F445599

General Info

Members Datasets Scaffolds Average Seq Length
445 253 433 221

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0072393|Ga0496117_0072393_1329_2090
Length 253
Sequence MSAKITALHRRPSRPTRMDRRRDLAIKEGMMKLFIGNKAYSSWSLRGWLACKLSGLPFEEVVVPLYDQAWEKRREGDEFAPSSGKVPILWDGDDIVVWDSLAIVEYLNEKSDGDRIWPSDPAARAMARSMAAEMHSSFAALRREHSMNIRQIYAPAPPSTEVEQDIARIMELWAQARARHGGDGEFLFGAFSAADVMFAPVVTRFITYQLPVARFAQAYMHAIIAHPWMQEWIGGAQAEDWIIDKFELPPQTV

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
6 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
9 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
10 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
244 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
245 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.91
Nodule 0
Rhizoplane 1.8
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001619 3300001904 Bacteria 4084
2 JGI24736J21556_1003382 3300001904 Bacteria 2771
3 JGI24741J21665_1000001 3300001915 Bacteria 68427
4 JGI24740J21852_10001522 3300001979 Bacteria 10655
5 JGI24739J22299_10000851 3300001989 Bacteria 11234
6 JGI24739J22299_10003297 3300001989 Bacteria 6151
7 JGI24739J22299_10012988 3300001989 Bacteria 3048
8 JGI24739J22299_10078374 3300001989 Bacteria 1018
9 JGI24737J22298_10000719 3300001990 Bacteria 11649
10 JGI24737J22298_10001952 3300001990 Bacteria 7378
11 JGI24737J22298_10048962 3300001990 Bacteria 1286
12 JGI24743J22301_10049196 3300001991 Bacteria 857
13 JGI24735J21928_10004239 3300002067 Bacteria 4837
14 JGI24735J21928_10005935 3300002067 Bacteria 4034
15 JGI24735J21928_10011300 3300002067 Bacteria 2834
16 JGI24735J21928_10012995 3300002067 Bacteria 2624
17 JGI24735J21928_10018808 3300002067 Bacteria 2128
18 JGI24735J21928_10021137 3300002067 Bacteria 1989
19 JGI24735J21928_10029317 3300002067 Bacteria 1639
20 JGI24738J21930_10001250 3300002075 Bacteria 7142
21 JGI24738J21930_10004515 3300002075 Bacteria 3403
22 JGI24738J21930_10005832 3300002075 Bacteria 2926
23 JGI24742J22300_10034976 3300002244 Bacteria 885
24 JGI25165J46597_1000165 3300003214 Bacteria 104009
25 rootH2_10155443 3300003320 Bacteria 2341
26 rootL2_10076898 3300003322 Bacteria 3607
27 rootL2_10155331 3300003322 Bacteria 1139
28 rootH1_10106799 3300003323 Bacteria 2604
29 rootH1_10262695 3300003323 Bacteria 2354
30 Ga0055542_1009332 3300003762 Bacteria 1858
31 Ga0055529_1005504 3300003763 Bacteria 1824
32 Ga0055536_1009163 3300003781 Bacteria 4138
33 Ga0055536_1012735 3300003781 Bacteria 3093
34 Ga0055536_1019914 3300003781 Bacteria 2092
35 Ga0055534_1005827 3300003784 Bacteria 3223
36 Ga0055530_10000197 3300003791 Bacteria 54281
37 Ga0055531_10008524 3300003794 Bacteria 5383
38 Ga0065704_10001961 3300005289 Bacteria 10690
39 Ga0065704_10003935 3300005289 Bacteria 8288
40 Ga0065704_10113709 3300005289 Bacteria 1902
41 Ga0065704_10164837 3300005289 Bacteria 1321
42 Ga0065707_10166599 3300005295 Bacteria 1517
43 Ga0070658_10000062 3300005327 Bacteria 107844
44 Ga0070658_10004018 3300005327 Bacteria 12053
45 Ga0070658_10004565 3300005327 Bacteria 11251
46 Ga0070658_10037040 3300005327 Bacteria 3931
47 Ga0070658_10067181 3300005327 Bacteria 2929
48 Ga0070658_10217520 3300005327 Bacteria 1615
49 Ga0070676_10000416 3300005328 Bacteria 20088
50 Ga0070683_100458475 3300005329 Bacteria 1217
51 Ga0070670_100083167 3300005331 Bacteria 2751
52 Ga0070670_100155196 3300005331 Bacteria 1982
53 Ga0068869_100015254 3300005334 Bacteria 5150
54 Ga0070660_100000377 3300005339 Bacteria 29678
55 Ga0070660_100002444 3300005339 Bacteria 12761
56 Ga0070660_100014500 3300005339 Bacteria 5679
57 Ga0070660_100019488 3300005339 Bacteria 4972
58 Ga0070660_100033044 3300005339 Bacteria 3897
59 Ga0070668_100000019 3300005347 Bacteria 98356
60 Ga0070668_100053308 3300005347 Bacteria 3119
61 Ga0070669_100004351 3300005353 Bacteria 10225
62 Ga0070669_100160160 3300005353 Bacteria 1748
63 Ga0070675_100150155 3300005354 Bacteria 1997
64 Ga0070671_100030999 3300005355 Bacteria 4415
65 Ga0070671_100067672 3300005355 Bacteria 2978
66 Ga0070673_100000002 3300005364 Bacteria 225084
67 Ga0070688_100473021 3300005365 Bacteria 941
68 Ga0070659_100006403 3300005366 Bacteria 8501
69 Ga0070659_100036509 3300005366 Bacteria 3831
70 Ga0070659_100254525 3300005366 Bacteria 1456
71 Ga0070659_100461694 3300005366 Bacteria 1078
72 Ga0070667_100000094 3300005367 Bacteria 111140
73 Ga0070701_10045151 3300005438 Bacteria 2260
74 Ga0070662_100029502 3300005457 Bacteria 3828
75 Ga0070662_100041043 3300005457 Bacteria 3299
76 Ga0070662_100146476 3300005457 Bacteria 1835
77 Ga0070662_100267170 3300005457 Bacteria 1380
78 Ga0068867_100000012 3300005459 Bacteria 118831
79 Ga0070685_10161641 3300005466 Bacteria 1428
80 Ga0070698_100748439 3300005471 Bacteria 920
81 Ga0068853_100041194 3300005539 Bacteria 3943
82 Ga0068853_100111734 3300005539 Bacteria 2428
83 Ga0068853_100279663 3300005539 Bacteria 1538
84 Ga0070686_100117382 3300005544 Bacteria 1822
85 Ga0070693_100020120 3300005547 Bacteria 3514
86 Ga0070665_100028448 3300005548 Bacteria 5628
87 Ga0068855_100000095 3300005563 Bacteria 106561
88 Ga0068855_100071449 3300005563 Bacteria 4036
89 Ga0068855_100114092 3300005563 Bacteria 3098
90 Ga0070664_100028935 3300005564 Bacteria 4615
91 Ga0070664_100273443 3300005564 Bacteria 1522
92 Ga0068857_100024736 3300005577 Bacteria 5289
93 Ga0068854_100000265 3300005578 Bacteria 35689
94 Ga0068854_100046578 3300005578 Bacteria 3088
