F445433

General Info

Members Datasets Scaffolds Average Seq Length
445 294 411 182

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100876613|Ga0070711_1008766131
Length 210
Sequence MRDTIASLHRASRTAPRAAIGAMLLAIACGLGGCAGGGAVNDSFAMASTGASPTVTFESIDGPPPQVFDRMVSVLDSESKLRNLSIVSREGGASYRVRSYLAAQVVRGRTMISWVWDVYDGNQQRALRLSGEEPAGKAGRDAWATADDMVLRKIAQAGLSGLASMINGTPQDTAPAAPSPAPGKRGPAVASTEPPASGAYTVSALSYTEH

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2791355199
11 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
12 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
13 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
14 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
15 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
16 2904699407
17 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
18 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
19 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
20 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
21 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
22 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
23 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
24 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
25 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
176 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
286 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
287 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
288 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
289 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
290 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
291 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
292 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
293 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
294 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.33
Metatranscriptomes 0.45
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 7.42
Rhizoplane 6.52
Rhizosphere 69.44
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100014689 3300005334 Bacteria 5237
2 Ga0068869_100236210 3300005334 Bacteria 1454
3 Ga0070682_100371308 3300005337 Bacteria 1073
4 Ga0070689_100209263 3300005340 Bacteria 1596
5 Ga0070687_100086555 3300005343 Bacteria 1723
6 Ga0070661_100339349 3300005344 Bacteria 1177
7 Ga0070668_100030456 3300005347 Bacteria 4102
8 Ga0070668_100084775 3300005347 Bacteria 2489
9 Ga0070671_100107925 3300005355 Bacteria 2338
10 Ga0070671_100292751 3300005355 Bacteria 1386
11 Ga0070674_100046511 3300005356 Bacteria 2969
12 Ga0070674_100332864 3300005356 Bacteria 1221
13 Ga0070673_101136060 3300005364 Bacteria 731
14 Ga0070688_100135896 3300005365 Bacteria 1664
15 Ga0070659_100234298 3300005366 Bacteria 1518
16 Ga0070667_100661751 3300005367 Bacteria 965
17 Ga0070709_10001107 3300005434 Bacteria 14866
18 Ga0070709_10450171 3300005434 Bacteria 970
19 Ga0070709_10580835 3300005434 Bacteria 861
20 Ga0070714_100625138 3300005435 Bacteria 1035
21 Ga0070713_100003901 3300005436 Bacteria 9889
22 Ga0070713_100187553 3300005436 Bacteria 1862
23 Ga0070710_10041921 3300005437 Bacteria 2529
24 Ga0070701_10217181 3300005438 Bacteria 1138
25 Ga0070711_100004148 3300005439 Bacteria 8518
26 Ga0070711_100023408 3300005439 Bacteria 4016
27 Ga0070711_100876613 3300005439 Bacteria 765
28 Ga0070705_100073425 3300005440 Bacteria 2076
29 Ga0070678_100461379 3300005456 Bacteria 1114
30 Ga0070662_100495449 3300005457 Bacteria 1019
31 Ga0070681_10007443 3300005458 Bacteria 10703
32 Ga0070707_100763836 3300005468 Bacteria 930
33 Ga0070698_100143771 3300005471 Bacteria 2335
34 Ga0070699_100215674 3300005518 Bacteria 1709
35 Ga0070679_100143789 3300005530 Bacteria 2363
36 Ga0068853_100192679 3300005539 Bacteria 1853
37 Ga0068853_100559791 3300005539 Bacteria 1084
38 Ga0070672_100146356 3300005543 Bacteria 1952
39 Ga0070672_100215682 3300005543 Bacteria 1608
40 Ga0070672_100353053 3300005543 Bacteria 1254
41 Ga0070696_100247245 3300005546 Bacteria 1347
42 Ga0070665_100036335 3300005548 Bacteria 4955
43 Ga0070665_100155149 3300005548 Bacteria 2291
44 Ga0070665_100242833 3300005548 Bacteria 1801
45 Ga0070665_100608684 3300005548 Bacteria 1106
46 Ga0068855_100004506 3300005563 Bacteria 17017
47 Ga0068855_100348174 3300005563 Bacteria 1632
48 Ga0070664_100165763 3300005564 Bacteria 1958
49 Ga0068857_100094348 3300005577 Bacteria 2679
50 Ga0068856_100088714 3300005614 Bacteria 3075
51 Ga0070702_100088367 3300005615 Bacteria 1873
52 Ga0068852_100123017 3300005616 Bacteria 2378
53 Ga0068852_100435359 3300005616 Bacteria 1296
54 Ga0068852_100658816 3300005616 Bacteria 1055
55 Ga0068859_100469259 3300005617 Bacteria 1354
56 Ga0068864_100591568 3300005618 Bacteria 1076
57 Ga0068861_100087892 3300005719 Bacteria 2446
58 Ga0068851_10136213 3300005834 Bacteria 1332
59 Ga0068851_10143342 3300005834 Bacteria 1301
60 Ga0068870_10059464 3300005840 Bacteria 2049
61 Ga0068863_100600224 3300005841 Bacteria 1089
62 Ga0068863_100871707 3300005841 Bacteria 900
63 Ga0068858_100013346 3300005842 Bacteria 7750
64 Ga0068858_100173897 3300005842 Bacteria 2032
65 Ga0068858_100201817 3300005842 Bacteria 1881
66 Ga0068860_100001648 3300005843 Bacteria 23877
67 Ga0068860_100045547 3300005843 Bacteria 4183
68 Ga0068860_100047409 3300005843 Bacteria 4095
69 Ga0068860_100157732 3300005843 Bacteria 2187
70 Ga0068860_100174926 3300005843 Bacteria 2075
71 Ga0068862_100354777 3300005844 Bacteria 1361
72 Ga0068862_100564428 3300005844 Bacteria 1088
73 Ga0068862_100623842 3300005844 Bacteria 1037
74 Ga0081540_1001716 3300005983 Bacteria 18545
75 Ga0081540_1015187 3300005983 Bacteria 4887
76 Ga0081540_1059419 3300005983 Bacteria 1836
77 Ga0081540_1175701 3300005983 Bacteria 809
78 Ga0070717_10003698 3300006028 Bacteria 10991
79 Ga0070717_10014572 3300006028 Bacteria 6052
80 Ga0070717_10067354 3300006028 Bacteria 2979
81 Ga0075365_10250503 3300006038 Bacteria 1244
82 Ga0075368_10058394 3300006042 Bacteria 1542
83 Ga0075363_100033760 3300006048 Bacteria 2667
84 Ga0075363_100233382 3300006048 Bacteria 1057
