1408 | 216 |
| 51 | 3300042012 | Ga0439455_0002132 | Ga0439455_0002132_1757_2410 | 216 |
| 52 | 3300003763 | Ga0055529_1005504 | Ga0055529_10055043 | 217 |
| 53 | 3300005339 | Ga0070660_100033044 | Ga0070660_1000330444 | 217 |
| 54 | 3300025254 | Ga0209148_1001194 | Ga0209148_100119416 | 217 |
| 55 | 3300025272 | Ga0209455_1000574 | Ga0209455_100057420 | 217 |
| 56 | 3300025904 | Ga0207647_10082489 | Ga0207647_100824893 | 217 |
| 57 | 3300048920 | Ga0496117_0187258 | Ga0496117_0187258_336_1007 | 217 |
| 58 | 3300048921 | Ga0496118_0010750 | Ga0496118_0010750_8158_8829 | 217 |
| 59 | 3300048922 | Ga0496119_0010246 | Ga0496119_0010246_6658_7329 | 217 |
| 60 | 3300048923 | Ga0496120_0017741 | Ga0496120_0017741_124_795 | 217 |
| 61 | 3300048924 | Ga0496121_0071532 | Ga0496121_0071532_225_896 | 217 |
| 62 | 3300001990 | JGI24737J22298_10048962 | JGI24737J22298_100489623 | 218 |
| 63 | 3300001991 | JGI24743J22301_10049196 | JGI24743J22301_100491961 | 218 |
| 64 | 3300002075 | JGI24738J21930_10004515 | JGI24738J21930_100045156 | 218 |
| 65 | 3300002244 | JGI24742J22300_10034976 | JGI24742J22300_100349761 | 218 |
| 66 | 3300003762 | Ga0055542_1009332 | Ga0055542_10093323 | 218 |
| 67 | 3300005327 | Ga0070658_10000062 | Ga0070658_1000006253 | 218 |
| 68 | 3300005327 | Ga0070658_10037040 | Ga0070658_100370405 | 218 |
| 69 | 3300005339 | Ga0070660_100000377 | Ga0070660_1000003774 | 218 |
| 70 | 3300005339 | Ga0070660_100019488 | Ga0070660_1000194884 | 218 |
| 71 | 3300005354 | Ga0070675_100150155 | Ga0070675_1001501551 | 218 |
| 72 | 3300005355 | Ga0070671_100067672 | Ga0070671_1000676724 | 218 |
| 73 | 3300005366 | Ga0070659_100036509 | Ga0070659_1000365092 | 218 |
| 74 | 3300005539 | Ga0068853_100041194 | Ga0068853_1000411942 | 218 |
| 75 | 3300005547 | Ga0070693_100020120 | Ga0070693_1000201203 | 218 |
| 76 | 3300005563 | Ga0068855_100000095 | Ga0068855_10000009550 | 218 |
| 77 | 3300005564 | Ga0070664_100273443 | Ga0070664_1002734432 | 218 |
| 78 | 3300005577 | Ga0068857_100024736 | Ga0068857_1000247366 | 218 |
| 79 | 3300005578 | Ga0068854_100000265 | Ga0068854_1000002656 | 218 |
| 80 | 3300005578 | Ga0068854_100046578 | Ga0068854_1000465783 | 218 |
| 81 | 3300005614 | Ga0068856_100051628 | Ga0068856_1000516281 | 218 |
| 82 | 3300005614 | Ga0068856_100436920 | Ga0068856_1004369202 | 218 |
| 83 | 3300005616 | Ga0068852_100000586 | Ga0068852_1000005868 | 218 |
| 84 | 3300006237 | Ga0097621_100001128 | Ga0097621_10000112817 | 218 |
| 85 | 3300006358 | Ga0068871_100007431 | Ga0068871_1000074316 | 218 |
| 86 | 3300009545 | Ga0105237_10052574 | Ga0105237_100525743 | 218 |
| 87 | 3300013100 | Ga0157373_10003665 | Ga0157373_100036659 | 218 |
| 88 | 3300013296 | Ga0157374_10010449 | Ga0157374_100104496 | 218 |
| 89 | 3300025254 | Ga0209148_1000074 | Ga0209148_1000074223 | 218 |
| 90 | 3300025901 | Ga0207688_10184696 | Ga0207688_101846962 | 218 |
| 91 | 3300025909 | Ga0207705_10000179 | Ga0207705_1000017919 | 218 |
| 92 | 3300025909 | Ga0207705_10049148 | Ga0207705_100491483 | 218 |
| 93 | 3300025909 | Ga0207705_10440011 | Ga0207705_104400112 | 218 |
| 94 | 3300025914 | Ga0207671_10090510 | Ga0207671_100905104 | 218 |
| 95 | 3300025919 | Ga0207657_10000791 | Ga0207657_100007914 | 218 |
| 96 | 3300025919 | Ga0207657_10013332 | Ga0207657_100133325 | 218 |
| 97 | 3300025931 | Ga0207644_10113154 | Ga0207644_101131543 | 218 |
| 98 | 3300025938 | Ga0207704_10519372 | Ga0207704_105193722 | 218 |
| 99 | 3300025940 | Ga0207691_10031510 | Ga0207691_100315103 | 218 |
| 100 | 3300025949 | Ga0207667_10000016 | Ga0207667_10000016284 | 218 |
| 101 | 3300025981 | Ga0207640_10000139 | Ga0207640_100001391 | 218 |
| 102 | 3300025981 | Ga0207640_10024737 | Ga0207640_100247374 | 218 |
| 103 | 3300026067 | Ga0207678_10035760 | Ga0207678_100357604 | 218 |