95 Ga0068856_100016744 3300005614 Bacteria 7101
96 Ga0068856_100051628 3300005614 Bacteria 4054
97 Ga0068856_100072555 3300005614 Bacteria 3408
98 Ga0068856_100436920 3300005614 Bacteria 1329
99 Ga0068852_100000586 3300005616 Bacteria 23996
100 Ga0068852_100181971 3300005616 Bacteria 1977
101 Ga0068859_100105153 3300005617 Bacteria 2882
102 Ga0068864_100385107 3300005618 Bacteria 1330
103 Ga0068861_100050543 3300005719 Bacteria 3152
104 Ga0068863_100000057 3300005841 Bacteria 123606
105 Ga0068860_100018154 3300005843 Bacteria 6847
106 Ga0081455_10000187 3300005937 Bacteria 78623
107 Ga0075363_100005054 3300006048 Bacteria 5835
108 Ga0075367_10002832 3300006178 Bacteria 8060
109 Ga0075366_10041128 3300006195 Bacteria 2736
110 Ga0097621_100001128 3300006237 Bacteria 18562
111 Ga0075370_10017804 3300006353 Bacteria 3844
112 Ga0075370_10104550 3300006353 Bacteria 1641
113 Ga0068871_100007431 3300006358 Bacteria 7829
114 Ga0068865_100000004 3300006881 Bacteria 226236
115 Ga0097620_100105147 3300006931 Bacteria 2882
116 Ga0105251_10012849 3300009011 Bacteria 4714
117 Ga0105240_10179929 3300009093 Bacteria 2496
118 Ga0105245_10001027 3300009098 Bacteria 25355
119 Ga0114129_10374160 3300009147 Bacteria 1882
120 Ga0105243_10000146 3300009148 Bacteria 81008
121 Ga0105241_10006190 3300009174 Bacteria 8828
122 Ga0105242_10000497 3300009176 Bacteria 31053
123 Ga0105237_10015961 3300009545 Bacteria 7808
124 Ga0105237_10052574 3300009545 Bacteria 4088
125 Ga0105249_10015630 3300009553 Bacteria 6720
126 Ga0105249_10436507 3300009553 Bacteria 1346
127 Ga0105249_10635172 3300009553 Bacteria 1124
128 Ga0105148_100146 3300009978 Bacteria 10542
129 Ga0105239_10141816 3300010375 Bacteria 2678
130 Ga0105239_10491278 3300010375 Bacteria 1395
131 Ga0105239_10508456 3300010375 Bacteria 1370
132 Ga0105246_10000138 3300011119 Bacteria 33809
133 Ga0157373_10003665 3300013100 Bacteria 11612
134 Ga0157373_10043196 3300013100 Bacteria 3220
135 Ga0157373_10045347 3300013100 Bacteria 3138
136 Ga0157371_10214174 3300013102 Bacteria 1383
137 Ga0157370_10000096 3300013104 Bacteria 99163
138 Ga0157370_10091181 3300013104 Bacteria 2861
139 Ga0157370_10096868 3300013104 Bacteria 2767
140 Ga0157369_10022918 3300013105 Bacteria 6962
141 Ga0157369_10187251 3300013105 Bacteria 2176
142 Ga0157369_10282891 3300013105 Bacteria 1727
143 Ga0157374_10001104 3300013296 Bacteria 23221
144 Ga0157374_10010449 3300013296 Bacteria 7984
145 Ga0157378_10812021 3300013297 Bacteria 962
146 Ga0157372_10034063 3300013307 Bacteria 5596
147 Ga0157372_10060755 3300013307 Bacteria 4229
148 Ga0157372_10081266 3300013307 Bacteria 3668
149 Ga0157372_10725164 3300013307 Bacteria 1156
150 Ga0157372_10737957 3300013307 Bacteria 1145
151 Ga0157375_10000587 3300013308 Bacteria 32327
152 Ga0157375_10063387 3300013308 Bacteria 3677
153 Ga0157380_10259160 3300014326 Bacteria 1578
154 Ga0157376_10000131 3300014969 Bacteria 51790
155 Ga0163161_10002898 3300017792 Bacteria 12137
156 Ga0163161_10030610 3300017792 Bacteria 3832
157 Ga0163161_10212334 3300017792 Bacteria 1495
158 Ga0163161_10399733 3300017792 Bacteria 1101
159 Ga0209147_100815 3300025229 Bacteria 14909
160 Ga0207427_100557 3300025231 Bacteria 18931
161 Ga0209026_1001831 3300025250 Bacteria 8716
162 Ga0209148_1000074 3300025254 Bacteria 314356
163 Ga0209148_1001194 3300025254 Bacteria 14881
164 Ga0209233_1000098 3300025261 Bacteria 294111
165 Ga0209455_1000574 3300025272 Bacteria 24064
166 Ga0209455_1039272 3300025272 Bacteria 732
167 Ga0209675_1000162 3300025291 Bacteria 83810
168 Ga0209676_1000113 3300025292 Bacteria 207931
169 Ga0209676_1000146 3300025292 Bacteria 174095
170 Ga0209676_1002307 3300025292 Bacteria 13898
171 Ga0209676_1059602 3300025292 Bacteria 957
172 Ga0209025_1035622 3300025294 Bacteria 2245
173 Ga0209050_1000126 3300025298 Bacteria 188438
174 Ga0209050_1013537 3300025298 Bacteria 3612
175 Ga0209050_1021825 3300025298 Bacteria 2317
176 Ga0209257_1000256 3300025304 Bacteria 123057
177 Ga0209257_1002572 3300025304 Bacteria 17649
178 Ga0209257_1002727 3300025304 Bacteria 16784
179 Ga0207688_10184696 3300025901 Bacteria 1245
180 Ga0207680_10053509 3300025903 Bacteria 2424
181 Ga0207647_10004165 3300025904 Bacteria 10726
182 Ga0207647_10012219 3300025904 Bacteria 5985
183 Ga0207647_10020602 3300025904 Bacteria 4419
184 Ga0207647_10082489 3300025904 Bacteria 1926
185 Ga0207647_10095278 3300025904 Bacteria 1772
186 Ga0207645_10004384 3300025907 Bacteria 10452
187 Ga0207705_10000055 3300025909 Bacteria 160436
188 Ga0207705_10000179 3300025909 Bacteria 66765
189 Ga0207705_10007178 3300025909 Bacteria 8207
190 Ga0207705_10049148 3300025909 Bacteria 3036
191 Ga0207705_10440011 3300025909 Bacteria 1010
192 Ga0207705_10564913 3300025909 Bacteria 884
193 Ga0207695_10005778 3300025913 Bacteria 16288
194 Ga0207671_10014180 3300025914 Bacteria 6309
195 Ga0207671_10090510 3300025914 Bacteria 2304
196 Ga0207657_10000791 3300025919 Bacteria 33627
197 Ga0207657_10004951 3300025919 Bacteria 14018
198 Ga0207657_10010795 3300025919 Bacteria 9092
199 Ga0207657_10013332 3300025919 Bacteria 8064
200 Ga0207681_10002127 3300025923 Bacteria 12647
201 Ga0207681_10331354 3300025923 Bacteria 1213
202 Ga0207681_10393024 3300025923 Bacteria 1119
203 Ga0207694_10061897 3300025924 Bacteria 2913
204 Ga0207650_10108279 3300025925 Bacteria 2148
205 Ga0207650_10129821 3300025925 Bacteria 1971
206 Ga0207644_10113154 3300025931 Bacteria 2055