85 Ga0075364_10114413 3300006051 Bacteria 1803
86 Ga0075364_10244691 3300006051 Bacteria 1218
87 Ga0070716_100001149 3300006173 Bacteria 11674
88 Ga0070716_100750090 3300006173 Bacteria 751
89 Ga0070712_100055353 3300006175 Bacteria 2778
90 Ga0070712_100188583 3300006175 Bacteria 1612
91 Ga0075362_10246135 3300006177 Bacteria 879
92 Ga0075367_10012514 3300006178 Bacteria 4528
93 Ga0097621_100171624 3300006237 Bacteria 1870
94 Ga0075370_10011721 3300006353 Bacteria 4614
95 Ga0068871_100296513 3300006358 Bacteria 1418
96 Ga0068871_101441432 3300006358 Bacteria 650
97 Ga0075428_101158489 3300006844 Bacteria 816
98 Ga0075433_10450119 3300006852 Bacteria 1135
99 Ga0068865_100088845 3300006881 Bacteria 2237
100 Ga0075436_100444256 3300006914 Bacteria 944
101 Ga0097620_100469237 3300006931 Bacteria 1354
102 Ga0097620_100780837 3300006931 Bacteria 1043
103 Ga0099825_1032383 3300006941 Bacteria 2125
104 Ga0099824_1035105 3300006942 Bacteria 1552
105 Ga0099822_1013793 3300006943 Bacteria 9407
106 Ga0099795_10041135 3300007788 Bacteria 1645
107 Ga0105251_10192721 3300009011 Bacteria 918
108 Ga0105250_10199807 3300009092 Bacteria 843
109 Ga0105240_10026526 3300009093 Bacteria 7602
110 Ga0105240_10048210 3300009093 Bacteria 5385
111 Ga0105240_10384933 3300009093 Bacteria 1583
112 Ga0111539_10022424 3300009094 Bacteria 7759
113 Ga0105245_10136035 3300009098 Bacteria 2309
114 Ga0105245_10205096 3300009098 Bacteria 1895
115 Ga0105245_10435980 3300009098 Bacteria 1316
116 Ga0105245_10889095 3300009098 Bacteria 932
117 Ga0105247_10547520 3300009101 Bacteria 850
118 Ga0114129_10590521 3300009147 Bacteria 1440
119 Ga0105243_11244338 3300009148 Bacteria 759
120 Ga0105241_10029981 3300009174 Bacteria 4063
121 Ga0105241_10037182 3300009174 Bacteria 3667
122 Ga0105241_10045473 3300009174 Bacteria 3331
123 Ga0105242_10250663 3300009176 Bacteria 1595
124 Ga0105248_10022204 3300009177 Bacteria 7036
125 Ga0105248_10257440 3300009177 Bacteria 1965
126 Ga0105248_10565400 3300009177 Bacteria 1283
127 Ga0105248_10656676 3300009177 Bacteria 1183
128 Ga0105237_10001334 3300009545 Bacteria 32733
129 Ga0105237_10032568 3300009545 Bacteria 5276
130 Ga0105237_10034979 3300009545 Bacteria 5084
131 Ga0105237_10124958 3300009545 Bacteria 2567
132 Ga0105249_10127011 3300009553 Bacteria 2429
133 Ga0105239_10007955 3300010375 Bacteria 12116
134 Ga0105239_10151252 3300010375 Bacteria 2590
135 Ga0105239_10198941 3300010375 Bacteria 2244
136 Ga0105239_10533441 3300010375 Bacteria 1336
137 Ga0105246_10749333 3300011119 Bacteria 861
138 Ga0157370_10009051 3300013104 Bacteria 10682
139 Ga0157370_10489818 3300013104 Bacteria 1130
140 Ga0157369_10009225 3300013105 Bacteria 11287
141 Ga0157374_10029144 3300013296 Bacteria 4994
142 Ga0157378_10007996 3300013297 Bacteria 9232
143 Ga0157378_10037945 3300013297 Bacteria 4269
144 Ga0157378_10315485 3300013297 Bacteria 1517
145 Ga0157378_10528825 3300013297 Bacteria 1182
146 Ga0163162_10223126 3300013306 Bacteria 2014
147 Ga0163162_10309199 3300013306 Bacteria 1713
148 Ga0163162_10473428 3300013306 Bacteria 1384
149 Ga0163162_10540588 3300013306 Bacteria 1294
150 Ga0157372_10887126 3300013307 Bacteria 1035
151 Ga0157375_10560416 3300013308 Bacteria 1304
152 Ga0163163_10098700 3300014325 Bacteria 2942
153 Ga0163163_10372587 3300014325 Bacteria 1485
154 Ga0163163_10506343 3300014325 Bacteria 1269
155 Ga0157380_10578883 3300014326 Bacteria 1107
156 Ga0157380_10687089 3300014326 Bacteria 1026
157 Ga0157377_10302983 3300014745 Bacteria 1055
158 Ga0157377_10521105 3300014745 Bacteria 834
159 Ga0157379_10139855 3300014968 Bacteria 2182
160 Ga0157379_10153961 3300014968 Bacteria 2074
161 Ga0157376_10010580 3300014969 Bacteria 6755
162 Ga0157376_10257149 3300014969 Bacteria 1634
163 Ga0157376_10534506 3300014969 Bacteria 1158
164 Ga0163161_10758914 3300017792 Bacteria 812
165 Ga0206354_10602691 3300020081 Bacteria 2470
166 Ga0206353_10951382 3300020082 Bacteria 951
167 Ga0213876_10004341 3300021384 Bacteria 7943
168 Ga0209233_1017109 3300025261 Bacteria 1982
169 Ga0207656_10047720 3300025321 Bacteria 1842
170 Ga0207692_10000223 3300025898 Bacteria 19217
171 Ga0207710_10125171 3300025900 Bacteria 1231
172 Ga0207688_10088632 3300025901 Bacteria 1775
173 Ga0207699_10018276 3300025906 Bacteria 3712
174 Ga0207699_10176886 3300025906 Bacteria 1432
175 Ga0207645_10111620 3300025907 Bacteria 1770
176 Ga0207643_10071871 3300025908 Bacteria 1992
177 Ga0207705_10060366 3300025909 Bacteria 2739
178 Ga0207684_10163308 3300025910 Bacteria 1918
179 Ga0207654_10018054 3300025911 Bacteria 3698
180 Ga0207654_10021694 3300025911 Bacteria 3418
181 Ga0207654_10087116 3300025911 Bacteria 1894
182 Ga0207695_10000123 3300025913 Bacteria 232059
183 Ga0207695_10139904 3300025913 Bacteria 2370
184 Ga0207671_10003762 3300025914 Bacteria 14939
185 Ga0207671_10067770 3300025914 Bacteria 2658
186 Ga0207693_10015424 3300025915 Bacteria 6129
187 Ga0207693_10164433 3300025915 Bacteria 1747
188 Ga0207663_10002105 3300025916 Bacteria 9482
189 Ga0207663_10046538 3300025916 Bacteria 2673
190 Ga0207663_10711605 3300025916 Bacteria 796
191 Ga0207662_10105718 3300025918 Bacteria 1750
192 Ga0207652_10179675 3300025921 Bacteria 1901
193 Ga0207681_10219071 3300025923 Bacteria 1471
194 Ga0207650_10196847 3300025925 Bacteria 1612
195 Ga0207659_10046695 3300025926 Bacteria 3060
196 Ga0207659_10421562 3300025926 Bacteria 1119
197 Ga0207659_10863424 3300025926 Bacteria 778
198 Ga0207687_10202157 3300025927 Bacteria 1554
199 Ga0207687_10315360 3300025927 Bacteria 1264
200 Ga0207700_10007359 3300025928 Bacteria 6725
201 Ga0207700_10068678 3300025928 Bacteria 2717
202 Ga0207644_10138850 3300025931 Bacteria 1869
203 Ga0207690_10171506 3300025932 Bacteria 1626
204 Ga0207690_10442636 3300025932 Bacteria 1043
205 Ga0207706_10131563 3300025933 Bacteria 2201
206 Ga0207706_10146842 3300025933 Bacteria 2075
207 Ga0207709_10676047 3300025935 Bacteria 824
208 Ga0207670_10385572 3300025936 Bacteria 1117
209 Ga0207669_10168572 3300025937 Bacteria 1556