| 104 | 3300026078 | Ga0207702_10383110 | Ga0207702_103831102 | 218 |
| 105 | 3300026116 | Ga0207674_10017443 | Ga0207674_100174435 | 218 |
| 106 | 3300026142 | Ga0207698_10000294 | Ga0207698_1000029432 | 218 |
| 107 | 3300037471 | Ga0395905_0095441 | Ga0395905_0095441_1388_2044 | 218 |
| 108 | 3300037471 | Ga0395905_0224836 | Ga0395905_0224836_796_1452 | 218 |
| 109 | 3300038443 | Ga0395901_0998747 | Ga0395901_0998747_55_711 | 218 |
| 110 | 3300044658 | Ga0466972_0010990 | Ga0466972_0010990_1498_2154 | 218 |
| 111 | 3300044706 | Ga0466964_0013581 | Ga0466964_0013581_416_1072 | 218 |
| 112 | iso_pu_bacteria | 2643221560 | 2643820289 | 218 |
| 113 | iso_pu_bacteria | 2643221563 | 2643834607 | 218 |
| 114 | iso_pu_bacteria | 2643221608 | 2644055533 | 218 |
| 115 | iso_pu_bacteria | 2852653556 | 2852656259 | 218 |
| 116 | iso_pu_bacteria | 2852680915 | 2852683320 | 218 |
| 117 | 3300001989 | JGI24739J22299_10003297 | JGI24739J22299_100032974 | 219 |
| 118 | 3300001989 | JGI24739J22299_10012988 | JGI24739J22299_100129886 | 219 |
| 119 | 3300001989 | JGI24739J22299_10078374 | JGI24739J22299_100783742 | 219 |
| 120 | 3300001990 | JGI24737J22298_10001952 | JGI24737J22298_100019522 | 219 |
| 121 | 3300002067 | JGI24735J21928_10004239 | JGI24735J21928_100042391 | 219 |
| 122 | 3300002067 | JGI24735J21928_10011300 | JGI24735J21928_100113001 | 219 |
| 123 | 3300002067 | JGI24735J21928_10012995 | JGI24735J21928_100129952 | 219 |
| 124 | 3300002067 | JGI24735J21928_10018808 | JGI24735J21928_100188083 | 219 |
| 125 | 3300002067 | JGI24735J21928_10021137 | JGI24735J21928_100211372 | 219 |
| 126 | 3300002067 | JGI24735J21928_10029317 | JGI24735J21928_100293174 | 219 |
| 127 | 3300002075 | JGI24738J21930_10001250 | JGI24738J21930_100012506 | 219 |
| 128 | 3300003214 | JGI25165J46597_1000165 | JGI25165J46597_100016567 | 219 |
| 129 | 3300003320 | rootH2_10155443 | rootH2_101554432 | 219 |
| 130 | 3300003322 | rootL2_10076898 | rootL2_100768985 | 219 |
| 131 | 3300003322 | rootL2_10155331 | rootL2_101553312 | 219 |
| 132 | 3300003323 | rootH1_10106799 | rootH1_101067992 | 219 |
| 133 | 3300003323 | rootH1_10262695 | rootH1_102626952 | 219 |
| 134 | 3300005327 | Ga0070658_10004018 | Ga0070658_1000401811 | 219 |
| 135 | 3300005327 | Ga0070658_10004565 | Ga0070658_1000456510 | 219 |
| 136 | 3300005327 | Ga0070658_10217520 | Ga0070658_102175203 | 219 |
| 137 | 3300005328 | Ga0070676_10000416 | Ga0070676_1000041614 | 219 |
| 138 | 3300005334 | Ga0068869_100015254 | Ga0068869_1000152544 | 219 |
| 139 | 3300005339 | Ga0070660_100002444 | Ga0070660_1000024448 | 219 |
| 140 | 3300005364 | Ga0070673_100000002 | Ga0070673_100000002198 | 219 |
| 141 | 3300005366 | Ga0070659_100254525 | Ga0070659_1002545253 | 219 |
| 142 | 3300005366 | Ga0070659_100461694 | Ga0070659_1004616942 | 219 |
| 143 | 3300005457 | Ga0070662_100029502 | Ga0070662_1000295022 | 219 |
| 144 | 3300005457 | Ga0070662_100041043 | Ga0070662_1000410433 | 219 |
| 145 | 3300005457 | Ga0070662_100267170 | Ga0070662_1002671702 | 219 |
| 146 | 3300005459 | Ga0068867_100000012 | Ga0068867_10000001216 | 219 |
| 147 | 3300005539 | Ga0068853_100111734 | Ga0068853_1001117342 | 219 |
| 148 | 3300005563 | Ga0068855_100071449 | Ga0068855_1000714494 | 219 |
| 149 | 3300005614 | Ga0068856_100016744 | Ga0068856_1000167442 | 219 |
| 150 | 3300005616 | Ga0068852_100181971 | Ga0068852_1001819712 | 219 |
| 151 | 3300006195 | Ga0075366_10041128 | Ga0075366_100411283 | 219 |
| 152 | 3300006353 | Ga0075370_10104550 | Ga0075370_101045503 | 219 |
| 153 | 3300006881 | Ga0068865_100000004 | Ga0068865_100000004197 | 219 |
| 154 | 3300009093 | Ga0105240_10179929 | Ga0105240_101799294 | 219 |
| 155 | 3300009098 | Ga0105245_10001027 | Ga0105245_100010275 | 219 |
| 156 | 3300009148 | Ga0105243_10000146 | Ga0105243_1000014615 | 219 |