207 Ga0207644_10126625 3300025931 Bacteria 1950
208 Ga0207644_10164538 3300025931 Bacteria 1727
209 Ga0207706_10010431 3300025933 Bacteria 8489
210 Ga0207706_10017733 3300025933 Bacteria 6413
211 Ga0207706_10036405 3300025933 Bacteria 4371
212 Ga0207706_10037963 3300025933 Bacteria 4274
213 Ga0207706_10053390 3300025933 Bacteria 3568
214 Ga0207706_10162190 3300025933 Bacteria 1965
215 Ga0207686_10004317 3300025934 Bacteria 7623
216 Ga0207709_10000314 3300025935 Bacteria 52842
217 Ga0207670_10032957 3300025936 Bacteria 3335
218 Ga0207704_10000005 3300025938 Bacteria 225353
219 Ga0207704_10519372 3300025938 Bacteria 963
220 Ga0207691_10031510 3300025940 Bacteria 4947
221 Ga0207689_10001653 3300025942 Bacteria 21135
222 Ga0207667_10000016 3300025949 Bacteria 391466
223 Ga0207667_10079777 3300025949 Bacteria 3392
224 Ga0207667_10251436 3300025949 Bacteria 1808
225 Ga0207651_10000007 3300025960 Bacteria 225286
226 Ga0207712_10007902 3300025961 Bacteria 6720
227 Ga0207712_10095408 3300025961 Bacteria 2199
228 Ga0207668_10000296 3300025972 Bacteria 32653
229 Ga0207668_10036012 3300025972 Bacteria 3301
230 Ga0207640_10000139 3300025981 Bacteria 53517
231 Ga0207640_10024737 3300025981 Bacteria 3628
232 Ga0207658_10000072 3300025986 Bacteria 112469
233 Ga0207677_10000085 3300026023 Bacteria 78393
234 Ga0207639_10047804 3300026041 Bacteria 3235
235 Ga0207639_10057513 3300026041 Bacteria 2986
236 Ga0207678_10035760 3300026067 Bacteria 4324
237 Ga0207678_10036634 3300026067 Bacteria 4270
238 Ga0207708_10219575 3300026075 Bacteria 1522
239 Ga0207702_10005342 3300026078 Bacteria 11261
240 Ga0207702_10018661 3300026078 Bacteria 5738
241 Ga0207702_10383110 3300026078 Bacteria 1353
242 Ga0207641_10000096 3300026088 Bacteria 123585
243 Ga0207648_10000005 3300026089 Bacteria 225083
244 Ga0207674_10006242 3300026116 Bacteria 14046
245 Ga0207674_10017443 3300026116 Bacteria 7835
246 Ga0207675_100028654 3300026118 Bacteria 5187
247 Ga0207698_10000294 3300026142 Bacteria 30242
248 Ga0207698_10010421 3300026142 Bacteria 5971
249 Ga0207698_10056740 3300026142 Bacteria 3025
250 Ga0209813_10000020 3300027866 Bacteria 75376
251 Ga0268266_10135170 3300028379 Bacteria 2208
252 Ga0268264_10012832 3300028381 Bacteria 6896
253 Ga0307408_100027647 3300031548 Bacteria 3911
254 Ga0307405_10048066 3300031731 Bacteria 2629
255 Ga0307405_10146823 3300031731 Bacteria 1653
256 Ga0307413_10086671 3300031824 Bacteria 2025
257 Ga0307406_10085972 3300031901 Bacteria 2104
258 Ga0307406_10105751 3300031901 Bacteria 1926
259 Ga0307406_10393431 3300031901 Bacteria 1096
260 Ga0307412_10001306 3300031911 Bacteria 13981
261 Ga0307412_10001453 3300031911 Bacteria 13173
262 Ga0307412_10020708 3300031911 Bacteria 4006
263 Ga0307412_10091719 3300031911 Bacteria 2127
264 Ga0307412_10098664 3300031911 Bacteria 2060
265 Ga0307414_10000607 3300032004 Bacteria 18398
266 Ga0307414_10012355 3300032004 Bacteria 5046
267 Ga0307414_10079396 3300032004 Bacteria 2395
268 Ga0307414_10102825 3300032004 Bacteria 2154
269 Ga0307414_10216193 3300032004 Bacteria 1570
270 Ga0307411_10043443 3300032005 Bacteria 2875
271 Ga0307415_100677333 3300032126 Bacteria 928
272 Ga0395899_0001254 3300037312 Bacteria 22064
273 Ga0395900_0090023 3300037418 Bacteria 3154
274 Ga0395900_0366027 3300037418 Bacteria 1412
275 Ga0395905_0095441 3300037471 Bacteria 2791
276 Ga0395905_0224836 3300037471 Bacteria 1756
277 Ga0395901_0998747 3300038443 Bacteria 813
278 Ga0439448_0000954 3300042005 Bacteria 7133
279 Ga0439448_0002340 3300042005 Bacteria 5139
280 Ga0439448_0003467 3300042005 Bacteria 4370
281 Ga0439448_0005772 3300042005 Bacteria 3536
282 Ga0439455_0000109 3300042012 Bacteria 8273
283 Ga0439455_0000505 3300042012 Bacteria 5435
284 Ga0439455_0002132 3300042012 Bacteria 3535
285 Ga0439458_0000632 3300042157 Bacteria 9121
286 Ga0439458_0001013 3300042157 Bacteria 7188
287 Ga0466972_0010990 3300044658 Bacteria 4545
288 Ga0466965_0027007 3300044683 Bacteria 2784
289 Ga0466966_0011213 3300044684 Bacteria 5949
290 Ga0466961_0011581 3300044693 Bacteria 5637
291 Ga0466963_0049425 3300044694 Bacteria 2781
292 Ga0466964_0013581 3300044706 Bacteria 3089
293 Ga0466971_0022878 3300044719 Bacteria 2785
294 Ga0466970_0004968 3300044765 Bacteria 6570
295 Ga0466957_0036824 3300044842 Bacteria 2943
296 Ga0466957_0102411 3300044842 Bacteria 1806
297 Ga0466960_0101204 3300044901 Bacteria 1484
298 Ga0466959_0035767 3300045049 Bacteria 3670
299 Ga0466958_0021853 3300045836 Bacteria 3742
300 Ga0466967_0029296 3300045976 Bacteria 4606
301 Ga0466967_1033346 3300045976 Bacteria 818
302 Ga0495627_000941 3300046453 Bacteria 20026
303 Ga0495627_002847 3300046453 Bacteria 7993
304 Ga0495638_0000014 3300046460 Bacteria 417060
305 Ga0495638_0048227 3300046460 Bacteria 2667
306 Ga0495638_0280838 3300046460 Bacteria 905
307 Ga0495650_0001110 3300046471 Bacteria 29443
308 Ga0495584_0128531 3300046491 Bacteria 1285
309 Ga0495583_0000072 3300046506 Bacteria 182057
310 Ga0495583_0000201 3300046506 Bacteria 100380
311 Ga0495606_0000842 3300046507 Bacteria 46207
312 Ga0495610_0000127 3300046512 Bacteria 84143
313 Ga0495631_0029609 3300046518 Bacteria 2489
314 Ga0495632_0000048 3300046519 Bacteria 137883
315 Ga0495632_0000171 3300046519 Bacteria 66639
316 Ga0495637_0000423 3300046520 Bacteria 30963
317 Ga0495637_0009504 3300046520 Bacteria 4739
318 Ga0495643_0000030 3300046522 Bacteria 260229
319 Ga0495643_0010369 3300046522 Bacteria 5737