210 Ga0207704_10411732 3300025938 Bacteria 1069
211 Ga0207665_10003603 3300025939 Bacteria 10343
212 Ga0207691_10067962 3300025940 Bacteria 3221
213 Ga0207691_10218725 3300025940 Bacteria 1652
214 Ga0207691_10364059 3300025940 Bacteria 1236
215 Ga0207711_10090492 3300025941 Bacteria 2690
216 Ga0207711_10141802 3300025941 Bacteria 2163
217 Ga0207711_10474659 3300025941 Bacteria 1165
218 Ga0207689_10063029 3300025942 Bacteria 3049
219 Ga0207689_10503692 3300025942 Bacteria 1015
220 Ga0207679_10394680 3300025945 Bacteria 1216
221 Ga0207667_10451544 3300025949 Bacteria 1306
222 Ga0207651_10530528 3300025960 Bacteria 1021
223 Ga0207712_10053734 3300025961 Bacteria 2827
224 Ga0207668_10090493 3300025972 Bacteria 2246
225 Ga0207668_10415598 3300025972 Bacteria 1140
226 Ga0207668_10802656 3300025972 Bacteria 833
227 Ga0207640_10170935 3300025981 Bacteria 1619
228 Ga0207703_10011306 3300026035 Bacteria 6942
229 Ga0207703_10136338 3300026035 Bacteria 2125
230 Ga0207639_10365308 3300026041 Bacteria 1292
231 Ga0207639_10407054 3300026041 Bacteria 1227
232 Ga0207678_10012946 3300026067 Bacteria 7318
233 Ga0207678_10146406 3300026067 Bacteria 2016
234 Ga0207678_10248118 3300026067 Bacteria 1524
235 Ga0207678_10298886 3300026067 Bacteria 1383
236 Ga0207702_10231239 3300026078 Bacteria 1728
237 Ga0207641_10104952 3300026088 Bacteria 2495
238 Ga0207641_10113716 3300026088 Bacteria 2404
239 Ga0207641_10614492 3300026088 Bacteria 1065
240 Ga0207641_10702661 3300026088 Bacteria 996
241 Ga0207648_10023566 3300026089 Bacteria 5512
242 Ga0207676_10144631 3300026095 Bacteria 2040
243 Ga0207676_10380552 3300026095 Bacteria 1314
244 Ga0207674_10283644 3300026116 Bacteria 1604
245 Ga0207675_100397196 3300026118 Bacteria 1358
246 Ga0207675_100563205 3300026118 Bacteria 1140
247 Ga0207675_100662261 3300026118 Bacteria 1051
248 Ga0207683_10157128 3300026121 Bacteria 2054
249 Ga0207698_10133700 3300026142 Bacteria 2124
250 Ga0207698_10140155 3300026142 Bacteria 2082
251 Ga0207698_10433616 3300026142 Bacteria 1264
252 Ga0207698_10466363 3300026142 Bacteria 1222
253 Ga0209589_1000007 3300027357 Bacteria 425699
254 Ga0209489_100008 3300027361 Bacteria 425699
255 Ga0209700_100009 3300027363 Bacteria 425699
256 Ga0209813_10151080 3300027866 Bacteria 832
257 Ga0209813_10195745 3300027866 Bacteria 746
258 Ga0207428_10059724 3300027907 Bacteria 3022
259 Ga0268266_10003841 3300028379 Bacteria 14671
260 Ga0268266_10014525 3300028379 Bacteria 6769
261 Ga0268265_10056954 3300028380 Bacteria 2976
262 Ga0268265_10109058 3300028380 Bacteria 2255
263 Ga0268264_10000042 3300028381 Bacteria 372069
264 Ga0268264_10111661 3300028381 Bacteria 2395
265 Ga0268264_10118333 3300028381 Bacteria 2331
266 Ga0268264_10853217 3300028381 Bacteria 912
267 Ga0307515_10087212 3300028794 Bacteria 3965
268 Ga0307511_10077800 3300030521 Bacteria 2358
269 Ga0265330_10058916 3300031235 Bacteria 1673
270 Ga0265330_10125551 3300031235 Bacteria 1093
271 Ga0265332_10014382 3300031238 Bacteria 3500
272 Ga0307513_10129672 3300031456 Bacteria 2470
273 Ga0307509_10120216 3300031507 Bacteria 2606
274 Ga0307509_10407249 3300031507 Bacteria 1065
275 Ga0307408_100176736 3300031548 Bacteria 1709
276 Ga0307508_10205944 3300031616 Bacteria 1568
277 Ga0307516_10014375 3300031730 Bacteria 8377
278 Ga0307516_10217263 3300031730 Bacteria 1623
279 Ga0307516_10218941 3300031730 Bacteria 1614
280 Ga0307410_10322534 3300031852 Bacteria 1226
281 Ga0307407_10246347 3300031903 Bacteria 1222
282 Ga0307412_10314226 3300031911 Bacteria 1244
283 Ga0307416_100203733 3300032002 Bacteria 1880
284 Ga0307416_100455996 3300032002 Bacteria 1332
285 Ga0307414_10608676 3300032004 Bacteria 981
286 Ga0307411_10085381 3300032005 Bacteria 2186
287 Ga0307411_10791955 3300032005 Bacteria 834
288 Ga0307415_100723497 3300032126 Bacteria 901
289 Ga0307415_100726122 3300032126 Bacteria 899
290 Ga0307510_10024536 3300033180 Bacteria 6965
291 Ga0315911_1000012 3300033442 Bacteria 248988
292 Ga0373934_0153681 3300035086 Bacteria 943
293 Ga0373945_0262750 3300035116 Bacteria 732
294 Ga0373953_0142343 3300035117 Bacteria 1026
295 Ga0373931_0004304 3300035691 Bacteria 6488
296 Ga0373933_0083859 3300035724 Bacteria 1958
297 Ga0395901_0194034 3300038443 Bacteria 2130
298 Ga0436360_0284564 3300039438 Bacteria 1413
299 Ga0436363_1238288 3300039450 Bacteria 2428
300 Ga0436362_0540643 3300039453 Bacteria 4809
301 Ga0439465_0046784 3300041413 Bacteria 1409
302 Ga0466967_0131404 3300045976 Bacteria 2325
303 Ga0495617_008241 3300046452 Bacteria 3596
304 Ga0495641_0117686 3300046461 Bacteria 1185
305 Ga0495653_0057468 3300046463 Bacteria 2960
306 Ga0495605_0109117 3300046474 Bacteria 1264
307 Ga0495605_0159530 3300046474 Bacteria 1002
308 Ga0495639_0009470 3300046475 Bacteria 4177
309 Ga0495584_0111197 3300046491 Bacteria 1386
310 Ga0495585_0289041 3300046492 Bacteria 808
311 Ga0495607_0170582 3300046501 Bacteria 1099
312 Ga0495583_0062715 3300046506 Bacteria 1654
313 Ga0495606_0080610 3300046507 Bacteria 2025
314 Ga0495610_0047325 3300046512 Bacteria 2116
315 Ga0495648_0063447 3300046524 Bacteria 2181
316 Ga0495666_0118479 3300046526 Bacteria 1241
317 Ga0495654_0074333 3300046530 Bacteria 1605
318 Ga0495621_0028601 3300046539 Bacteria 1896
319 Ga0495597_0073096 3300046542 Bacteria 1474
320 Ga0495622_0201208 3300046557 Bacteria 887
321 Ga0495668_0045611 3300046616 Bacteria 2437
322 Ga0495668_0051855 3300046616 Bacteria 2271
323 Ga0495625_0115618 3300046660 Bacteria 1830
324 Ga0495659_0003010 3300046664 Bacteria 5403
325 Ga0495669_0005826 3300046684 Bacteria 5140
326 Ga0495624_0190746 3300046690 Bacteria 1247
327 Ga0495670_0265312 3300046691 Bacteria 917
328 Ga0495589_0156144 3300046794 Bacteria 1088
329 Ga0495672_0057443 3300047320 Bacteria 2260
330 Ga0495672_0262326 3300047320 Bacteria 833
331 Ga0495677_0022158 3300047445 Bacteria 2303
332 Ga0495626_0166867 3300048091 Bacteria 920
333 Ga0496100_0370382 3300048903 Bacteria 1086
334 Ga0496100_0533253 3300048903 Bacteria 907
335 Ga0496101_0336677 3300048904 Bacteria 1185
336 Ga0496101_0837238 3300048904 Bacteria 725