| 157 | 3300009176 | Ga0105242_10000497 | Ga0105242_1000049730 | 219 |
| 158 | 3300009553 | Ga0105249_10015630 | Ga0105249_100156303 | 219 |
| 159 | 3300010375 | Ga0105239_10141816 | Ga0105239_101418162 | 219 |
| 160 | 3300010375 | Ga0105239_10491278 | Ga0105239_104912782 | 219 |
| 161 | 3300011119 | Ga0105246_10000138 | Ga0105246_1000013817 | 219 |
| 162 | 3300013102 | Ga0157371_10214174 | Ga0157371_102141742 | 219 |
| 163 | 3300013104 | Ga0157370_10000096 | Ga0157370_1000009647 | 219 |
| 164 | 3300013104 | Ga0157370_10091181 | Ga0157370_100911812 | 219 |
| 165 | 3300013105 | Ga0157369_10022918 | Ga0157369_100229184 | 219 |
| 166 | 3300013296 | Ga0157374_10001104 | Ga0157374_1000110411 | 219 |
| 167 | 3300013307 | Ga0157372_10034063 | Ga0157372_100340635 | 219 |
| 168 | 3300013307 | Ga0157372_10060755 | Ga0157372_100607552 | 219 |
| 169 | 3300013307 | Ga0157372_10081266 | Ga0157372_100812662 | 219 |
| 170 | 3300013308 | Ga0157375_10000587 | Ga0157375_1000058711 | 219 |
| 171 | 3300014969 | Ga0157376_10000131 | Ga0157376_1000013142 | 219 |
| 172 | 3300017792 | Ga0163161_10399733 | Ga0163161_103997331 | 219 |
| 173 | 3300025231 | Ga0207427_100557 | Ga0207427_1005573 | 219 |
| 174 | 3300025250 | Ga0209026_1001831 | Ga0209026_10018313 | 219 |
| 175 | 3300025261 | Ga0209233_1000098 | Ga0209233_1000098226 | 219 |
| 176 | 3300025272 | Ga0209455_1039272 | Ga0209455_10392721 | 219 |
| 177 | 3300025903 | Ga0207680_10053509 | Ga0207680_100535093 | 219 |
| 178 | 3300025904 | Ga0207647_10004165 | Ga0207647_100041655 | 219 |
| 179 | 3300025904 | Ga0207647_10012219 | Ga0207647_100122192 | 219 |
| 180 | 3300025904 | Ga0207647_10095278 | Ga0207647_100952782 | 219 |
| 181 | 3300025907 | Ga0207645_10004384 | Ga0207645_100043845 | 219 |
| 182 | 3300025909 | Ga0207705_10000055 | Ga0207705_10000055142 | 219 |
| 183 | 3300025909 | Ga0207705_10007178 | Ga0207705_100071784 | 219 |
| 184 | 3300025909 | Ga0207705_10564913 | Ga0207705_105649131 | 219 |
| 185 | 3300025913 | Ga0207695_10005778 | Ga0207695_100057789 | 219 |
| 186 | 3300025919 | Ga0207657_10004951 | Ga0207657_100049519 | 219 |
| 187 | 3300025933 | Ga0207706_10010431 | Ga0207706_100104318 | 219 |
| 188 | 3300025933 | Ga0207706_10017733 | Ga0207706_100177336 | 219 |
| 189 | 3300025933 | Ga0207706_10036405 | Ga0207706_100364056 | 219 |
| 190 | 3300025933 | Ga0207706_10162190 | Ga0207706_101621903 | 219 |
| 191 | 3300025934 | Ga0207686_10004317 | Ga0207686_100043178 | 219 |
| 192 | 3300025935 | Ga0207709_10000314 | Ga0207709_1000031464 | 219 |
| 193 | 3300025938 | Ga0207704_10000005 | Ga0207704_1000000516 | 219 |
| 194 | 3300025942 | Ga0207689_10001653 | Ga0207689_1000165316 | 219 |
| 195 | 3300025949 | Ga0207667_10079777 | Ga0207667_100797772 | 219 |
| 196 | 3300025960 | Ga0207651_10000007 | Ga0207651_1000000716 | 219 |
| 197 | 3300025961 | Ga0207712_10007902 | Ga0207712_100079028 | 219 |
| 198 | 3300026023 | Ga0207677_10000085 | Ga0207677_100000855 | 219 |
| 199 | 3300026041 | Ga0207639_10047804 | Ga0207639_100478042 | 219 |
| 200 | 3300026078 | Ga0207702_10005342 | Ga0207702_100053426 | 219 |
| 201 | 3300026089 | Ga0207648_10000005 | Ga0207648_1000000517 | 219 |
| 202 | 3300026142 | Ga0207698_10056740 | Ga0207698_100567403 | 219 |
| 203 | 3300037312 | Ga0395899_0001254 | Ga0395899_0001254_20931_21590 | 219 |
| 204 | 3300037418 | Ga0395900_0090023 | Ga0395900_0090023_1684_2343 | 219 |
| 205 | 3300037418 | Ga0395900_0366027 | Ga0395900_0366027_573_1235 | 219 |
| 206 | 3300042005 | Ga0439448_0000954 | Ga0439448_0000954_6343_7005 | 219 |
| 207 | 3300042005 | Ga0439448_0002340 | Ga0439448_0002340_3198_3860 | 219 |
| 208 | 3300042005 | Ga0439448_0003467 | Ga0439448_0003467_3138_3800 | 219 |
| 209 | 3300042012 | Ga0439455_0000109 | Ga0439455_0000109_6554_7216 | 219 |