320 Ga0495648_0000021 3300046524 Bacteria 246945
321 Ga0495648_0021069 3300046524 Bacteria 4525
322 Ga0495663_0000003 3300046525 Bacteria 362694
323 Ga0495654_0045118 3300046530 Bacteria 2176
324 Ga0495633_0003052 3300046558 Bacteria 11397
325 Ga0495633_0006472 3300046558 Bacteria 6932
326 Ga0495633_0028739 3300046558 Bacteria 2707
327 Ga0495633_0068294 3300046558 Bacteria 1659
328 Ga0495668_0000015 3300046616 Bacteria 441932
329 Ga0495611_0008401 3300046648 Bacteria 4373
330 Ga0495625_0002061 3300046660 Bacteria 22521
331 Ga0495625_0070549 3300046660 Bacteria 2453
332 Ga0495671_0000028 3300046692 Bacteria 234938
333 Ga0495671_0000043 3300046692 Bacteria 163036
334 Ga0495671_0080243 3300046692 Bacteria 1599
335 Ga0495687_099181 3300047443 Bacteria 1097
336 Ga0495673_0000058 3300047469 Bacteria 235044
337 Ga0495673_0075903 3300047469 Bacteria 1403
338 Ga0495681_0000155 3300047470 Bacteria 57469
339 Ga0495681_0000983 3300047470 Bacteria 21816
340 Ga0495686_0000368 3300047472 Bacteria 73088
341 Ga0495686_0000518 3300047472 Bacteria 55768
342 Ga0495686_0001904 3300047472 Bacteria 20835
343 Ga0495686_0003497 3300047472 Bacteria 13569
344 Ga0495686_0031280 3300047472 Bacteria 3452
345 Ga0495686_0094738 3300047472 Bacteria 1809
346 Ga0496102_0000345 3300048905 Bacteria 56618
347 Ga0496103_0005035 3300048906 Bacteria 7969
348 Ga0496108_0000875 3300048911 Bacteria 23492
349 Ga0496109_0019845 3300048912 Bacteria 5932
350 Ga0496110_0008352 3300048913 Bacteria 8331
351 Ga0496110_0042254 3300048913 Bacteria 3979
352 Ga0496111_0024561 3300048914 Bacteria 4246
353 Ga0496113_0018744 3300048916 Bacteria 4826
354 Ga0496116_0011662 3300048919 Bacteria 7247
355 Ga0496117_0000633 3300048920 Bacteria 56618
356 Ga0496117_0072393 3300048920 Bacteria 2304
357 Ga0496117_0110348 3300048920 Bacteria 1715
358 Ga0496117_0168034 3300048920 Bacteria 1276
359 Ga0496117_0187258 3300048920 Bacteria 1183
360 Ga0496118_0000654 3300048921 Bacteria 56618
361 Ga0496118_0010750 3300048921 Bacteria 9024
362 Ga0496118_0024851 3300048921 Bacteria 5158
363 Ga0496118_0070052 3300048921 Bacteria 2535
364 Ga0496118_0187737 3300048921 Bacteria 1240
365 Ga0496118_0217337 3300048921 Bacteria 1116
366 Ga0496119_0010246 3300048922 Bacteria 7902
367 Ga0496120_0017741 3300048923 Bacteria 4603
368 Ga0496120_0102992 3300048923 Bacteria 1505
369 Ga0496121_0000454 3300048924 Bacteria 80561
370 Ga0496121_0071532 3300048924 Bacteria 2789
371 Ga0496121_0113228 3300048924 Bacteria 2065
372 Ga0496122_0001352 3300048925 Bacteria 39977
373 Ga0496122_0036640 3300048925 Bacteria 3962
374 Ga0496122_0070406 3300048925 Bacteria 2499
375 Ga0496122_0093525 3300048925 Bacteria 2039
376 Ga0496123_0000465 3300048926 Bacteria 70986
377 Ga0496123_0022020 3300048926 Bacteria 4930
378 Ga0496123_0029963 3300048926 Bacteria 3994
379 Ga0496123_0045638 3300048926 Bacteria 2983
380 Ga0496123_0064154 3300048926 Bacteria 2342
381 Ga0496124_0000664 3300048927 Bacteria 56618
382 Ga0496124_0002038 3300048927 Bacteria 27462
383 Ga0496124_0008038 3300048927 Bacteria 11091
384 Ga0496124_0102915 3300048927 Bacteria 2310
385 Ga0496124_0106034 3300048927 Bacteria 2269
386 Ga0496124_0177029 3300048927 Bacteria 1645
387 Ga0496124_0238196 3300048927 Bacteria 1355
388 Ga0496125_0018322 3300048928 Bacteria 6653
389 Ga0496125_0024468 3300048928 Bacteria 5552
390 Ga0496125_0076136 3300048928 Bacteria 2592
391 Ga0496125_0132936 3300048928 Bacteria 1747
392 Ga0496126_0030460 3300048929 Bacteria 5111
393 Ga0496126_0093505 3300048929 Bacteria 2640
394 Ga0496126_0180428 3300048929 Bacteria 1794
395 Ga0495682_0023125 3300049460 Bacteria 2322
396 Ga0501031_0130277 3300049568 Bacteria 1643
397 Ga0501032_0062790 3300049569 Bacteria 2488
398 Ga0501033_0010630 3300049570 Bacteria 7057
399 Ga0501034_0075887 3300049571 Bacteria 3368
400 Ga0501036_0044978 3300049572 Bacteria 3740
401 Ga0501037_0066682 3300049573 Bacteria 2621
402 Ga0501038_0025913 3300049574 Bacteria 5223
403 Ga0501039_0015976 3300049575 Bacteria 5748
404 Ga0501043_0220013 3300049579 Bacteria 1469
405 Ga0501046_0297272 3300049580 Bacteria 1180
406 Ga0501047_0125830 3300049581 Bacteria 2443
407 Ga0501048_0194916 3300049582 Bacteria 1436
408 Ga0501223_000021 3300049663 Bacteria 66697
409 Ga0501225_0000011 3300049705 Bacteria 74084
410 Ga0501225_0019452 3300049705 Bacteria 1879
411 Ga0501035_0012696 3300049822 Bacteria 7783
412 Ga0501044_0044360 3300049823 Bacteria 4613
413 nmdc:mga03n38_1172_c1 3300050490 Bacteria 7301
414 nmdc:mga0k408_76067_c1 3300050493 Bacteria 1962
415 nmdc:mga06z11_59_c2 3300050494 Bacteria 45567
416 nmdc:mga04h51_11080_c1 3300050495 Bacteria 2494
417 nmdc:mga05p37_388028_c1 3300050507 Bacteria 1634
418 Ga0500651_0139240 3300053093 Bacteria 1464
419 Ga0500555_015164 3300053103 Bacteria 2222
420 Ga0500562_015571 3300053108 Bacteria 1951
421 Ga0500592_009184 3300053116 Bacteria 1570
422 Ga0500592_016041 3300053116 Bacteria 1203
423 Ga0500597_006565 3300053120 Bacteria 3874
424 Ga0500608_194398 3300053122 Bacteria 845
425 Ga0500568_0003398 3300053139 Bacteria 8897
426 Ga0500604_0074795 3300053151 Bacteria 1086
427 Ga0500616_0071306 3300053153 Bacteria 1770
428 Ga0500624_000008 3300053157 Bacteria 181801
429 Ga0500624_000012 3300053157 Bacteria 165895
430 Ga0500627_0000028 3300053158 Bacteria 99118
431 Ga0500637_0000101 3300053178 Bacteria 31079
432 Ga0500611_001800 3300053727 Bacteria 2446
433 Ga0466962_0001247 3300061719 Bacteria 11734