337 Ga0496102_0054487 3300048905 Bacteria 3647
338 Ga0496102_0088910 3300048905 Bacteria 2857
339 Ga0496102_0806120 3300048905 Bacteria 861
340 Ga0496103_0123963 3300048906 Bacteria 1647
341 Ga0496103_0190061 3300048906 Bacteria 1320
342 Ga0496104_0127238 3300048907 Bacteria 2446
343 Ga0496104_0230069 3300048907 Bacteria 1766
344 Ga0496104_0350170 3300048907 Bacteria 1390
345 Ga0496105_0022725 3300048908 Bacteria 5081
346 Ga0496106_0000714 3300048909 Bacteria 23911
347 Ga0496106_0081933 3300048909 Bacteria 2479
348 Ga0496107_0298829 3300048910 Bacteria 1198
349 Ga0496107_0304579 3300048910 Bacteria 1186
350 Ga0496108_0033394 3300048911 Bacteria 4275
351 Ga0496108_0090376 3300048911 Bacteria 2603
352 Ga0496110_0020947 3300048913 Bacteria 5524
353 Ga0496110_0576674 3300048913 Bacteria 1021
354 Ga0496111_0009562 3300048914 Bacteria 6477
355 Ga0496111_0312028 3300048914 Bacteria 1165
356 Ga0496112_0016855 3300048915 Bacteria 6855
357 Ga0496112_0046560 3300048915 Bacteria 4254
358 Ga0496113_0012253 3300048916 Bacteria 5756
359 Ga0496115_0010286 3300048918 Bacteria 6984
360 Ga0496115_0015297 3300048918 Bacteria 5818
361 Ga0496115_0687941 3300048918 Bacteria 805
362 Ga0496116_0115860 3300048919 Bacteria 1563
363 Ga0496117_0019312 3300048920 Bacteria 5604
364 Ga0496117_0207708 3300048920 Bacteria 1101
365 Ga0496118_0002645 3300048921 Bacteria 23738
366 Ga0496119_0027425 3300048922 Bacteria 3914
367 Ga0496119_0067887 3300048922 Bacteria 2101
368 Ga0496121_0000418 3300048924 Bacteria 84182
369 Ga0496121_0000927 3300048924 Bacteria 53016
370 Ga0496121_0040629 3300048924 Bacteria 4077
371 Ga0496124_0002424 3300048927 Bacteria 24471
372 Ga0496124_0091353 3300048927 Bacteria 2481
373 Ga0496124_0099584 3300048927 Bacteria 2357
374 Ga0496125_0110695 3300048928 Bacteria 1990
375 Ga0496125_0155489 3300048928 Bacteria 1563
376 Ga0496126_0005830 3300048929 Bacteria 13925
377 Ga0496126_0102114 3300048929 Bacteria 2507
378 Ga0496126_0130737 3300048929 Bacteria 2170
379 Ga0496126_0206990 3300048929 Bacteria 1653
380 Ga0496126_0408165 3300048929 Bacteria 1100
381 Ga0501036_0893290 3300049572 Bacteria 729
382 Ga0501079_0320598 3300049741 Bacteria 1213
383 nmdc:mga03683_268689_c1 3300050489 Bacteria 795
384 nmdc:mga03n38_16227_c1 3300050490 Bacteria 2894
385 nmdc:mga00v17_19853_c2 3300050491 Bacteria 2557
386 nmdc:mga0yw44_292697_c1 3300050492 Bacteria 1090
387 nmdc:mga0k408_304190_c1 3300050493 Bacteria 952
388 nmdc:mga06z11_10664_c1 3300050494 Bacteria 3926
389 nmdc:mga06z11_147011_c1 3300050494 Bacteria 1337
390 nmdc:mga04h51_125247_c1 3300050495 Bacteria 961
391 nmdc:mga04h51_88355_c1 3300050495 Bacteria 1111
392 nmdc:mga07m45_21566_c1 3300050496 Bacteria 3509
393 nmdc:mga07m45_268463_c1 3300050496 Bacteria 993
394 nmdc:mga05p37_105601_c1 3300050507 Bacteria 3464
395 nmdc:mga08y16_84036_c1 3300050511 Bacteria 3318
396 nmdc:mga08x19_523423_c1 3300050514 Bacteria 838
397 nmdc:mga0a205_448022_c1 3300050515 Bacteria 1151
398 nmdc:mga0a205_636753_c1 3300050515 Bacteria 918
399 Ga0495601_0450383 3300053077 Bacteria 832
400 Ga0500635_0134980 3300053080 Bacteria 933
401 Ga0500578_0379281 3300053086 Bacteria 820
402 Ga0500556_0130365 3300053104 Bacteria 985
403 Ga0500594_0032220 3300053118 Bacteria 1387
404 Ga0500595_004138 3300053119 Bacteria 6579
405 Ga0500595_009099 3300053119 Bacteria 4026
406 Ga0500658_0084026 3300053134 Bacteria 1366
407 Ga0500568_0018973 3300053139 Bacteria 3000
408 Ga0500620_115117 3300053155 Bacteria 942
409 Ga0500636_0202329 3300053177 Bacteria 1049
410 Ga0500645_009090 3300053730 Bacteria 3354
411 Ga0500609_009724 3300053731 Bacteria 1295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10528825 Ga0157378_105288251 146
2 3300026088 Ga0207641_10113716 Ga0207641_101137161 151
3 3300006237 Ga0097621_100171624 Ga0097621_1001716241 152
4 3300031507 Ga0307509_10407249 Ga0307509_104072491 158
5 3300047320 Ga0495672_0057443 Ga0495672_0057443_805_1434 158
6 3300053086 Ga0500578_0379281 Ga0500578_0379281_202_777 159
7 3300048903 Ga0496100_0533253 Ga0496100_0533253_40_606 160
8 iso_pu_bacteria 2885374607 2885378064 160
9 iso_pu_bacteria 2903748898 2903757419 160
10 iso_pu_bacteria 2904699407 2904706718 160
11 iso_pu_bacteria 2908739725 2908740355 160
12 3300005434 Ga0070709_10001107 Ga0070709_100011079 161
13 3300005439 Ga0070711_100004148 Ga0070711_1000041485 161
14 3300006028 Ga0070717_10067354 Ga0070717_100673544 161
15 3300006173 Ga0070716_100001149 Ga0070716_1000011492 161
16 3300006175 Ga0070712_100055353 Ga0070712_1000553533 161
17 3300025898 Ga0207692_10000223 Ga0207692_100002239 161
18 3300025906 Ga0207699_10018276 Ga0207699_100182762 161
19 3300025915 Ga0207693_10015424 Ga0207693_100154242 161
20 3300025916 Ga0207663_10002105 Ga0207663_100021055 161
21 3300025928 Ga0207700_10068678 Ga0207700_100686783 161
22 3300025939 Ga0207665_10003603 Ga0207665_1000360313 161
23 3300025261 Ga0209233_1017109 Ga0209233_10171092 162
24 3300025915 Ga0207693_10164433 Ga0207693_101644332 162
25 3300005356 Ga0070674_100332864 Ga0070674_1003328642 163
26 3300005439 Ga0070711_100023408 Ga0070711_1000234082 163
27 3300009545 Ga0105237_10124958 Ga0105237_101249583 163
28 3300025916 Ga0207663_10046538 Ga0207663_100465382 163
29 3300025937 Ga0207669_10168572 Ga0207669_101685722 163
30 3300009147 Ga0114129_10590521 Ga0114129_105905212 164
31 3300026067 Ga0207678_10298886 Ga0207678_102988862 164
32 3300048929 Ga0496126_0130737 Ga0496126_0130737_122_685 164
33 3300050507 nmdc:mga05p37_105601_c1 nmdc:mga05p37_105601_c1_287_865 164
34 iso_pu_bacteria 2906660503 2906661572 164
35 3300005364 Ga0070673_101136060 Ga0070673_1011360601 165
36 3300005367 Ga0070667_100661751 Ga0070667_1006617511 165
37 3300005437 Ga0070710_10041921 Ga0070710_100419213 165
38 3300005438 Ga0070701_10217181 Ga0070701_102171812 165
39 3300005539 Ga0068853_100559791 Ga0068853_1005597912 165
40 3300005543 Ga0070672_100215682 Ga0070672_1002156822 165
41 3300005548 Ga0070665_100608684 Ga0070665_1006086841 165
42 3300005615 Ga0070702_100088367 Ga0070702_1000883673 165