| 210 | 3300042012 | Ga0439455_0000505 | Ga0439455_0000505_10_672 | 219 |
| 211 | 3300042157 | Ga0439458_0000632 | Ga0439458_0000632_8373_9035 | 219 |
| 212 | 3300042157 | Ga0439458_0001013 | Ga0439458_0001013_2614_3276 | 219 |
| 213 | 3300044683 | Ga0466965_0027007 | Ga0466965_0027007_2101_2760 | 219 |
| 214 | 3300044684 | Ga0466966_0011213 | Ga0466966_0011213_94_753 | 219 |
| 215 | 3300044693 | Ga0466961_0011581 | Ga0466961_0011581_1613_2272 | 219 |
| 216 | 3300044694 | Ga0466963_0049425 | Ga0466963_0049425_1337_1996 | 219 |
| 217 | 3300044719 | Ga0466971_0022878 | Ga0466971_0022878_1989_2648 | 219 |
| 218 | 3300044765 | Ga0466970_0004968 | Ga0466970_0004968_3442_4101 | 219 |
| 219 | 3300044842 | Ga0466957_0036824 | Ga0466957_0036824_1864_2523 | 219 |
| 220 | 3300044842 | Ga0466957_0102411 | Ga0466957_0102411_827_1486 | 219 |
| 221 | 3300044901 | Ga0466960_0101204 | Ga0466960_0101204_810_1469 | 219 |
| 222 | 3300045049 | Ga0466959_0035767 | Ga0466959_0035767_205_864 | 219 |
| 223 | 3300045836 | Ga0466958_0021853 | Ga0466958_0021853_1623_2282 | 219 |
| 224 | 3300045976 | Ga0466967_0029296 | Ga0466967_0029296_212_871 | 219 |
| 225 | 3300045976 | Ga0466967_1033346 | Ga0466967_1033346_100_759 | 219 |
| 226 | 3300047443 | Ga0495687_099181 | Ga0495687_099181_161_823 | 219 |
| 227 | 3300048921 | Ga0496118_0217337 | Ga0496118_0217337_160_819 | 219 |
| 228 | 3300050493 | nmdc:mga0k408_76067_c1 | nmdc:mga0k408_76067_c1_668_1342 | 219 |
| 229 | 3300061719 | Ga0466962_0001247 | Ga0466962_0001247_5193_5852 | 219 |
| 230 | iso_pu_bacteria | 2775507255 | 2778124763 | 219 |
| 231 | 3300046460 | Ga0495638_0048227 | Ga0495638_0048227_1747_2412 | 220 |
| 232 | 3300047472 | Ga0495686_0003497 | Ga0495686_0003497_9404_10069 | 220 |
| 233 | 3300048920 | Ga0496117_0168034 | Ga0496117_0168034_22_687 | 220 |
| 234 | 3300048921 | Ga0496118_0070052 | Ga0496118_0070052_1458_2123 | 220 |
| 235 | 3300048923 | Ga0496120_0102992 | Ga0496120_0102992_735_1400 | 220 |
| 236 | 3300048924 | Ga0496121_0113228 | Ga0496121_0113228_565_1230 | 220 |
| 237 | 3300048925 | Ga0496122_0036640 | Ga0496122_0036640_1858_2523 | 220 |
| 238 | 3300048926 | Ga0496123_0022020 | Ga0496123_0022020_3738_4403 | 220 |
| 239 | 3300053151 | Ga0500604_0074795 | Ga0500604_0074795_38_703 | 220 |
| 240 | iso_pu_bacteria | 2512564014 | 2512643711 | 220 |
| 241 | iso_pu_bacteria | 2808606401 | 2809064346 | 220 |
| 242 | iso_pu_bacteria | 2808606404 | 2809080314 | 220 |
| 243 | iso_pu_bacteria | 2808606405 | 2809084678 | 220 |
| 244 | iso_pu_bacteria | 2880518877 | 2880522085 | 220 |
| 245 | iso_pu_bacteria | 2919709256 | 2919713310 | 220 |
| 246 | 3300001904 | JGI24736J21556_1003382 | JGI24736J21556_10033823 | 221 |
| 247 | 3300005289 | Ga0065704_10113709 | Ga0065704_101137092 | 221 |
| 248 | 3300005331 | Ga0070670_100155196 | Ga0070670_1001551963 | 221 |
| 249 | 3300005347 | Ga0070668_100000019 | Ga0070668_10000001989 | 221 |
| 250 | 3300005353 | Ga0070669_100004351 | Ga0070669_10000435114 | 221 |
| 251 | 3300005367 | Ga0070667_100000094 | Ga0070667_100000094105 | 221 |
| 252 | 3300005841 | Ga0068863_100000057 | Ga0068863_100000057105 | 221 |
| 253 | 3300005843 | Ga0068860_100018154 | Ga0068860_1000181542 | 221 |
| 254 | 3300005937 | Ga0081455_10000187 | Ga0081455_1000018756 | 221 |
| 255 | 3300025292 | Ga0209676_1059602 | Ga0209676_10596022 | 221 |
| 256 | 3300025923 | Ga0207681_10002127 | Ga0207681_100021274 | 221 |
| 257 | 3300025923 | Ga0207681_10393024 | Ga0207681_103930242 | 221 |
| 258 | 3300025925 | Ga0207650_10129821 | Ga0207650_101298213 | 221 |
| 259 | 3300025972 | Ga0207668_10000296 | Ga0207668_1000029624 | 221 |
| 260 | 3300025986 | Ga0207658_10000072 | Ga0207658_1000007215 | 221 |
| 261 | 3300026088 | Ga0207641_10000096 | Ga0207641_10000096102 | 221 |