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100105153 Ga0068859_1001051533 176
2 3300006931 Ga0097620_100105147 Ga0097620_1001051473 176
3 3300025936 Ga0207670_10032957 Ga0207670_100329571 182
4 3300005438 Ga0070701_10045151 Ga0070701_100451512 186
5 3300005544 Ga0070686_100117382 Ga0070686_1001173822 186
6 3300005719 Ga0068861_100050543 Ga0068861_1000505433 186
7 3300013308 Ga0157375_10063387 Ga0157375_100633874 190
8 3300014326 Ga0157380_10259160 Ga0157380_102591603 192
9 3300005365 Ga0070688_100473021 Ga0070688_1004730211 193
10 3300026075 Ga0207708_10219575 Ga0207708_102195752 193
11 3300026118 Ga0207675_100028654 Ga0207675_1000286545 200
12 3300053120 Ga0500597_006565 Ga0500597_006565_1594_2259 200
13 3300053157 Ga0500624_000008 Ga0500624_000008_29444_30109 200
14 3300053178 Ga0500637_0000101 Ga0500637_0000101_16839_17504 200
15 3300048925 Ga0496122_0001352 Ga0496122_0001352_37738_38412 207
16 3300048926 Ga0496123_0000465 Ga0496123_0000465_7740_8414 207
17 3300048927 Ga0496124_0008038 Ga0496124_0008038_8219_8893 207
18 3300005289 Ga0065704_10001961 Ga0065704_1000196110 210
19 3300005295 Ga0065707_10166599 Ga0065707_101665992 210
20 3300005331 Ga0070670_100083167 Ga0070670_1000831674 210
21 3300005466 Ga0070685_10161641 Ga0070685_101616412 210
22 3300005618 Ga0068864_100385107 Ga0068864_1003851072 210
23 3300009147 Ga0114129_10374160 Ga0114129_103741601 210
24 3300009553 Ga0105249_10635172 Ga0105249_106351721 210
25 3300009978 Ga0105148_100146 Ga0105148_1001466 210
26 3300025925 Ga0207650_10108279 Ga0207650_101082791 210
27 3300025931 Ga0207644_10164538 Ga0207644_101645382 210
28 3300048912 Ga0496109_0019845 Ga0496109_0019845_4156_4830 210
29 3300048913 Ga0496110_0008352 Ga0496110_0008352_5577_6251 210
30 3300048914 Ga0496111_0024561 Ga0496111_0024561_2536_3210 210
31 3300048916 Ga0496113_0018744 Ga0496113_0018744_1496_2170 210
32 3300048926 Ga0496123_0029963 Ga0496123_0029963_1931_2605 210
33 3300048927 Ga0496124_0238196 Ga0496124_0238196_39_713 210
34 3300048928 Ga0496125_0018322 Ga0496125_0018322_1563_2237 210
35 3300049663 Ga0501223_000021 Ga0501223_000021_26565_27239 210
36 3300049705 Ga0501225_0000011 Ga0501225_0000011_26570_27244 210
37 3300049705 Ga0501225_0019452 Ga0501225_0019452_918_1592 210
38 3300050507 nmdc:mga05p37_388028_c1 nmdc:mga05p37_388028_c1_29_703 210
39 3300048905 Ga0496102_0000345 Ga0496102_0000345_52619_53287 213
40 3300048906 Ga0496103_0005035 Ga0496103_0005035_3970_4638 213
41 3300048919 Ga0496116_0011662 Ga0496116_0011662_3755_4423 213
42 3300048920 Ga0496117_0000633 Ga0496117_0000633_3332_4000 213
43 3300048921 Ga0496118_0000654 Ga0496118_0000654_52619_53287 213
44 3300048927 Ga0496124_0000664 Ga0496124_0000664_52619_53287 213
45 3300005355 Ga0070671_100030999 Ga0070671_1000309992 216
46 3300005457 Ga0070662_100146476 Ga0070662_1001464762 216
47 3300013100 Ga0157373_10043196 Ga0157373_100431963 216
48 3300025931 Ga0207644_10126625 Ga0207644_101266253 216
49 3300025933 Ga0207706_10053390 Ga0207706_100533904 216
50 3300042005 Ga0439448_0005772 Ga0439448_0005772_755_1408 216
51 3300042012 Ga0439455_0002132 Ga0439455_0002132_1757_2410 216
52 3300003763 Ga0055529_1005504 Ga0055529_10055043 217
53 3300005339 Ga0070660_100033044 Ga0070660_1000330444 217
54 3300025254 Ga0209148_1001194 Ga0209148_100119416 217
55 3300025272 Ga0209455_1000574 Ga0209455_100057420 217
56 3300025904 Ga0207647_10082489 Ga0207647_100824893 217
57 3300048920 Ga0496117_0187258 Ga0496117_0187258_336_1007 217
58 3300048921 Ga0496118_0010750 Ga0496118_0010750_8158_8829 217
59 3300048922 Ga0496119_0010246 Ga0496119_0010246_6658_7329 217
60 3300048923 Ga0496120_0017741 Ga0496120_0017741_124_795 217
61 3300048924 Ga0496121_0071532 Ga0496121_0071532_225_896 217
62 3300001990 JGI24737J22298_10048962 JGI24737J22298_100489623 218
63 3300001991 JGI24743J22301_10049196 JGI24743J22301_100491961 218
64 3300002075 JGI24738J21930_10004515 JGI24738J21930_100045156 218
65 3300002244 JGI24742J22300_10034976 JGI24742J22300_100349761 218
66 3300003762 Ga0055542_1009332 Ga0055542_10093323 218
67 3300005327 Ga0070658_10000062 Ga0070658_1000006253 218
68 3300005327 Ga0070658_10037040 Ga0070658_100370405 218
69 3300005339 Ga0070660_100000377 Ga0070660_1000003774 218
70 3300005339 Ga0070660_100019488 Ga0070660_1000194884 218
71 3300005354 Ga0070675_100150155 Ga0070675_1001501551 218
72 3300005355 Ga0070671_100067672 Ga0070671_1000676724 218
73 3300005366 Ga0070659_100036509 Ga0070659_1000365092 218
74 3300005539 Ga0068853_100041194 Ga0068853_1000411942 218
75 3300005547 Ga0070693_100020120 Ga0070693_1000201203 218
76 3300005563 Ga0068855_100000095 Ga0068855_10000009550 218
77 3300005564 Ga0070664_100273443 Ga0070664_1002734432 218
78 3300005577 Ga0068857_100024736 Ga0068857_1000247366 218
79 3300005578 Ga0068854_100000265 Ga0068854_1000002656 218
80 3300005578 Ga0068854_100046578 Ga0068854_1000465783 218
81 3300005614 Ga0068856_100051628 Ga0068856_1000516281 218
82 3300005614 Ga0068856_100436920 Ga0068856_1004369202 218
83 3300005616 Ga0068852_100000586 Ga0068852_1000005868 218
84 3300006237 Ga0097621_100001128 Ga0097621_10000112817 218
85 3300006358 Ga0068871_100007431 Ga0068871_1000074316 218
86 3300009545 Ga0105237_10052574 Ga0105237_100525743 218
87 3300013100 Ga0157373_10003665 Ga0157373_100036659 218
88 3300013296 Ga0157374_10010449 Ga0157374_100104496 218
89 3300025254 Ga0209148_1000074 Ga0209148_1000074223 218
90 3300025901 Ga0207688_10184696 Ga0207688_101846962 218
91 3300025909 Ga0207705_10000179 Ga0207705_1000017919 218
92 3300025909 Ga0207705_10049148 Ga0207705_100491483 218
93 3300025909 Ga0207705_10440011 Ga0207705_104400112 218
94 3300025914 Ga0207671_10090510 Ga0207671_100905104 218
95 3300025919 Ga0207657_10000791 Ga0207657_100007914 218
96 3300025919 Ga0207657_10013332 Ga0207657_100133325 218
97 3300025931 Ga0207644_10113154 Ga0207644_101131543 218
98 3300025938 Ga0207704_10519372 Ga0207704_105193722 218
99 3300025940 Ga0207691_10031510 Ga0207691_100315103 218
100 3300025949 Ga0207667_10000016 Ga0207667_10000016284 218
101 3300025981 Ga0207640_10000139 Ga0207640_100001391 218
102 3300025981 Ga0207640_10024737 Ga0207640_100247374 218
103 3300026067 Ga0207678_10035760 Ga0207678_100357604 218
104 3300026078 Ga0207702_10383110 Ga0207702_103831102 218
105 3300026116 Ga0207674_10017443 Ga0207674_100174435 218
106 3300026142 Ga0207698_10000294 Ga0207698_1000029432 218
107 3300037471 Ga0395905_0095441 Ga0395905_0095441_1388_2044 218
108 3300037471 Ga0395905_0224836 Ga0395905_0224836_796_1452 218
109 3300038443 Ga0395901_0998747 Ga0395901_0998747_55_711 218
110 3300044658 Ga0466972_0010990 Ga0466972_0010990_1498_2154 218
111 3300044706 Ga0466964_0013581 Ga0466964_0013581_416_1072 218
112 iso_pu_bacteria 2643221560 2643820289 218
113 iso_pu_bacteria 2643221563 2643834607 218
114 iso_pu_bacteria 2643221608 2644055533 218
115 iso_pu_bacteria 2852653556 2852656259 218
116 iso_pu_bacteria 2852680915 2852683320 218
117 3300001989 JGI24739J22299_10003297 JGI24739J22299_100032974 219
118 3300001989 JGI24739J22299_10012988 JGI24739J22299_100129886 219
119 3300001989 JGI24739J22299_10078374 JGI24739J22299_100783742 219
120 3300001990 JGI24737J22298_10001952 JGI24737J22298_100019522 219