43 3300005844 Ga0068862_100354777 Ga0068862_1003547772 165
44 3300006881 Ga0068865_100088845 Ga0068865_1000888452 165
45 3300009177 Ga0105248_10565400 Ga0105248_105654002 165
46 3300013297 Ga0157378_10315485 Ga0157378_103154851 165
47 3300013306 Ga0163162_10223126 Ga0163162_102231262 165
48 3300013308 Ga0157375_10560416 Ga0157375_105604162 165
49 3300014326 Ga0157380_10578883 Ga0157380_105788832 165
50 3300014969 Ga0157376_10257149 Ga0157376_102571492 165
51 3300025926 Ga0207659_10421562 Ga0207659_104215622 165
52 3300025927 Ga0207687_10315360 Ga0207687_103153602 165
53 3300025940 Ga0207691_10067962 Ga0207691_100679622 165
54 3300025941 Ga0207711_10474659 Ga0207711_104746591 165
55 3300025961 Ga0207712_10053734 Ga0207712_100537343 165
56 3300026067 Ga0207678_10248118 Ga0207678_102481183 165
57 3300026118 Ga0207675_100397196 Ga0207675_1003971963 165
58 3300031730 Ga0307516_10217263 Ga0307516_102172632 165
59 3300046474 Ga0495605_0159530 Ga0495605_0159530_213_842 165
60 3300046616 Ga0495668_0051855 Ga0495668_0051855_657_1286 165
61 3300046684 Ga0495669_0005826 Ga0495669_0005826_3694_4323 165
62 3300046691 Ga0495670_0265312 Ga0495670_0265312_107_736 165
63 3300047445 Ga0495677_0022158 Ga0495677_0022158_768_1397 165
64 3300048905 Ga0496102_0088910 Ga0496102_0088910_179_808 165
65 3300048918 Ga0496115_0687941 Ga0496115_0687941_154_783 165
66 3300049572 Ga0501036_0893290 Ga0501036_0893290_80_715 165
67 3300049741 Ga0501079_0320598 Ga0501079_0320598_100_735 165
68 3300053104 Ga0500556_0130365 Ga0500556_0130365_145_774 165
69 3300053139 Ga0500568_0018973 Ga0500568_0018973_1221_1850 165
70 iso_pu_bacteria 2876808645 2876811603 165
71 iso_pu_bacteria 2922361189 2922367347 165
72 iso_pu_bacteria 2922386360 2922389952 165
73 3300010375 Ga0105239_10151252 Ga0105239_101512522 166
74 3300031616 Ga0307508_10205944 Ga0307508_102059442 166
75 3300048909 Ga0496106_0000714 Ga0496106_0000714_8765_9367 166
76 3300048910 Ga0496107_0304579 Ga0496107_0304579_438_1040 166
77 3300048920 Ga0496117_0019312 Ga0496117_0019312_4645_5247 166
78 3300048921 Ga0496118_0002645 Ga0496118_0002645_8692_9294 166
79 3300048922 Ga0496119_0067887 Ga0496119_0067887_743_1345 166
80 3300048924 Ga0496121_0000418 Ga0496121_0000418_12406_13008 166
81 3300048927 Ga0496124_0002424 Ga0496124_0002424_18415_19017 166
82 3300048928 Ga0496125_0155489 Ga0496125_0155489_843_1445 166
83 3300048929 Ga0496126_0005830 Ga0496126_0005830_5871_6473 166
84 3300009545 Ga0105237_10032568 Ga0105237_100325683 167
85 3300038443 Ga0395901_0194034 Ga0395901_0194034_318_944 167
86 3300045976 Ga0466967_0131404 Ga0466967_0131404_509_1093 167
87 3300005434 Ga0070709_10450171 Ga0070709_104501712 168
88 3300005548 Ga0070665_100036335 Ga0070665_1000363352 168
89 3300031235 Ga0265330_10125551 Ga0265330_101255511 168
90 3300031238 Ga0265332_10014382 Ga0265332_100143824 168
91 3300031730 Ga0307516_10218941 Ga0307516_102189412 168
92 3300041413 Ga0439465_0046784 Ga0439465_0046784_405_1010 168
93 3300005337 Ga0070682_100371308 Ga0070682_1003713082 169
94 3300005355 Ga0070671_100292751 Ga0070671_1002927511 169
95 3300005548 Ga0070665_100242833 Ga0070665_1002428332 169
96 3300005842 Ga0068858_100201817 Ga0068858_1002018172 169
97 3300005983 Ga0081540_1059419 Ga0081540_10594192 169
98 3300006042 Ga0075368_10058394 Ga0075368_100583942 169
99 3300006048 Ga0075363_100033760 Ga0075363_1000337602 169
100 3300006178 Ga0075367_10012514 Ga0075367_100125142 169
101 3300006353 Ga0075370_10011721 Ga0075370_100117215 169
102 3300007788 Ga0099795_10041135 Ga0099795_100411352 169
103 3300009098 Ga0105245_10889095 Ga0105245_108890951 169
104 3300013104 Ga0157370_10009051 Ga0157370_100090514 169
105 3300013306 Ga0163162_10540588 Ga0163162_105405882 169
106 3300013307 Ga0157372_10887126 Ga0157372_108871261 169
107 3300014325 Ga0163163_10098700 Ga0163163_100987003 169
108 3300014969 Ga0157376_10534506 Ga0157376_105345062 169
109 3300025909 Ga0207705_10060366 Ga0207705_100603663 169
110 3300025972 Ga0207668_10802656 Ga0207668_108026561 169
111 3300026035 Ga0207703_10136338 Ga0207703_101363382 169
112 3300026067 Ga0207678_10146406 Ga0207678_101464063 169
113 3300026078 Ga0207702_10231239 Ga0207702_102312392 169
114 3300027866 Ga0209813_10195745 Ga0209813_101957451 169
115 3300028379 Ga0268266_10003841 Ga0268266_1000384110 169
116 3300028794 Ga0307515_10087212 Ga0307515_100872125 169
117 3300031548 Ga0307408_100176736 Ga0307408_1001767362 169
118 3300046452 Ga0495617_008241 Ga0495617_008241_1234_1854 169
119 3300046461 Ga0495641_0117686 Ga0495641_0117686_435_1061 169
120 3300046474 Ga0495605_0109117 Ga0495605_0109117_202_822 169
121 3300046506 Ga0495583_0062715 Ga0495583_0062715_184_804 169
122 3300046512 Ga0495610_0047325 Ga0495610_0047325_950_1570 169
123 3300046524 Ga0495648_0063447 Ga0495648_0063447_1317_1937 169
124 3300046526 Ga0495666_0118479 Ga0495666_0118479_390_1010 169
125 3300046660 Ga0495625_0115618 Ga0495625_0115618_91_711 169
126 3300048907 Ga0496104_0230069 Ga0496104_0230069_47_670 169
127 3300048910 Ga0496107_0298829 Ga0496107_0298829_522_1145 169
128 3300050490 nmdc:mga03n38_16227_c1 nmdc:mga03n38_16227_c1_1203_1826 169
129 3300050491 nmdc:mga00v17_19853_c2 nmdc:mga00v17_19853_c2_403_1026 169
130 3300050494 nmdc:mga06z11_10664_c1 nmdc:mga06z11_10664_c1_3275_3898 169
131 3300050495 nmdc:mga04h51_125247_c1 nmdc:mga04h51_125247_c1_84_707 169
132 3300050496 nmdc:mga07m45_21566_c1 nmdc:mga07m45_21566_c1_1346_1969 169
133 3300005340 Ga0070689_100209263 Ga0070689_1002092631 170
134 3300005436 Ga0070713_100003901 Ga0070713_1000039016 170
135 3300009174 Ga0105241_10029981 Ga0105241_100299812 170
136 3300009177 Ga0105248_10656676 Ga0105248_106566762 170
137 3300010375 Ga0105239_10007955 Ga0105239_100079551 170
138 3300025906 Ga0207699_10176886 Ga0207699_101768861 170
139 3300025911 Ga0207654_10018054 Ga0207654_100180544 170
140 3300025928 Ga0207700_10007359 Ga0207700_100073596 170
141 3300026142 Ga0207698_10140155 Ga0207698_101401551 170
142 3300031911 Ga0307412_10314226 Ga0307412_103142262 170