| 262 | 3300028381 | Ga0268264_10012832 | Ga0268264_100128322 | 221 |
| 263 | 3300031911 | Ga0307412_10020708 | Ga0307412_100207081 | 221 |
| 264 | 3300046460 | Ga0495638_0000014 | Ga0495638_0000014_345997_346665 | 221 |
| 265 | 3300046460 | Ga0495638_0280838 | Ga0495638_0280838_155_823 | 221 |
| 266 | 3300046471 | Ga0495650_0001110 | Ga0495650_0001110_19181_19849 | 221 |
| 267 | 3300046506 | Ga0495583_0000072 | Ga0495583_0000072_111196_111861 | 221 |
| 268 | 3300046506 | Ga0495583_0000201 | Ga0495583_0000201_60077_60745 | 221 |
| 269 | 3300046507 | Ga0495606_0000842 | Ga0495606_0000842_13035_13703 | 221 |
| 270 | 3300046519 | Ga0495632_0000171 | Ga0495632_0000171_64664_65332 | 221 |
| 271 | 3300046524 | Ga0495648_0000021 | Ga0495648_0000021_70344_71012 | 221 |
| 272 | 3300046558 | Ga0495633_0028739 | Ga0495633_0028739_1073_1741 | 221 |
| 273 | 3300046648 | Ga0495611_0008401 | Ga0495611_0008401_1828_2496 | 221 |
| 274 | 3300046692 | Ga0495671_0000028 | Ga0495671_0000028_164024_164689 | 221 |
| 275 | 3300046692 | Ga0495671_0080243 | Ga0495671_0080243_773_1441 | 221 |
| 276 | 3300047469 | Ga0495673_0000058 | Ga0495673_0000058_70302_70967 | 221 |
| 277 | 3300047469 | Ga0495673_0075903 | Ga0495673_0075903_101_769 | 221 |
| 278 | 3300047472 | Ga0495686_0000368 | Ga0495686_0000368_44750_45418 | 221 |
| 279 | 3300047472 | Ga0495686_0001904 | Ga0495686_0001904_7380_8120 | 221 |
| 280 | 3300047472 | Ga0495686_0094738 | Ga0495686_0094738_316_984 | 221 |
| 281 | 3300048920 | Ga0496117_0110348 | Ga0496117_0110348_787_1455 | 221 |
| 282 | 3300048921 | Ga0496118_0024851 | Ga0496118_0024851_3481_4149 | 221 |
| 283 | 3300048926 | Ga0496123_0064154 | Ga0496123_0064154_900_1568 | 221 |
| 284 | 3300048927 | Ga0496124_0002038 | Ga0496124_0002038_23405_24070 | 221 |
| 285 | 3300049460 | Ga0495682_0023125 | Ga0495682_0023125_200_868 | 221 |
| 286 | 3300053103 | Ga0500555_015164 | Ga0500555_015164_1404_2072 | 221 |
| 287 | 3300053116 | Ga0500592_016041 | Ga0500592_016041_174_842 | 221 |
| 288 | 3300053122 | Ga0500608_194398 | Ga0500608_194398_129_797 | 221 |
| 289 | 3300053153 | Ga0500616_0071306 | Ga0500616_0071306_528_1196 | 221 |
| 290 | 3300053727 | Ga0500611_001800 | Ga0500611_001800_1486_2154 | 221 |
| 291 | 3300003781 | Ga0055536_1009163 | Ga0055536_10091635 | 222 |
| 292 | 3300003781 | Ga0055536_1012735 | Ga0055536_10127353 | 222 |
| 293 | 3300003781 | Ga0055536_1019914 | Ga0055536_10199143 | 222 |
| 294 | 3300003784 | Ga0055534_1005827 | Ga0055534_10058272 | 222 |
| 295 | 3300003791 | Ga0055530_10000197 | Ga0055530_100001978 | 222 |
| 296 | 3300003794 | Ga0055531_10008524 | Ga0055531_100085243 | 222 |
| 297 | 3300005327 | Ga0070658_10067181 | Ga0070658_100671813 | 222 |
| 298 | 3300013297 | Ga0157378_10812021 | Ga0157378_108120211 | 222 |
| 299 | 3300025291 | Ga0209675_1000162 | Ga0209675_100016251 | 222 |
| 300 | 3300025292 | Ga0209676_1000113 | Ga0209676_1000113118 | 222 |
| 301 | 3300025292 | Ga0209676_1000146 | Ga0209676_1000146122 | 222 |
| 302 | 3300025292 | Ga0209676_1002307 | Ga0209676_100230711 | 222 |
| 303 | 3300025294 | Ga0209025_1035622 | Ga0209025_10356223 | 222 |
| 304 | 3300025298 | Ga0209050_1000126 | Ga0209050_1000126118 | 222 |
| 305 | 3300025298 | Ga0209050_1013537 | Ga0209050_10135374 | 222 |
| 306 | 3300025298 | Ga0209050_1021825 | Ga0209050_10218252 | 222 |
| 307 | 3300025304 | Ga0209257_1000256 | Ga0209257_1000256112 | 222 |
| 308 | 3300025304 | Ga0209257_1002572 | Ga0209257_100257216 | 222 |
| 309 | 3300025304 | Ga0209257_1002727 | Ga0209257_100272715 | 222 |
| 310 | 3300031731 | Ga0307405_10146823 | Ga0307405_101468233 | 222 |
| 311 | 3300031901 | Ga0307406_10085972 | Ga0307406_100859721 | 222 |
| 312 | 3300031901 | Ga0307406_10393431 | Ga0307406_103934312 | 222 |
| 313 | 3300031911 | Ga0307412_10001306 | Ga0307412_100013062 | 222 |