121 3300002067 JGI24735J21928_10004239 JGI24735J21928_100042391 219
122 3300002067 JGI24735J21928_10011300 JGI24735J21928_100113001 219
123 3300002067 JGI24735J21928_10012995 JGI24735J21928_100129952 219
124 3300002067 JGI24735J21928_10018808 JGI24735J21928_100188083 219
125 3300002067 JGI24735J21928_10021137 JGI24735J21928_100211372 219
126 3300002067 JGI24735J21928_10029317 JGI24735J21928_100293174 219
127 3300002075 JGI24738J21930_10001250 JGI24738J21930_100012506 219
128 3300003214 JGI25165J46597_1000165 JGI25165J46597_100016567 219
129 3300003320 rootH2_10155443 rootH2_101554432 219
130 3300003322 rootL2_10076898 rootL2_100768985 219
131 3300003322 rootL2_10155331 rootL2_101553312 219
132 3300003323 rootH1_10106799 rootH1_101067992 219
133 3300003323 rootH1_10262695 rootH1_102626952 219
134 3300005327 Ga0070658_10004018 Ga0070658_1000401811 219
135 3300005327 Ga0070658_10004565 Ga0070658_1000456510 219
136 3300005327 Ga0070658_10217520 Ga0070658_102175203 219
137 3300005328 Ga0070676_10000416 Ga0070676_1000041614 219
138 3300005334 Ga0068869_100015254 Ga0068869_1000152544 219
139 3300005339 Ga0070660_100002444 Ga0070660_1000024448 219
140 3300005364 Ga0070673_100000002 Ga0070673_100000002198 219
141 3300005366 Ga0070659_100254525 Ga0070659_1002545253 219
142 3300005366 Ga0070659_100461694 Ga0070659_1004616942 219
143 3300005457 Ga0070662_100029502 Ga0070662_1000295022 219
144 3300005457 Ga0070662_100041043 Ga0070662_1000410433 219
145 3300005457 Ga0070662_100267170 Ga0070662_1002671702 219
146 3300005459 Ga0068867_100000012 Ga0068867_10000001216 219
147 3300005539 Ga0068853_100111734 Ga0068853_1001117342 219
148 3300005563 Ga0068855_100071449 Ga0068855_1000714494 219
149 3300005614 Ga0068856_100016744 Ga0068856_1000167442 219
150 3300005616 Ga0068852_100181971 Ga0068852_1001819712 219
151 3300006195 Ga0075366_10041128 Ga0075366_100411283 219
152 3300006353 Ga0075370_10104550 Ga0075370_101045503 219
153 3300006881 Ga0068865_100000004 Ga0068865_100000004197 219
154 3300009093 Ga0105240_10179929 Ga0105240_101799294 219
155 3300009098 Ga0105245_10001027 Ga0105245_100010275 219
156 3300009148 Ga0105243_10000146 Ga0105243_1000014615 219
157 3300009176 Ga0105242_10000497 Ga0105242_1000049730 219
158 3300009553 Ga0105249_10015630 Ga0105249_100156303 219
159 3300010375 Ga0105239_10141816 Ga0105239_101418162 219
160 3300010375 Ga0105239_10491278 Ga0105239_104912782 219
161 3300011119 Ga0105246_10000138 Ga0105246_1000013817 219
162 3300013102 Ga0157371_10214174 Ga0157371_102141742 219
163 3300013104 Ga0157370_10000096 Ga0157370_1000009647 219
164 3300013104 Ga0157370_10091181 Ga0157370_100911812 219
165 3300013105 Ga0157369_10022918 Ga0157369_100229184 219
166 3300013296 Ga0157374_10001104 Ga0157374_1000110411 219
167 3300013307 Ga0157372_10034063 Ga0157372_100340635 219
168 3300013307 Ga0157372_10060755 Ga0157372_100607552 219
169 3300013307 Ga0157372_10081266 Ga0157372_100812662 219
170 3300013308 Ga0157375_10000587 Ga0157375_1000058711 219
171 3300014969 Ga0157376_10000131 Ga0157376_1000013142 219
172 3300017792 Ga0163161_10399733 Ga0163161_103997331 219
173 3300025231 Ga0207427_100557 Ga0207427_1005573 219
174 3300025250 Ga0209026_1001831 Ga0209026_10018313 219
175 3300025261 Ga0209233_1000098 Ga0209233_1000098226 219
176 3300025272 Ga0209455_1039272 Ga0209455_10392721 219
177 3300025903 Ga0207680_10053509 Ga0207680_100535093 219
178 3300025904 Ga0207647_10004165 Ga0207647_100041655 219
179 3300025904 Ga0207647_10012219 Ga0207647_100122192 219
180 3300025904 Ga0207647_10095278 Ga0207647_100952782 219
181 3300025907 Ga0207645_10004384 Ga0207645_100043845 219
182 3300025909 Ga0207705_10000055 Ga0207705_10000055142 219
183 3300025909 Ga0207705_10007178 Ga0207705_100071784 219
184 3300025909 Ga0207705_10564913 Ga0207705_105649131 219
185 3300025913 Ga0207695_10005778 Ga0207695_100057789 219
186 3300025919 Ga0207657_10004951 Ga0207657_100049519 219
187 3300025933 Ga0207706_10010431 Ga0207706_100104318 219
188 3300025933 Ga0207706_10017733 Ga0207706_100177336 219
189 3300025933 Ga0207706_10036405 Ga0207706_100364056 219
190 3300025933 Ga0207706_10162190 Ga0207706_101621903 219
191 3300025934 Ga0207686_10004317 Ga0207686_100043178 219
192 3300025935 Ga0207709_10000314 Ga0207709_1000031464 219
193 3300025938 Ga0207704_10000005 Ga0207704_1000000516 219
194 3300025942 Ga0207689_10001653 Ga0207689_1000165316 219
195 3300025949 Ga0207667_10079777 Ga0207667_100797772 219
196 3300025960 Ga0207651_10000007 Ga0207651_1000000716 219
197 3300025961 Ga0207712_10007902 Ga0207712_100079028 219
198 3300026023 Ga0207677_10000085 Ga0207677_100000855 219
199 3300026041 Ga0207639_10047804 Ga0207639_100478042 219
200 3300026078 Ga0207702_10005342 Ga0207702_100053426 219
201 3300026089 Ga0207648_10000005 Ga0207648_1000000517 219
202 3300026142 Ga0207698_10056740 Ga0207698_100567403 219
203 3300037312 Ga0395899_0001254 Ga0395899_0001254_20931_21590 219
204 3300037418 Ga0395900_0090023 Ga0395900_0090023_1684_2343 219
205 3300037418 Ga0395900_0366027 Ga0395900_0366027_573_1235 219
206 3300042005 Ga0439448_0000954 Ga0439448_0000954_6343_7005 219
207 3300042005 Ga0439448_0002340 Ga0439448_0002340_3198_3860 219
208 3300042005 Ga0439448_0003467 Ga0439448_0003467_3138_3800 219
209 3300042012 Ga0439455_0000109 Ga0439455_0000109_6554_7216 219
210 3300042012 Ga0439455_0000505 Ga0439455_0000505_10_672 219
211 3300042157 Ga0439458_0000632 Ga0439458_0000632_8373_9035 219
212 3300042157 Ga0439458_0001013 Ga0439458_0001013_2614_3276 219
213 3300044683 Ga0466965_0027007 Ga0466965_0027007_2101_2760 219
214 3300044684 Ga0466966_0011213 Ga0466966_0011213_94_753 219
215 3300044693 Ga0466961_0011581 Ga0466961_0011581_1613_2272 219
216 3300044694 Ga0466963_0049425 Ga0466963_0049425_1337_1996 219
217 3300044719 Ga0466971_0022878 Ga0466971_0022878_1989_2648 219
218 3300044765 Ga0466970_0004968 Ga0466970_0004968_3442_4101 219
219 3300044842 Ga0466957_0036824 Ga0466957_0036824_1864_2523 219
220 3300044842 Ga0466957_0102411 Ga0466957_0102411_827_1486 219
221 3300044901 Ga0466960_0101204 Ga0466960_0101204_810_1469 219
222 3300045049 Ga0466959_0035767 Ga0466959_0035767_205_864 219
223 3300045836 Ga0466958_0021853 Ga0466958_0021853_1623_2282 219
224 3300045976 Ga0466967_0029296 Ga0466967_0029296_212_871 219
225 3300045976 Ga0466967_1033346 Ga0466967_1033346_100_759 219
226 3300047443 Ga0495687_099181 Ga0495687_099181_161_823 219
227 3300048921 Ga0496118_0217337 Ga0496118_0217337_160_819 219
228 3300050493 nmdc:mga0k408_76067_c1 nmdc:mga0k408_76067_c1_668_1342 219
229 3300061719 Ga0466962_0001247 Ga0466962_0001247_5193_5852 219
230 iso_pu_bacteria 2775507255 2778124763 219
231 3300046460 Ga0495638_0048227 Ga0495638_0048227_1747_2412 220
232 3300047472 Ga0495686_0003497 Ga0495686_0003497_9404_10069 220
233 3300048920 Ga0496117_0168034 Ga0496117_0168034_22_687 220
234 3300048921 Ga0496118_0070052 Ga0496118_0070052_1458_2123 220
235 3300048923 Ga0496120_0102992 Ga0496120_0102992_735_1400 220
236 3300048924 Ga0496121_0113228 Ga0496121_0113228_565_1230 220
237 3300048925 Ga0496122_0036640 Ga0496122_0036640_1858_2523 220
238 3300048926 Ga0496123_0022020 Ga0496123_0022020_3738_4403 220