143 3300032002 Ga0307416_100455996 Ga0307416_1004559961 170
144 3300032126 Ga0307415_100726122 Ga0307415_1007261221 170
145 3300035691 Ga0373931_0004304 Ga0373931_0004304_1454_2068 170
146 3300046690 Ga0495624_0190746 Ga0495624_0190746_153_776 170
147 3300048905 Ga0496102_0806120 Ga0496102_0806120_31_645 170
148 3300048907 Ga0496104_0127238 Ga0496104_0127238_1330_1944 170
149 3300048915 Ga0496112_0016855 Ga0496112_0016855_5644_6258 170
150 3300048916 Ga0496113_0012253 Ga0496113_0012253_3574_4188 170
151 3300005356 Ga0070674_100046511 Ga0070674_1000465114 171
152 3300005457 Ga0070662_100495449 Ga0070662_1004954492 171
153 3300005843 Ga0068860_100174926 Ga0068860_1001749262 171
154 3300009098 Ga0105245_10435980 Ga0105245_104359802 171
155 3300009553 Ga0105249_10127011 Ga0105249_101270112 171
156 3300010375 Ga0105239_10533441 Ga0105239_105334412 171
157 3300014745 Ga0157377_10302983 Ga0157377_103029831 171
158 3300017792 Ga0163161_10758914 Ga0163161_107589141 171
159 3300021384 Ga0213876_10004341 Ga0213876_100043417 171
160 3300025901 Ga0207688_10088632 Ga0207688_100886322 171
161 3300025932 Ga0207690_10171506 Ga0207690_101715061 171
162 3300025933 Ga0207706_10146842 Ga0207706_101468422 171
163 3300026089 Ga0207648_10023566 Ga0207648_100235665 171
164 3300027866 Ga0209813_10151080 Ga0209813_101510801 171
165 3300028380 Ga0268265_10109058 Ga0268265_101090583 171
166 3300031852 Ga0307410_10322534 Ga0307410_103225342 171
167 3300031903 Ga0307407_10246347 Ga0307407_102463472 171
168 3300032005 Ga0307411_10085381 Ga0307411_100853812 171
169 3300039450 Ga0436363_1238288 Ga0436363_1238288_344_967 171
170 3300039453 Ga0436362_0540643 Ga0436362_0540643_3731_4354 171
171 3300046507 Ga0495606_0080610 Ga0495606_0080610_81_680 171
172 3300046794 Ga0495589_0156144 Ga0495589_0156144_241_864 171
173 3300053730 Ga0500645_009090 Ga0500645_009090_1693_2310 171
174 iso_pu_bacteria 2524023228 2524538246 171
175 iso_pu_bacteria 8006933436 8006937711 171
176 iso_pu_bacteria 8006973647 8006977742 171
177 3300005834 Ga0068851_10143342 Ga0068851_101433422 172
178 3300006177 Ga0075362_10246135 Ga0075362_102461351 172
179 3300006358 Ga0068871_101441432 Ga0068871_1014414321 172
180 3300006941 Ga0099825_1032383 Ga0099825_10323832 172
181 3300006942 Ga0099824_1035105 Ga0099824_10351052 172
182 3300006943 Ga0099822_1013793 Ga0099822_101379310 172
183 3300009094 Ga0111539_10022424 Ga0111539_100224249 172
184 3300009098 Ga0105245_10205096 Ga0105245_102050962 172
185 3300027357 Ga0209589_1000007 Ga0209589_1000007388 172
186 3300027361 Ga0209489_100008 Ga0209489_100008388 172
187 3300027363 Ga0209700_100009 Ga0209700_100009388 172
188 3300027907 Ga0207428_10059724 Ga0207428_100597242 172
189 3300035724 Ga0373933_0083859 Ga0373933_0083859_755_1390 172
190 3300046530 Ga0495654_0074333 Ga0495654_0074333_970_1587 172
191 3300046539 Ga0495621_0028601 Ga0495621_0028601_471_1088 172
192 3300048913 Ga0496110_0576674 Ga0496110_0576674_270_893 172
193 3300048924 Ga0496121_0000927 Ga0496121_0000927_2733_3362 172
194 3300048929 Ga0496126_0408165 Ga0496126_0408165_314_916 172
195 3300050511 nmdc:mga08y16_84036_c1 nmdc:mga08y16_84036_c1_417_1046 172
196 iso_pu_bacteria 2517572143 2517890127 172
197 3300005458 Ga0070681_10007443 Ga0070681_1000744314 173
198 3300005843 Ga0068860_100001648 Ga0068860_10000164814 173
199 3300013306 Ga0163162_10309199 Ga0163162_103091991 173
200 3300014745 Ga0157377_10521105 Ga0157377_105211051 173
201 3300028381 Ga0268264_10000042 Ga0268264_10000042350 173
202 3300031507 Ga0307509_10120216 Ga0307509_101202163 173
203 3300032004 Ga0307414_10608676 Ga0307414_106086762 173
204 3300033180 Ga0307510_10024536 Ga0307510_100245361 173
205 3300033442 Ga0315911_1000012 Ga0315911_1000012113 173
206 3300046557 Ga0495622_0201208 Ga0495622_0201208_78_698 173
207 3300005347 Ga0070668_100030456 Ga0070668_1000304562 174
208 3300005456 Ga0070678_100461379 Ga0070678_1004613791 174
209 3300005543 Ga0070672_100353053 Ga0070672_1003530532 174
210 3300005841 Ga0068863_100600224 Ga0068863_1006002242 174
211 3300005841 Ga0068863_100871707 Ga0068863_1008717072 174
212 3300005844 Ga0068862_100623842 Ga0068862_1006238422 174
213 3300006038 Ga0075365_10250503 Ga0075365_102505032 174
214 3300025940 Ga0207691_10364059 Ga0207691_103640591 174
215 3300025960 Ga0207651_10530528 Ga0207651_105305282 174
216 3300026088 Ga0207641_10614492 Ga0207641_106144921 174
217 3300026088 Ga0207641_10702661 Ga0207641_107026611 174
218 3300026121 Ga0207683_10157128 Ga0207683_101571282 174
219 3300032005 Ga0307411_10791955 Ga0307411_107919552 174
220 3300046463 Ga0495653_0057468 Ga0495653_0057468_1424_2059 174
221 3300046542 Ga0495597_0073096 Ga0495597_0073096_672_1292 174
222 3300048904 Ga0496101_0336677 Ga0496101_0336677_247_894 174
223 3300048904 Ga0496101_0837238 Ga0496101_0837238_55_660 174
224 3300048918 Ga0496115_0015297 Ga0496115_0015297_1484_2089 174
225 3300048919 Ga0496116_0115860 Ga0496116_0115860_836_1456 174
226 3300048920 Ga0496117_0207708 Ga0496117_0207708_270_890 174
227 3300048922 Ga0496119_0027425 Ga0496119_0027425_395_1015 174
228 3300048929 Ga0496126_0102114 Ga0496126_0102114_1470_2090 174
229 3300048929 Ga0496126_0206990 Ga0496126_0206990_21_641 174
230 3300050492 nmdc:mga0yw44_292697_c1 nmdc:mga0yw44_292697_c1_130_750 174
231 3300053077 Ga0495601_0450383 Ga0495601_0450383_26_661 174
232 3300053134 Ga0500658_0084026 Ga0500658_0084026_551_1171 174
233 iso_pu_bacteria 2935630451 2935633339 174
234 iso_pu_bacteria 2941507105 2941509359 174
235 iso_pu_bacteria 2941515067 2941517188 174
236 iso_pu_bacteria 2941523033 2941529957 174
237 iso_pu_bacteria 3005474847 3005476372 174
238 iso_pu_bacteria 8056689827 8056695462 174
239 3300005334 Ga0068869_100236210 Ga0068869_1002362102 175
240 3300005347 Ga0070668_100084775 Ga0070668_1000847752 175
241 3300005365 Ga0070688_100135896 Ga0070688_1001358962 175
242 3300005616 Ga0068852_100123017 Ga0068852_1001230171 175
243 3300005617 Ga0068859_100469259 Ga0068859_1004692593 175