| 314 | 3300031911 | Ga0307412_10001453 | Ga0307412_1000145311 | 222 |
| 315 | 3300031911 | Ga0307412_10091719 | Ga0307412_100917193 | 222 |
| 316 | 3300032004 | Ga0307414_10000607 | Ga0307414_1000060723 | 222 |
| 317 | 3300032004 | Ga0307414_10012355 | Ga0307414_100123554 | 222 |
| 318 | 3300032004 | Ga0307414_10102825 | Ga0307414_101028253 | 222 |
| 319 | 3300032004 | Ga0307414_10216193 | Ga0307414_102161932 | 222 |
| 320 | 3300046522 | Ga0495643_0010369 | Ga0495643_0010369_1718_2389 | 222 |
| 321 | 3300046616 | Ga0495668_0000015 | Ga0495668_0000015_289908_290579 | 222 |
| 322 | 3300046660 | Ga0495625_0002061 | Ga0495625_0002061_9987_10658 | 222 |
| 323 | 3300048929 | Ga0496126_0180428 | Ga0496126_0180428_435_1106 | 222 |
| 324 | 3300049568 | Ga0501031_0130277 | Ga0501031_0130277_440_1111 | 222 |
| 325 | 3300049569 | Ga0501032_0062790 | Ga0501032_0062790_1026_1697 | 222 |
| 326 | 3300049570 | Ga0501033_0010630 | Ga0501033_0010630_6134_6805 | 222 |
| 327 | 3300049571 | Ga0501034_0075887 | Ga0501034_0075887_1394_2065 | 222 |
| 328 | 3300049572 | Ga0501036_0044978 | Ga0501036_0044978_790_1461 | 222 |
| 329 | 3300049573 | Ga0501037_0066682 | Ga0501037_0066682_445_1116 | 222 |
| 330 | 3300049574 | Ga0501038_0025913 | Ga0501038_0025913_1525_2196 | 222 |
| 331 | 3300049575 | Ga0501039_0015976 | Ga0501039_0015976_960_1631 | 222 |
| 332 | 3300049579 | Ga0501043_0220013 | Ga0501043_0220013_221_892 | 222 |
| 333 | 3300049580 | Ga0501046_0297272 | Ga0501046_0297272_469_1140 | 222 |
| 334 | 3300049581 | Ga0501047_0125830 | Ga0501047_0125830_929_1600 | 222 |
| 335 | 3300049582 | Ga0501048_0194916 | Ga0501048_0194916_299_970 | 222 |
| 336 | 3300049822 | Ga0501035_0012696 | Ga0501035_0012696_6035_6706 | 222 |
| 337 | 3300049823 | Ga0501044_0044360 | Ga0501044_0044360_1243_1914 | 222 |
| 338 | 3300053093 | Ga0500651_0139240 | Ga0500651_0139240_599_1270 | 222 |
| 339 | 3300053139 | Ga0500568_0003398 | Ga0500568_0003398_2719_3390 | 222 |
| 340 | 3300053157 | Ga0500624_000012 | Ga0500624_000012_116207_116878 | 222 |
| 341 | 3300001904 | JGI24736J21556_1001619 | JGI24736J21556_10016194 | 223 |
| 342 | 3300001915 | JGI24741J21665_1000001 | JGI24741J21665_10000015 | 223 |
| 343 | 3300001979 | JGI24740J21852_10001522 | JGI24740J21852_100015222 | 223 |
| 344 | 3300001989 | JGI24739J22299_10000851 | JGI24739J22299_1000085110 | 223 |
| 345 | 3300001990 | JGI24737J22298_10000719 | JGI24737J22298_1000071911 | 223 |
| 346 | 3300002067 | JGI24735J21928_10005935 | JGI24735J21928_100059354 | 223 |
| 347 | 3300002075 | JGI24738J21930_10005832 | JGI24738J21930_100058323 | 223 |
| 348 | 3300005289 | Ga0065704_10003935 | Ga0065704_100039357 | 223 |
| 349 | 3300005289 | Ga0065704_10164837 | Ga0065704_101648371 | 223 |
| 350 | 3300005329 | Ga0070683_100458475 | Ga0070683_1004584752 | 223 |
| 351 | 3300005339 | Ga0070660_100014500 | Ga0070660_1000145002 | 223 |
| 352 | 3300005347 | Ga0070668_100053308 | Ga0070668_1000533084 | 223 |
| 353 | 3300005353 | Ga0070669_100160160 | Ga0070669_1001601601 | 223 |
| 354 | 3300005366 | Ga0070659_100006403 | Ga0070659_1000064032 | 223 |
| 355 | 3300005471 | Ga0070698_100748439 | Ga0070698_1007484391 | 223 |
| 356 | 3300005539 | Ga0068853_100279663 | Ga0068853_1002796632 | 223 |
| 357 | 3300005548 | Ga0070665_100028448 | Ga0070665_1000284482 | 223 |
| 358 | 3300005563 | Ga0068855_100114092 | Ga0068855_1001140924 | 223 |
| 359 | 3300005564 | Ga0070664_100028935 | Ga0070664_1000289355 | 223 |
| 360 | 3300005614 | Ga0068856_100072555 | Ga0068856_1000725554 | 223 |
| 361 | 3300006048 | Ga0075363_100005054 | Ga0075363_1000050543 | 223 |
| 362 | 3300006178 | Ga0075367_10002832 | Ga0075367_100028324 | 223 |
| 363 | 3300006353 | Ga0075370_10017804 | Ga0075370_100178042 | 223 |
| 364 | 3300009011 | Ga0105251_10012849 | Ga0105251_100128494 | 223 |