239 3300053151 Ga0500604_0074795 Ga0500604_0074795_38_703 220
240 iso_pu_bacteria 2512564014 2512643711 220
241 iso_pu_bacteria 2808606401 2809064346 220
242 iso_pu_bacteria 2808606404 2809080314 220
243 iso_pu_bacteria 2808606405 2809084678 220
244 iso_pu_bacteria 2880518877 2880522085 220
245 iso_pu_bacteria 2919709256 2919713310 220
246 3300001904 JGI24736J21556_1003382 JGI24736J21556_10033823 221
247 3300005289 Ga0065704_10113709 Ga0065704_101137092 221
248 3300005331 Ga0070670_100155196 Ga0070670_1001551963 221
249 3300005347 Ga0070668_100000019 Ga0070668_10000001989 221
250 3300005353 Ga0070669_100004351 Ga0070669_10000435114 221
251 3300005367 Ga0070667_100000094 Ga0070667_100000094105 221
252 3300005841 Ga0068863_100000057 Ga0068863_100000057105 221
253 3300005843 Ga0068860_100018154 Ga0068860_1000181542 221
254 3300005937 Ga0081455_10000187 Ga0081455_1000018756 221
255 3300025292 Ga0209676_1059602 Ga0209676_10596022 221
256 3300025923 Ga0207681_10002127 Ga0207681_100021274 221
257 3300025923 Ga0207681_10393024 Ga0207681_103930242 221
258 3300025925 Ga0207650_10129821 Ga0207650_101298213 221
259 3300025972 Ga0207668_10000296 Ga0207668_1000029624 221
260 3300025986 Ga0207658_10000072 Ga0207658_1000007215 221
261 3300026088 Ga0207641_10000096 Ga0207641_10000096102 221
262 3300028381 Ga0268264_10012832 Ga0268264_100128322 221
263 3300031911 Ga0307412_10020708 Ga0307412_100207081 221
264 3300046460 Ga0495638_0000014 Ga0495638_0000014_345997_346665 221
265 3300046460 Ga0495638_0280838 Ga0495638_0280838_155_823 221
266 3300046471 Ga0495650_0001110 Ga0495650_0001110_19181_19849 221
267 3300046506 Ga0495583_0000072 Ga0495583_0000072_111196_111861 221
268 3300046506 Ga0495583_0000201 Ga0495583_0000201_60077_60745 221
269 3300046507 Ga0495606_0000842 Ga0495606_0000842_13035_13703 221
270 3300046519 Ga0495632_0000171 Ga0495632_0000171_64664_65332 221
271 3300046524 Ga0495648_0000021 Ga0495648_0000021_70344_71012 221
272 3300046558 Ga0495633_0028739 Ga0495633_0028739_1073_1741 221
273 3300046648 Ga0495611_0008401 Ga0495611_0008401_1828_2496 221
274 3300046692 Ga0495671_0000028 Ga0495671_0000028_164024_164689 221
275 3300046692 Ga0495671_0080243 Ga0495671_0080243_773_1441 221
276 3300047469 Ga0495673_0000058 Ga0495673_0000058_70302_70967 221
277 3300047469 Ga0495673_0075903 Ga0495673_0075903_101_769 221
278 3300047472 Ga0495686_0000368 Ga0495686_0000368_44750_45418 221
279 3300047472 Ga0495686_0001904 Ga0495686_0001904_7380_8120 221
280 3300047472 Ga0495686_0094738 Ga0495686_0094738_316_984 221
281 3300048920 Ga0496117_0110348 Ga0496117_0110348_787_1455 221
282 3300048921 Ga0496118_0024851 Ga0496118_0024851_3481_4149 221
283 3300048926 Ga0496123_0064154 Ga0496123_0064154_900_1568 221
284 3300048927 Ga0496124_0002038 Ga0496124_0002038_23405_24070 221
285 3300049460 Ga0495682_0023125 Ga0495682_0023125_200_868 221
286 3300053103 Ga0500555_015164 Ga0500555_015164_1404_2072 221
287 3300053116 Ga0500592_016041 Ga0500592_016041_174_842 221
288 3300053122 Ga0500608_194398 Ga0500608_194398_129_797 221
289 3300053153 Ga0500616_0071306 Ga0500616_0071306_528_1196 221
290 3300053727 Ga0500611_001800 Ga0500611_001800_1486_2154 221
291 3300003781 Ga0055536_1009163 Ga0055536_10091635 222
292 3300003781 Ga0055536_1012735 Ga0055536_10127353 222
293 3300003781 Ga0055536_1019914 Ga0055536_10199143 222
294 3300003784 Ga0055534_1005827 Ga0055534_10058272 222
295 3300003791 Ga0055530_10000197 Ga0055530_100001978 222
296 3300003794 Ga0055531_10008524 Ga0055531_100085243 222
297 3300005327 Ga0070658_10067181 Ga0070658_100671813 222
298 3300013297 Ga0157378_10812021 Ga0157378_108120211 222
299 3300025291 Ga0209675_1000162 Ga0209675_100016251 222
300 3300025292 Ga0209676_1000113 Ga0209676_1000113118 222
301 3300025292 Ga0209676_1000146 Ga0209676_1000146122 222
302 3300025292 Ga0209676_1002307 Ga0209676_100230711 222
303 3300025294 Ga0209025_1035622 Ga0209025_10356223 222
304 3300025298 Ga0209050_1000126 Ga0209050_1000126118 222
305 3300025298 Ga0209050_1013537 Ga0209050_10135374 222
306 3300025298 Ga0209050_1021825 Ga0209050_10218252 222
307 3300025304 Ga0209257_1000256 Ga0209257_1000256112 222
308 3300025304 Ga0209257_1002572 Ga0209257_100257216 222
309 3300025304 Ga0209257_1002727 Ga0209257_100272715 222
310 3300031731 Ga0307405_10146823 Ga0307405_101468233 222
311 3300031901 Ga0307406_10085972 Ga0307406_100859721 222
312 3300031901 Ga0307406_10393431 Ga0307406_103934312 222
313 3300031911 Ga0307412_10001306 Ga0307412_100013062 222
314 3300031911 Ga0307412_10001453 Ga0307412_1000145311 222
315 3300031911 Ga0307412_10091719 Ga0307412_100917193 222
316 3300032004 Ga0307414_10000607 Ga0307414_1000060723 222
317 3300032004 Ga0307414_10012355 Ga0307414_100123554 222
318 3300032004 Ga0307414_10102825 Ga0307414_101028253 222
319 3300032004 Ga0307414_10216193 Ga0307414_102161932 222
320 3300046522 Ga0495643_0010369 Ga0495643_0010369_1718_2389 222
321 3300046616 Ga0495668_0000015 Ga0495668_0000015_289908_290579 222
322 3300046660 Ga0495625_0002061 Ga0495625_0002061_9987_10658 222
323 3300048929 Ga0496126_0180428 Ga0496126_0180428_435_1106 222
324 3300049568 Ga0501031_0130277 Ga0501031_0130277_440_1111 222
325 3300049569 Ga0501032_0062790 Ga0501032_0062790_1026_1697 222
326 3300049570 Ga0501033_0010630 Ga0501033_0010630_6134_6805 222
327 3300049571 Ga0501034_0075887 Ga0501034_0075887_1394_2065 222
328 3300049572 Ga0501036_0044978 Ga0501036_0044978_790_1461 222
329 3300049573 Ga0501037_0066682 Ga0501037_0066682_445_1116 222
330 3300049574 Ga0501038_0025913 Ga0501038_0025913_1525_2196 222
331 3300049575 Ga0501039_0015976 Ga0501039_0015976_960_1631 222
332 3300049579 Ga0501043_0220013 Ga0501043_0220013_221_892 222
333 3300049580 Ga0501046_0297272 Ga0501046_0297272_469_1140 222
334 3300049581 Ga0501047_0125830 Ga0501047_0125830_929_1600 222
335 3300049582 Ga0501048_0194916 Ga0501048_0194916_299_970 222
336 3300049822 Ga0501035_0012696 Ga0501035_0012696_6035_6706 222
337 3300049823 Ga0501044_0044360 Ga0501044_0044360_1243_1914 222
338 3300053093 Ga0500651_0139240 Ga0500651_0139240_599_1270 222
339 3300053139 Ga0500568_0003398 Ga0500568_0003398_2719_3390 222
340 3300053157 Ga0500624_000012 Ga0500624_000012_116207_116878 222
341 3300001904 JGI24736J21556_1001619 JGI24736J21556_10016194 223
342 3300001915 JGI24741J21665_1000001 JGI24741J21665_10000015 223
343 3300001979 JGI24740J21852_10001522 JGI24740J21852_100015222 223
344 3300001989 JGI24739J22299_10000851 JGI24739J22299_1000085110 223
345 3300001990 JGI24737J22298_10000719 JGI24737J22298_1000071911 223
346 3300002067 JGI24735J21928_10005935 JGI24735J21928_100059354 223
347 3300002075 JGI24738J21930_10005832 JGI24738J21930_100058323 223
348 3300005289 Ga0065704_10003935 Ga0065704_100039357 223
349 3300005289 Ga0065704_10164837 Ga0065704_101648371 223
350 3300005329 Ga0070683_100458475 Ga0070683_1004584752 223
351 3300005339 Ga0070660_100014500 Ga0070660_1000145002 223
352 3300005347 Ga0070668_100053308 Ga0070668_1000533084 223
353 3300005353 Ga0070669_100160160 Ga0070669_1001601601 223
354 3300005366 Ga0070659_100006403 Ga0070659_1000064032 223
355 3300005471 Ga0070698_100748439 Ga0070698_1007484391 223
356 3300005539 Ga0068853_100279663 Ga0068853_1002796632 223