244 3300005842 Ga0068858_100173897 Ga0068858_1001738973 175
245 3300005843 Ga0068860_100045547 Ga0068860_1000455474 175
246 3300005983 Ga0081540_1175701 Ga0081540_11757011 175
247 3300006931 Ga0097620_100469237 Ga0097620_1004692373 175
248 3300009011 Ga0105251_10192721 Ga0105251_101927211 175
249 3300009093 Ga0105240_10384933 Ga0105240_103849332 175
250 3300009098 Ga0105245_10136035 Ga0105245_101360352 175
251 3300013104 Ga0157370_10489818 Ga0157370_104898182 175
252 3300013105 Ga0157369_10009225 Ga0157369_100092257 175
253 3300014326 Ga0157380_10687089 Ga0157380_106870891 175
254 3300020081 Ga0206354_10602691 Ga0206354_106026912 175
255 3300020082 Ga0206353_10951382 Ga0206353_109513821 175
256 3300025913 Ga0207695_10000123 Ga0207695_1000012357 175
257 3300025916 Ga0207663_10711605 Ga0207663_107116051 175
258 3300025926 Ga0207659_10863424 Ga0207659_108634241 175
259 3300025938 Ga0207704_10411732 Ga0207704_104117322 175
260 3300025942 Ga0207689_10503692 Ga0207689_105036921 175
261 3300025972 Ga0207668_10090493 Ga0207668_100904933 175
262 3300026142 Ga0207698_10133700 Ga0207698_101337003 175
263 3300028380 Ga0268265_10056954 Ga0268265_100569542 175
264 3300028381 Ga0268264_10118333 Ga0268264_101183332 175
265 3300031730 Ga0307516_10014375 Ga0307516_100143755 175
266 3300032126 Ga0307415_100723497 Ga0307415_1007234972 175
267 3300048924 Ga0496121_0040629 Ga0496121_0040629_2633_3253 175
268 3300048927 Ga0496124_0091353 Ga0496124_0091353_1559_2179 175
269 3300048928 Ga0496125_0110695 Ga0496125_0110695_315_935 175
270 3300050514 nmdc:mga08x19_523423_c1 nmdc:mga08x19_523423_c1_87_704 175
271 3300050515 nmdc:mga0a205_636753_c1 nmdc:mga0a205_636753_c1_237_854 175
272 3300053155 Ga0500620_115117 Ga0500620_115117_83_706 175
273 3300053177 Ga0500636_0202329 Ga0500636_0202329_14_658 175
274 iso_pu_bacteria 2513237096 2513655663 175
275 iso_pu_bacteria 2513237137 2513864170 175
276 iso_pu_bacteria 2513237145 2513916259 175
277 iso_pu_bacteria 2728368998 2728748959 175
278 iso_pu_bacteria 8006926726 8006929309 175
279 iso_pu_bacteria 8019555841 8019560926 175
280 iso_pu_bacteria 8019565922 8019571008 175
281 3300005468 Ga0070707_100763836 Ga0070707_1007638361 176
282 3300005618 Ga0068864_100591568 Ga0068864_1005915682 176
283 3300009093 Ga0105240_10026526 Ga0105240_100265263 176
284 3300009174 Ga0105241_10045473 Ga0105241_100454733 176
285 3300014325 Ga0163163_10506343 Ga0163163_105063431 176
286 3300025910 Ga0207684_10163308 Ga0207684_101633081 176
287 3300025911 Ga0207654_10087116 Ga0207654_100871162 176
288 3300026095 Ga0207676_10380552 Ga0207676_103805521 176
289 3300031456 Ga0307513_10129672 Ga0307513_101296722 176
290 3300048906 Ga0496103_0190061 Ga0496103_0190061_67_681 176
291 3300048908 Ga0496105_0022725 Ga0496105_0022725_3677_4291 176
292 3300048911 Ga0496108_0033394 Ga0496108_0033394_618_1232 176
293 3300048913 Ga0496110_0020947 Ga0496110_0020947_3370_3984 176
294 3300048914 Ga0496111_0009562 Ga0496111_0009562_93_707 176
295 3300048918 Ga0496115_0010286 Ga0496115_0010286_166_780 176
296 3300053080 Ga0500635_0134980 Ga0500635_0134980_165_785 176
297 iso_pu_bacteria 2513237104 2513717747 176
298 3300006048 Ga0075363_100233382 Ga0075363_1002333822 177
299 3300006051 Ga0075364_10244691 Ga0075364_102446912 177
300 3300006175 Ga0070712_100188583 Ga0070712_1001885832 177
301 3300006844 Ga0075428_101158489 Ga0075428_1011584891 177
302 3300006931 Ga0097620_100780837 Ga0097620_1007808371 177
303 3300009545 Ga0105237_10001334 Ga0105237_1000133418 177
304 3300025914 Ga0207671_10003762 Ga0207671_100037626 177
305 3300030521 Ga0307511_10077800 Ga0307511_100778002 177
306 3300035116 Ga0373945_0262750 Ga0373945_0262750_43_660 177
307 3300039438 Ga0436360_0284564 Ga0436360_0284564_33_647 177
308 3300005434 Ga0070709_10580835 Ga0070709_105808352 178
309 3300005539 Ga0068853_100192679 Ga0068853_1001926792 178
310 3300005563 Ga0068855_100004506 Ga0068855_10000450621 178
311 3300005983 Ga0081540_1015187 Ga0081540_10151874 178
312 3300026041 Ga0207639_10365308 Ga0207639_103653082 178
313 iso_pu_bacteria 8006984368 8006989781 178
314 3300005435 Ga0070714_100625138 Ga0070714_1006251382 179
315 3300005436 Ga0070713_100187553 Ga0070713_1001875532 179
316 3300005530 Ga0070679_100143789 Ga0070679_1001437892 179
317 3300005616 Ga0068852_100658816 Ga0068852_1006588162 179
318 3300005983 Ga0081540_1001716 Ga0081540_10017165 179
319 3300006028 Ga0070717_10003698 Ga0070717_100036985 179
320 3300006051 Ga0075364_10114413 Ga0075364_101144131 179
321 3300006173 Ga0070716_100750090 Ga0070716_1007500902 179
322 3300006358 Ga0068871_100296513 Ga0068871_1002965132 179
323 3300009093 Ga0105240_10048210 Ga0105240_1004821013 179
324 3300009177 Ga0105248_10257440 Ga0105248_102574402 179
325 3300014968 Ga0157379_10153961 Ga0157379_101539612 179
326 3300025913 Ga0207695_10139904 Ga0207695_101399042 179
327 3300025921 Ga0207652_10179675 Ga0207652_101796752 179
328 3300025941 Ga0207711_10141802 Ga0207711_101418022 179
329 3300026142 Ga0207698_10433616 Ga0207698_104336162 179
330 3300046475 Ga0495639_0009470 Ga0495639_0009470_2299_2919 179
331 3300046492 Ga0495585_0289041 Ga0495585_0289041_55_675 179
332 3300046616 Ga0495668_0045611 Ga0495668_0045611_280_900 179
333 3300048091 Ga0495626_0166867 Ga0495626_0166867_199_819 179
334 3300046491 Ga0495584_0111197 Ga0495584_0111197_344_961 180
335 iso_pu_bacteria 2513237101 2513697889 180
336 iso_pu_bacteria 2721755755 2723842759 180
337 iso_pu_bacteria 2791355199 2793080350 180
338 iso_pu_bacteria 2874604998 2874606571 180
339 iso_pu_bacteria 2879110137 2879114186 180
340 iso_pu_bacteria 8006964411 8006966067 180
341 iso_pu_bacteria 8006994254 8006998162 180
342 3300005439 Ga0070711_100876613 Ga0070711_1008766131 181
343 3300005543 Ga0070672_100146356 Ga0070672_1001463562 181
344 3300006028 Ga0070717_10014572 Ga0070717_100145727 181
345 3300013296 Ga0157374_10029144 Ga0157374_100291442 181
346 3300025914 Ga0207671_10067770 Ga0207671_100677702 181
347 3300025925 Ga0207650_10196847 Ga0207650_101968472 181