| 365 | 3300009174 | Ga0105241_10006190 | Ga0105241_100061904 | 223 |
| 366 | 3300009545 | Ga0105237_10015961 | Ga0105237_100159616 | 223 |
| 367 | 3300009553 | Ga0105249_10436507 | Ga0105249_104365072 | 223 |
| 368 | 3300010375 | Ga0105239_10508456 | Ga0105239_105084561 | 223 |
| 369 | 3300013100 | Ga0157373_10045347 | Ga0157373_100453474 | 223 |
| 370 | 3300013104 | Ga0157370_10096868 | Ga0157370_100968682 | 223 |
| 371 | 3300013105 | Ga0157369_10187251 | Ga0157369_101872511 | 223 |
| 372 | 3300013105 | Ga0157369_10282891 | Ga0157369_102828912 | 223 |
| 373 | 3300013307 | Ga0157372_10725164 | Ga0157372_107251642 | 223 |
| 374 | 3300013307 | Ga0157372_10737957 | Ga0157372_107379572 | 223 |
| 375 | 3300017792 | Ga0163161_10002898 | Ga0163161_100028982 | 223 |
| 376 | 3300017792 | Ga0163161_10030610 | Ga0163161_100306103 | 223 |
| 377 | 3300017792 | Ga0163161_10212334 | Ga0163161_102123342 | 223 |
| 378 | 3300025229 | Ga0209147_100815 | Ga0209147_10081512 | 223 |
| 379 | 3300025904 | Ga0207647_10020602 | Ga0207647_100206024 | 223 |
| 380 | 3300025914 | Ga0207671_10014180 | Ga0207671_100141805 | 223 |
| 381 | 3300025919 | Ga0207657_10010795 | Ga0207657_100107952 | 223 |
| 382 | 3300025923 | Ga0207681_10331354 | Ga0207681_103313542 | 223 |
| 383 | 3300025924 | Ga0207694_10061897 | Ga0207694_100618972 | 223 |
| 384 | 3300025933 | Ga0207706_10037963 | Ga0207706_100379632 | 223 |
| 385 | 3300025949 | Ga0207667_10251436 | Ga0207667_102514361 | 223 |
| 386 | 3300025961 | Ga0207712_10095408 | Ga0207712_100954081 | 223 |
| 387 | 3300025972 | Ga0207668_10036012 | Ga0207668_100360122 | 223 |
| 388 | 3300026041 | Ga0207639_10057513 | Ga0207639_100575135 | 223 |
| 389 | 3300026067 | Ga0207678_10036634 | Ga0207678_100366344 | 223 |
| 390 | 3300026078 | Ga0207702_10018661 | Ga0207702_100186615 | 223 |
| 391 | 3300026116 | Ga0207674_10006242 | Ga0207674_1000624214 | 223 |
| 392 | 3300026142 | Ga0207698_10010421 | Ga0207698_100104215 | 223 |
| 393 | 3300027866 | Ga0209813_10000020 | Ga0209813_100000202 | 223 |
| 394 | 3300028379 | Ga0268266_10135170 | Ga0268266_101351703 | 223 |
| 395 | 3300031548 | Ga0307408_100027647 | Ga0307408_1000276472 | 223 |
| 396 | 3300031731 | Ga0307405_10048066 | Ga0307405_100480663 | 223 |
| 397 | 3300031824 | Ga0307413_10086671 | Ga0307413_100866712 | 223 |
| 398 | 3300031901 | Ga0307406_10105751 | Ga0307406_101057512 | 223 |
| 399 | 3300031911 | Ga0307412_10098664 | Ga0307412_100986642 | 223 |
| 400 | 3300032004 | Ga0307414_10079396 | Ga0307414_100793963 | 223 |
| 401 | 3300032005 | Ga0307411_10043443 | Ga0307411_100434434 | 223 |
| 402 | 3300032126 | Ga0307415_100677333 | Ga0307415_1006773331 | 223 |
| 403 | 3300046453 | Ga0495627_000941 | Ga0495627_000941_2090_2764 | 223 |
| 404 | 3300046453 | Ga0495627_002847 | Ga0495627_002847_4790_5479 | 223 |
| 405 | 3300046491 | Ga0495584_0128531 | Ga0495584_0128531_466_1137 | 223 |
| 406 | 3300046512 | Ga0495610_0000127 | Ga0495610_0000127_7851_8540 | 223 |
| 407 | 3300046518 | Ga0495631_0029609 | Ga0495631_0029609_364_1038 | 223 |
| 408 | 3300046519 | Ga0495632_0000048 | Ga0495632_0000048_2612_3286 | 223 |
| 409 | 3300046520 | Ga0495637_0000423 | Ga0495637_0000423_17951_18622 | 223 |
| 410 | 3300046520 | Ga0495637_0009504 | Ga0495637_0009504_2007_2696 | 223 |
| 411 | 3300046522 | Ga0495643_0000030 | Ga0495643_0000030_12340_13011 | 223 |
| 412 | 3300046524 | Ga0495648_0021069 | Ga0495648_0021069_2248_2922 | 223 |
| 413 | 3300046525 | Ga0495663_0000003 | Ga0495663_0000003_185064_185738 | 223 |
| 414 | 3300046530 | Ga0495654_0045118 | Ga0495654_0045118_796_1470 | 223 |
| 415 | 3300046558 | Ga0495633_0003052 | Ga0495633_0003052_2513_3187 | 223 |
| 416 | 3300046558 | Ga0495633_0006472 | Ga0495633_0006472_3180_3854 | 223 |
| 417 | 3300046558 | Ga0495633_0068294 | Ga0495633_0068294_366_1055 | 223 |