357 3300005548 Ga0070665_100028448 Ga0070665_1000284482 223
358 3300005563 Ga0068855_100114092 Ga0068855_1001140924 223
359 3300005564 Ga0070664_100028935 Ga0070664_1000289355 223
360 3300005614 Ga0068856_100072555 Ga0068856_1000725554 223
361 3300006048 Ga0075363_100005054 Ga0075363_1000050543 223
362 3300006178 Ga0075367_10002832 Ga0075367_100028324 223
363 3300006353 Ga0075370_10017804 Ga0075370_100178042 223
364 3300009011 Ga0105251_10012849 Ga0105251_100128494 223
365 3300009174 Ga0105241_10006190 Ga0105241_100061904 223
366 3300009545 Ga0105237_10015961 Ga0105237_100159616 223
367 3300009553 Ga0105249_10436507 Ga0105249_104365072 223
368 3300010375 Ga0105239_10508456 Ga0105239_105084561 223
369 3300013100 Ga0157373_10045347 Ga0157373_100453474 223
370 3300013104 Ga0157370_10096868 Ga0157370_100968682 223
371 3300013105 Ga0157369_10187251 Ga0157369_101872511 223
372 3300013105 Ga0157369_10282891 Ga0157369_102828912 223
373 3300013307 Ga0157372_10725164 Ga0157372_107251642 223
374 3300013307 Ga0157372_10737957 Ga0157372_107379572 223
375 3300017792 Ga0163161_10002898 Ga0163161_100028982 223
376 3300017792 Ga0163161_10030610 Ga0163161_100306103 223
377 3300017792 Ga0163161_10212334 Ga0163161_102123342 223
378 3300025229 Ga0209147_100815 Ga0209147_10081512 223
379 3300025904 Ga0207647_10020602 Ga0207647_100206024 223
380 3300025914 Ga0207671_10014180 Ga0207671_100141805 223
381 3300025919 Ga0207657_10010795 Ga0207657_100107952 223
382 3300025923 Ga0207681_10331354 Ga0207681_103313542 223
383 3300025924 Ga0207694_10061897 Ga0207694_100618972 223
384 3300025933 Ga0207706_10037963 Ga0207706_100379632 223
385 3300025949 Ga0207667_10251436 Ga0207667_102514361 223
386 3300025961 Ga0207712_10095408 Ga0207712_100954081 223
387 3300025972 Ga0207668_10036012 Ga0207668_100360122 223
388 3300026041 Ga0207639_10057513 Ga0207639_100575135 223
389 3300026067 Ga0207678_10036634 Ga0207678_100366344 223
390 3300026078 Ga0207702_10018661 Ga0207702_100186615 223
391 3300026116 Ga0207674_10006242 Ga0207674_1000624214 223
392 3300026142 Ga0207698_10010421 Ga0207698_100104215 223
393 3300027866 Ga0209813_10000020 Ga0209813_100000202 223
394 3300028379 Ga0268266_10135170 Ga0268266_101351703 223
395 3300031548 Ga0307408_100027647 Ga0307408_1000276472 223
396 3300031731 Ga0307405_10048066 Ga0307405_100480663 223
397 3300031824 Ga0307413_10086671 Ga0307413_100866712 223
398 3300031901 Ga0307406_10105751 Ga0307406_101057512 223
399 3300031911 Ga0307412_10098664 Ga0307412_100986642 223
400 3300032004 Ga0307414_10079396 Ga0307414_100793963 223
401 3300032005 Ga0307411_10043443 Ga0307411_100434434 223
402 3300032126 Ga0307415_100677333 Ga0307415_1006773331 223
403 3300046453 Ga0495627_000941 Ga0495627_000941_2090_2764 223
404 3300046453 Ga0495627_002847 Ga0495627_002847_4790_5479 223
405 3300046491 Ga0495584_0128531 Ga0495584_0128531_466_1137 223
406 3300046512 Ga0495610_0000127 Ga0495610_0000127_7851_8540 223
407 3300046518 Ga0495631_0029609 Ga0495631_0029609_364_1038 223
408 3300046519 Ga0495632_0000048 Ga0495632_0000048_2612_3286 223
409 3300046520 Ga0495637_0000423 Ga0495637_0000423_17951_18622 223
410 3300046520 Ga0495637_0009504 Ga0495637_0009504_2007_2696 223
411 3300046522 Ga0495643_0000030 Ga0495643_0000030_12340_13011 223
412 3300046524 Ga0495648_0021069 Ga0495648_0021069_2248_2922 223
413 3300046525 Ga0495663_0000003 Ga0495663_0000003_185064_185738 223
414 3300046530 Ga0495654_0045118 Ga0495654_0045118_796_1470 223
415 3300046558 Ga0495633_0003052 Ga0495633_0003052_2513_3187 223
416 3300046558 Ga0495633_0006472 Ga0495633_0006472_3180_3854 223
417 3300046558 Ga0495633_0068294 Ga0495633_0068294_366_1055 223
418 3300046660 Ga0495625_0070549 Ga0495625_0070549_850_1524 223
419 3300046692 Ga0495671_0000043 Ga0495671_0000043_12340_13011 223
420 3300047470 Ga0495681_0000155 Ga0495681_0000155_47105_47794 223
421 3300047470 Ga0495681_0000983 Ga0495681_0000983_18393_19064 223
422 3300047472 Ga0495686_0000518 Ga0495686_0000518_24750_25439 223
423 3300047472 Ga0495686_0031280 Ga0495686_0031280_1615_2289 223
424 3300048911 Ga0496108_0000875 Ga0496108_0000875_2742_3416 223
425 3300048913 Ga0496110_0042254 Ga0496110_0042254_2633_3307 223
426 3300048920 Ga0496117_0072393 Ga0496117_0072393_1329_2090 223
427 3300048921 Ga0496118_0187737 Ga0496118_0187737_180_941 223
428 3300048924 Ga0496121_0000454 Ga0496121_0000454_11598_12272 223
429 3300048925 Ga0496122_0070406 Ga0496122_0070406_1588_2262 223
430 3300048925 Ga0496122_0093525 Ga0496122_0093525_1261_1935 223
431 3300048926 Ga0496123_0045638 Ga0496123_0045638_2076_2750 223
432 3300048927 Ga0496124_0102915 Ga0496124_0102915_769_1443 223
433 3300048927 Ga0496124_0106034 Ga0496124_0106034_15_689 223
434 3300048927 Ga0496124_0177029 Ga0496124_0177029_201_962 223
435 3300048928 Ga0496125_0024468 Ga0496125_0024468_3291_3965 223
436 3300048928 Ga0496125_0076136 Ga0496125_0076136_312_986 223
437 3300048928 Ga0496125_0132936 Ga0496125_0132936_214_888 223
438 3300048929 Ga0496126_0030460 Ga0496126_0030460_4240_4914 223
439 3300048929 Ga0496126_0093505 Ga0496126_0093505_342_1016 223
440 3300050490 nmdc:mga03n38_1172_c1 nmdc:mga03n38_1172_c1_5677_6357 223
441 3300050494 nmdc:mga06z11_59_c2 nmdc:mga06z11_59_c2_12200_12880 223
442 3300050495 nmdc:mga04h51_11080_c1 nmdc:mga04h51_11080_c1_1791_2471 223
443 3300053108 Ga0500562_015571 Ga0500562_015571_530_1204 223
444 3300053116 Ga0500592_009184 Ga0500592_009184_157_831 223
445 3300053158 Ga0500627_0000028 Ga0500627_0000028_28520_29194 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

40

110

0.96

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

37

115

0.82

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

30

109

0.72

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

149

235

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.883 2 206
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8719 2 206
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8636 2 209
4mp4-assembly1.cif.gz_A crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8473 2 207
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.847 2 206
ID Description Score Start End Superfamily
3bbyA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8702 2 82 3.40.30.10
af_P77544_4_214_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8453 2 206 3.40.50.720
4mp4C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8394 86 193 1.20.1050.10
af_Q4CZ29_2_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.831 2 82 3.40.30.10
1n2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8276 1 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2W4ZCE3-F1-model_v4 Glutathione S-transferase 0.9971 2 196 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A2W5C6Y9-F1-model_v4 Glutathione S-transferase 0.9941 2 221 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A431J993-F1-model_v4 deleted 0.9864 1 160
AF-A5PCQ9-F1-model_v4 Glutathione S-transferase, N-terminal 0.9857 2 218 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A0B9A480-F1-model_v4 Glutathione S-transferase-like protein 0.9839 2 221 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
92.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map