348 3300053119 Ga0500595_004138 Ga0500595_004138_194_823 181
349 3300005344 Ga0070661_100339349 Ga0070661_1003393492 182
350 3300013297 Ga0157378_10007996 Ga0157378_1000799610 182
351 3300025923 Ga0207681_10219071 Ga0207681_102190712 182
352 3300046664 Ga0495659_0003010 Ga0495659_0003010_1908_2525 182
353 3300047320 Ga0495672_0262326 Ga0495672_0262326_152_769 182
354 3300048927 Ga0496124_0099584 Ga0496124_0099584_312_929 182
355 3300053118 Ga0500594_0032220 Ga0500594_0032220_372_989 182
356 3300053731 Ga0500609_009724 Ga0500609_009724_165_782 182
357 3300006914 Ga0075436_100444256 Ga0075436_1004442562 183
358 3300031235 Ga0265330_10058916 Ga0265330_100589162 183
359 3300035086 Ga0373934_0153681 Ga0373934_0153681_99_731 183
360 3300035117 Ga0373953_0142343 Ga0373953_0142343_169_801 183
361 3300005334 Ga0068869_100014689 Ga0068869_1000146892 184
362 3300005343 Ga0070687_100086555 Ga0070687_1000865552 184
363 3300005355 Ga0070671_100107925 Ga0070671_1001079252 184
364 3300005366 Ga0070659_100234298 Ga0070659_1002342982 184
365 3300005440 Ga0070705_100073425 Ga0070705_1000734252 184
366 3300005471 Ga0070698_100143771 Ga0070698_1001437712 184
367 3300005518 Ga0070699_100215674 Ga0070699_1002156742 184
368 3300005546 Ga0070696_100247245 Ga0070696_1002472452 184
369 3300005548 Ga0070665_100155149 Ga0070665_1001551493 184
370 3300005563 Ga0068855_100348174 Ga0068855_1003481741 184
371 3300005564 Ga0070664_100165763 Ga0070664_1001657632 184
372 3300005577 Ga0068857_100094348 Ga0068857_1000943481 184
373 3300005614 Ga0068856_100088714 Ga0068856_1000887144 184
374 3300005616 Ga0068852_100435359 Ga0068852_1004353592 184
375 3300005719 Ga0068861_100087892 Ga0068861_1000878922 184
376 3300005834 Ga0068851_10136213 Ga0068851_101362132 184
377 3300005840 Ga0068870_10059464 Ga0068870_100594642 184
378 3300005842 Ga0068858_100013346 Ga0068858_1000133469 184
379 3300005843 Ga0068860_100047409 Ga0068860_1000474092 184
380 3300005843 Ga0068860_100157732 Ga0068860_1001577322 184
381 3300005844 Ga0068862_100564428 Ga0068862_1005644282 184
382 3300006852 Ga0075433_10450119 Ga0075433_104501192 184
383 3300009092 Ga0105250_10199807 Ga0105250_101998071 184
384 3300009101 Ga0105247_10547520 Ga0105247_105475201 184
385 3300009148 Ga0105243_11244338 Ga0105243_112443381 184
386 3300009174 Ga0105241_10037182 Ga0105241_100371824 184
387 3300009176 Ga0105242_10250663 Ga0105242_102506632 184
388 3300009177 Ga0105248_10022204 Ga0105248_100222044 184
389 3300009545 Ga0105237_10034979 Ga0105237_100349794 184
390 3300010375 Ga0105239_10198941 Ga0105239_101989412 184
391 3300011119 Ga0105246_10749333 Ga0105246_107493331 184
392 3300013297 Ga0157378_10037945 Ga0157378_100379452 184
393 3300013306 Ga0163162_10473428 Ga0163162_104734281 184
394 3300014325 Ga0163163_10372587 Ga0163163_103725872 184
395 3300014968 Ga0157379_10139855 Ga0157379_101398552 184
396 3300014969 Ga0157376_10010580 Ga0157376_100105805 184
397 3300025321 Ga0207656_10047720 Ga0207656_100477202 184
398 3300025900 Ga0207710_10125171 Ga0207710_101251712 184
399 3300025907 Ga0207645_10111620 Ga0207645_101116202 184
400 3300025908 Ga0207643_10071871 Ga0207643_100718712 184
401 3300025911 Ga0207654_10021694 Ga0207654_100216941 184
402 3300025918 Ga0207662_10105718 Ga0207662_101057182 184
403 3300025926 Ga0207659_10046695 Ga0207659_100466953 184
404 3300025927 Ga0207687_10202157 Ga0207687_102021572 184
405 3300025931 Ga0207644_10138850 Ga0207644_101388502 184
406 3300025932 Ga0207690_10442636 Ga0207690_104426361 184
407 3300025933 Ga0207706_10131563 Ga0207706_101315632 184
408 3300025935 Ga0207709_10676047 Ga0207709_106760471 184
409 3300025936 Ga0207670_10385572 Ga0207670_103855722 184
410 3300025940 Ga0207691_10218725 Ga0207691_102187251 184
411 3300025941 Ga0207711_10090492 Ga0207711_100904922 184
412 3300025942 Ga0207689_10063029 Ga0207689_100630294 184
413 3300025945 Ga0207679_10394680 Ga0207679_103946802 184
414 3300025949 Ga0207667_10451544 Ga0207667_104515441 184
415 3300025972 Ga0207668_10415598 Ga0207668_104155981 184
416 3300025981 Ga0207640_10170935 Ga0207640_101709352 184
417 3300026035 Ga0207703_10011306 Ga0207703_100113064 184
418 3300026041 Ga0207639_10407054 Ga0207639_104070542 184
419 3300026067 Ga0207678_10012946 Ga0207678_100129463 184
420 3300026088 Ga0207641_10104952 Ga0207641_101049522 184
421 3300026095 Ga0207676_10144631 Ga0207676_101446312 184
422 3300026116 Ga0207674_10283644 Ga0207674_102836442 184
423 3300026118 Ga0207675_100563205 Ga0207675_1005632052 184
424 3300026118 Ga0207675_100662261 Ga0207675_1006622611 184
425 3300026142 Ga0207698_10466363 Ga0207698_104663632 184
426 3300028379 Ga0268266_10014525 Ga0268266_100145252 184
427 3300028381 Ga0268264_10111661 Ga0268264_101116612 184
428 3300028381 Ga0268264_10853217 Ga0268264_108532172 184
429 3300032002 Ga0307416_100203733 Ga0307416_1002037332 184
430 3300046501 Ga0495607_0170582 Ga0495607_0170582_385_1002 184
431 3300048903 Ga0496100_0370382 Ga0496100_0370382_338_961 184
432 3300048905 Ga0496102_0054487 Ga0496102_0054487_2881_3504 184
433 3300048906 Ga0496103_0123963 Ga0496103_0123963_767_1387 184
434 3300048907 Ga0496104_0350170 Ga0496104_0350170_734_1357 184
435 3300048909 Ga0496106_0081933 Ga0496106_0081933_545_1168 184
436 3300048911 Ga0496108_0090376 Ga0496108_0090376_1330_1953 184
437 3300048914 Ga0496111_0312028 Ga0496111_0312028_477_1100 184
438 3300048915 Ga0496112_0046560 Ga0496112_0046560_974_1597 184
439 3300050489 nmdc:mga03683_268689_c1 nmdc:mga03683_268689_c1_131_754 184
440 3300050493 nmdc:mga0k408_304190_c1 nmdc:mga0k408_304190_c1_236_859 184
441 3300050494 nmdc:mga06z11_147011_c1 nmdc:mga06z11_147011_c1_165_788 184
442 3300050495 nmdc:mga04h51_88355_c1 nmdc:mga04h51_88355_c1_241_864 184
443 3300050496 nmdc:mga07m45_268463_c1 nmdc:mga07m45_268463_c1_96_719 184
444 3300050515 nmdc:mga0a205_448022_c1 nmdc:mga0a205_448022_c1_47_670 184
445 3300053119 Ga0500595_009099 Ga0500595_009099_2593_3213 184

Feature Viewer

pLDDT pTM Quality
46.24 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map