| 418 | 3300046660 | Ga0495625_0070549 | Ga0495625_0070549_850_1524 | 223 |
| 419 | 3300046692 | Ga0495671_0000043 | Ga0495671_0000043_12340_13011 | 223 |
| 420 | 3300047470 | Ga0495681_0000155 | Ga0495681_0000155_47105_47794 | 223 |
| 421 | 3300047470 | Ga0495681_0000983 | Ga0495681_0000983_18393_19064 | 223 |
| 422 | 3300047472 | Ga0495686_0000518 | Ga0495686_0000518_24750_25439 | 223 |
| 423 | 3300047472 | Ga0495686_0031280 | Ga0495686_0031280_1615_2289 | 223 |
| 424 | 3300048911 | Ga0496108_0000875 | Ga0496108_0000875_2742_3416 | 223 |
| 425 | 3300048913 | Ga0496110_0042254 | Ga0496110_0042254_2633_3307 | 223 |
| 426 | 3300048920 | Ga0496117_0072393 | Ga0496117_0072393_1329_2090 | 223 |
| 427 | 3300048921 | Ga0496118_0187737 | Ga0496118_0187737_180_941 | 223 |
| 428 | 3300048924 | Ga0496121_0000454 | Ga0496121_0000454_11598_12272 | 223 |
| 429 | 3300048925 | Ga0496122_0070406 | Ga0496122_0070406_1588_2262 | 223 |
| 430 | 3300048925 | Ga0496122_0093525 | Ga0496122_0093525_1261_1935 | 223 |
| 431 | 3300048926 | Ga0496123_0045638 | Ga0496123_0045638_2076_2750 | 223 |
| 432 | 3300048927 | Ga0496124_0102915 | Ga0496124_0102915_769_1443 | 223 |
| 433 | 3300048927 | Ga0496124_0106034 | Ga0496124_0106034_15_689 | 223 |
| 434 | 3300048927 | Ga0496124_0177029 | Ga0496124_0177029_201_962 | 223 |
| 435 | 3300048928 | Ga0496125_0024468 | Ga0496125_0024468_3291_3965 | 223 |
| 436 | 3300048928 | Ga0496125_0076136 | Ga0496125_0076136_312_986 | 223 |
| 437 | 3300048928 | Ga0496125_0132936 | Ga0496125_0132936_214_888 | 223 |
| 438 | 3300048929 | Ga0496126_0030460 | Ga0496126_0030460_4240_4914 | 223 |
| 439 | 3300048929 | Ga0496126_0093505 | Ga0496126_0093505_342_1016 | 223 |
| 440 | 3300050490 | nmdc:mga03n38_1172_c1 | nmdc:mga03n38_1172_c1_5677_6357 | 223 |
| 441 | 3300050494 | nmdc:mga06z11_59_c2 | nmdc:mga06z11_59_c2_12200_12880 | 223 |
| 442 | 3300050495 | nmdc:mga04h51_11080_c1 | nmdc:mga04h51_11080_c1_1791_2471 | 223 |
| 443 | 3300053108 | Ga0500562_015571 | Ga0500562_015571_530_1204 | 223 |
| 444 | 3300053116 | Ga0500592_009184 | Ga0500592_009184_157_831 | 223 |
| 445 | 3300053158 | Ga0500627_0000028 | Ga0500627_0000028_28520_29194 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mp4-assembly1.cif.gz_B | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.883 | 2 | 206 |
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8719 | 2 | 206 |
| 3bby-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution | 0.8636 | 2 | 209 |
| 4mp4-assembly1.cif.gz_A | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8473 | 2 | 207 |
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.847 | 2 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bbyA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8702 | 2 | 82 | 3.40.30.10 |
| af_P77544_4_214_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8453 | 2 | 206 | 3.40.50.720 |
| 4mp4C02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.8394 | 86 | 193 | 1.20.1050.10 |
| af_Q4CZ29_2_81_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.831 | 2 | 82 | 3.40.30.10 |
| 1n2aB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8276 | 1 | 81 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4ZCE3-F1-model_v4 | Glutathione S-transferase | 0.9971 | 2 | 196 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A2W5C6Y9-F1-model_v4 | Glutathione S-transferase | 0.9941 | 2 | 221 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A431J993-F1-model_v4 | deleted | 0.9864 | 1 | 160 |
|
| AF-A5PCQ9-F1-model_v4 | Glutathione S-transferase, N-terminal | 0.9857 | 2 | 218 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A0B9A480-F1-model_v4 | Glutathione S-transferase-like protein | 0.9839 | 2 | 221 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar