F445420

General Info

Members Datasets Scaffolds Average Seq Length
445 259 890 160

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100495139|Ga0070689_1004951391
Length 192
Sequence VAGARSKATGTSGSEHRTGRKTQTRRAAASPAPVTPHFTHFDPAGQAHMVDIAGKDVTRRVARAGGRIVMLPATLALIRAGAASKGDVLAVARVAAIQAAKRTSELIPLCHPLPLTRVAVSFEPDSAASAILIEVTAETLGQTGVEMEALTAASVGLLTVYDMCKSVDRGMRIEGVRVLEKSGGKSGHFKAD

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
208 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
256 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0
Rhizoplane 6.29
Rhizosphere 88.54
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100495139 3300005340 Bacteria 1046
2 JGI25165J46597_1000089 3300003214 Bacteria 169547
3 Ga0065165_1002265 3300005262 Bacteria 16983
4 Ga0065165_1003370 3300005262 Bacteria 11331
5 Ga0065704_10141566 3300005289 Bacteria 1512
6 Ga0070658_10687324 3300005327 Bacteria 888
7 Ga0070676_10106290 3300005328 Bacteria 1741
8 Ga0070683_100005392 3300005329 Bacteria 10671
9 Ga0070683_100471952 3300005329 Bacteria 1198
10 Ga0070690_100301775 3300005330 Bacteria 1149
11 Ga0068869_100086790 3300005334 Bacteria 2346
12 Ga0070666_10289538 3300005335 Bacteria 1165
13 Ga0070680_100169771 3300005336 Bacteria 1835
14 Ga0070660_100034857 3300005339 Bacteria 3806
15 Ga0070689_100155829 3300005340 Bacteria 1844
16 Ga0070689_100212450 3300005340 Bacteria 1584
17 Ga0070668_100298289 3300005347 Bacteria 1351
18 Ga0070668_101321708 3300005347 Bacteria 656
19 Ga0070669_100008708 3300005353 Bacteria 7239
20 Ga0070675_100007399 3300005354 Bacteria 8481
21 Ga0070675_100309116 3300005354 Bacteria 1394
22 Ga0070675_100469811 3300005354 Bacteria 1130
23 Ga0070671_100000133 3300005355 Bacteria 47555
24 Ga0070671_100068795 3300005355 Bacteria 2953
25 Ga0070674_100008653 3300005356 Bacteria 6067
26 Ga0070673_100180116 3300005364 Bacteria 1809
27 Ga0070673_100206422 3300005364 Bacteria 1694
28 Ga0070659_100014527 3300005366 Bacteria 5884
29 Ga0070659_100052396 3300005366 Bacteria 3209
30 Ga0070659_100342385 3300005366 Bacteria 1253
31 Ga0070667_100062925 3300005367 Bacteria 3143
32 Ga0070667_100388812 3300005367 Bacteria 1268
33 Ga0070709_10184875 3300005434 Bacteria 1466
34 Ga0070709_11420603 3300005434 Bacteria 562
35 Ga0070714_100043415 3300005435 Bacteria 3802
36 Ga0070714_100078883 3300005435 Bacteria 2862
37 Ga0070713_100467379 3300005436 Bacteria 1187
38 Ga0070713_100851106 3300005436 Bacteria 876
39 Ga0070701_10075768 3300005438 Bacteria 1809
40 Ga0070701_10301415 3300005438 Bacteria 985
41 Ga0070711_100488805 3300005439 Bacteria 1013
42 Ga0070705_100056811 3300005440 Bacteria 2306
43 Ga0070705_100884990 3300005440 Bacteria 717
44 Ga0070694_100063127 3300005444 Bacteria 2532
45 Ga0070708_100385263 3300005445 Bacteria 1322
46 Ga0070708_101147012 3300005445 Bacteria 727
47 Ga0070678_100006084 3300005456 Bacteria 7043
48 Ga0070678_100803677 3300005456 Bacteria 854
49 Ga0070662_100053666 3300005457 Bacteria 2918
50 Ga0068867_100037767 3300005459 Bacteria 3512
51 Ga0068867_100185658 3300005459 Bacteria 1656
52 Ga0068867_100334836 3300005459 Bacteria 1258
53 Ga0068867_100486868 3300005459 Bacteria 1058
54 Ga0070707_100017616 3300005468 Bacteria 6719
55 Ga0070707_100058052 3300005468 Bacteria 3712
56 Ga0070707_100411345 3300005468 Bacteria 1313
57 Ga0070698_100022398 3300005471 Bacteria 6610
58 Ga0070698_100256520 3300005471 Bacteria 1681
59 Ga0070698_101817585 3300005471 Bacteria 562
60 Ga0070699_100086765 3300005518 Bacteria 2732
61 Ga0070699_100452035 3300005518 Bacteria 1165
62 Ga0070679_100078564 3300005530 Bacteria 3288
63 Ga0070679_101041239 3300005530 Bacteria 763
64 Ga0070697_100084586 3300005536 Bacteria 2616
65 Ga0070697_100153094 3300005536 Bacteria 1945
66 Ga0070697_100254595 3300005536 Bacteria 1502
67 Ga0068853_100317140 3300005539 Bacteria 1444
68 Ga0068853_100678194 3300005539 Bacteria 982
69 Ga0070672_100007079 3300005543 Bacteria 7587
70 Ga0070672_101367008 3300005543 Bacteria 633
71 Ga0070686_100346168 3300005544 Bacteria 1115
72 Ga0070695_100284087 3300005545 Bacteria 1217
73 Ga0070696_100050513 3300005546 Bacteria 2890
74 Ga0070696_100304744 3300005546 Bacteria 1221
75 Ga0070665_100032041 3300005548 Bacteria 5291
76 Ga0070665_100470098 3300005548 Bacteria 1268
77 Ga0070704_100119253 3300005549 Bacteria 2023
78 Ga0070704_100135207 3300005549 Bacteria 1917
79 Ga0070704_100148839 3300005549 Bacteria 1838
80 Ga0068855_100099567 3300005563 Bacteria 3348
81 Ga0068855_100496973 3300005563 Bacteria 1326
82 Ga0068855_101607742 3300005563 Bacteria 665
83 Ga0070664_100232044 3300005564 Bacteria 1654
84 Ga0068859_100000331 3300005617 Bacteria 47138
85 Ga0068859_100768487 3300005617 Bacteria 1052
86 Ga0068859_101784130 3300005617 Bacteria 680
87 Ga0068864_100000526 3300005618 Bacteria 33060
88 Ga0068861_100000810 3300005719 Bacteria 18885
89 Ga0068861_100034971 3300005719 Bacteria 3719
90 Ga0068861_100121588 3300005719 Bacteria 2107
91 Ga0068858_100000899 3300005842 Bacteria 30862
92 Ga0068858_101015436 3300005842 Bacteria 813
93 Ga0068860_100001586 3300005843 Bacteria 24468
94 Ga0068860_100060737 3300005843 Bacteria 3592
95 Ga0068862_100159263 3300005844 Bacteria 2014
96 Ga0070717_10034915 3300006028 Bacteria 4067
97 Ga0070717_10093317 3300006028 Bacteria 2544
98 Ga0070717_10396290 3300006028 Bacteria 1239
99 Ga0075432_10086450 3300006058 Bacteria 1143
100 Ga0070716_100816692 3300006173 Bacteria 723
101 Ga0075366_10252778 3300006195 Bacteria 1075
102 Ga0097621_100087480 3300006237 Bacteria 2602
103 Ga0075428_100001228 3300006844 Bacteria 27445
104 Ga0075430_100232329 3300006846 Bacteria 1529
105 Ga0075433_10094433 3300006852 Bacteria 2647
106 Ga0068865_100044104 3300006881 Bacteria 3051
107 Ga0075436_100004206 3300006914 Bacteria 9878
108 Ga0097620_100000331 3300006931 Bacteria 47138
109 Ga0097620_100768680 3300006931 Bacteria 1052
110 Ga0097620_101784147 3300006931 Bacteria 680
111 Ga0099794_10002139 3300007265 Bacteria 7186
112 Ga0099795_10183048 3300007788 Bacteria 876
113 Ga0111539_10001371 3300009094 Bacteria 32392
114 Ga0111539_10004914 3300009094 Bacteria 17396
115 Ga0111539_10029089 3300009094 Bacteria 6737
116 Ga0111539_10164407 3300009094 Bacteria 2596
117 Ga0105245_10016958 3300009098 Bacteria 6358
118 Ga0105245_10814762 3300009098 Bacteria 972
119 Ga0105247_10011765 3300009101 Bacteria 5262
120 Ga0114129_10005820 3300009147 Bacteria 17459
121 Ga0105243_10064756 3300009148 Bacteria 2934
122 Ga0105241_10907738 3300009174 Bacteria 818
123 Ga0105242_10499359 3300009176 Bacteria 1157
124 Ga0105237_10032311 3300009545 Bacteria 5299
125 Ga0105238_10035308 3300009551 Bacteria 5083
126 Ga0105249_10047977 3300009553 Bacteria 3894
127 Ga0099796_10002451 3300010159 Bacteria 4070
128 Ga0105239_10825941 3300010375 Bacteria 1062
129 Ga0105246_10152746 3300011119 Bacteria 1749
130 Ga0105246_10912903 3300011119 Bacteria 788
131 Ga0157373_10271169 3300013100 Bacteria 1201
132 Ga0157370_11065389 3300013104 Bacteria 731
133 Ga0157374_10078668 3300013296 Bacteria 3124
134 Ga0157374_11144519 3300013296 Bacteria 799
135 Ga0157374_11449296 3300013296 Bacteria 710
136 Ga0157378_10016975 3300013297 Bacteria 6383
137 Ga0157378_10049551 3300013297 Bacteria 3737
138 Ga0157378_10202284 3300013297 Bacteria 1879
139 Ga0157378_10609519 3300013297 Bacteria 1104
140 Ga0163162_10052369 3300013306 Bacteria 4099
141 Ga0163162_12456098 3300013306 Bacteria 599
142 Ga0157372_10017667 3300013307 Bacteria 7656
143 Ga0157372_10098898 3300013307 Bacteria 3328
144 Ga0157375_10069877 3300013308 Bacteria 3519
145 Ga0157375_10229592 3300013308 Bacteria 2015
146 Ga0163163_10448748 3300014325 Bacteria 1350
147 Ga0157380_10287329 3300014326 Bacteria 1508
148 Ga0157380_11099152 3300014326 Bacteria 834
149 Ga0157379_10000045 3300014968 Bacteria 75128
150 Ga0157376_10019973 3300014969 Bacteria 5174
151 Ga0206356_10678058 3300020070 Bacteria 1701
152 Ga0209563_123678 3300025230 Bacteria 650
153 Ga0209437_105170 3300025233 Bacteria 2237
154 Ga0209233_1000154 3300025261 Bacteria 169616
155 Ga0209257_1048418 3300025304 Bacteria 1216
156 Ga0207680_10236885 3300025903 Bacteria 1256
157 Ga0207647_10072255 3300025904 Bacteria 2081
158 Ga0207699_10644312 3300025906 Bacteria 773
159 Ga0207645_10113133 3300025907 Bacteria 1758
160 Ga0207705_10488635 3300025909 Bacteria 956
161 Ga0207705_10705759 3300025909 Bacteria 784
162 Ga0207707_10373762 3300025912 Bacteria 1226
163 Ga0207695_10528069 3300025913 Bacteria 1062
164 Ga0207671_10222140 3300025914 Bacteria 1480
165 Ga0207671_10474509 3300025914 Bacteria 997
166 Ga0207693_10109062 3300025915 Bacteria 2171
167 Ga0207663_10073645 3300025916 Bacteria 2211
168 Ga0207660_10195647 3300025917 Bacteria 1577
169 Ga0207660_10203712 3300025917 Bacteria 1546
170 Ga0207660_11159846 3300025917 Bacteria 629
171 Ga0207657_10009308 3300025919 Bacteria 9893
172 Ga0207657_10062317 3300025919 Bacteria 3194
173 Ga0207649_10248535 3300025920 Bacteria 1280
174 Ga0207652_11080485 3300025921 Bacteria 703
175 Ga0207646_10000622 3300025922 Bacteria 46121
176 Ga0207646_10000747 3300025922 Bacteria 42235
177 Ga0207646_10074095 3300025922 Bacteria 3041
178 Ga0207646_10328274 3300025922 Bacteria 1382
179 Ga0207646_10574179 3300025922 Bacteria 1013
180 Ga0207694_10018002 3300025924 Bacteria 5340
181 Ga0207687_10029708 3300025927 Bacteria 3678
182 Ga0207700_11251396 3300025928 Bacteria 662
183 Ga0207664_10079596 3300025929 Bacteria 2661
184 Ga0207664_10762932 3300025929 Bacteria 870
185 Ga0207644_10000256 3300025931 Bacteria 35858
186 Ga0207644_10115465 3300025931 Bacteria 2036
187 Ga0207706_10059300 3300025933 Bacteria 3370
188 Ga0207709_10078730 3300025935 Bacteria 2117
189 Ga0207670_10428071 3300025936 Bacteria 1063
190 Ga0207669_10012244 3300025937 Bacteria 4212
191 Ga0207669_10068049 3300025937 Bacteria 2222
192 Ga0207704_10892896 3300025938 Bacteria 747
193 Ga0207665_10603635 3300025939 Bacteria 857
194 Ga0207665_10649862 3300025939 Bacteria 827
195 Ga0207691_10040919 3300025940 Bacteria 4281
196 Ga0207689_10000030 3300025942 Bacteria 97584
197 Ga0207661_10175326 3300025944 Bacteria 1869
198 Ga0207667_10639232 3300025949 Bacteria 1070
199 Ga0207667_10808878 3300025949 Bacteria 933
200 Ga0207667_10831590 3300025949 Bacteria 918
201 Ga0207651_10004803 3300025960 Bacteria 6876
202 Ga0207651_10261449 3300025960 Bacteria 1421
203 Ga0207651_10605529 3300025960 Bacteria 958
204 Ga0207712_10507337 3300025961 Bacteria 1032
205 Ga0207668_10083623 3300025972 Bacteria 2323
206 Ga0207658_10040153 3300025986 Bacteria 3381
207 Ga0207658_10059915 3300025986 Bacteria 2838
208 Ga0207658_10911049 3300025986 Bacteria 801
209 Ga0207703_10000143 3300026035 Bacteria 84508
210 Ga0207639_11937069 3300026041 Bacteria 550
211 Ga0207708_10068143 3300026075 Bacteria 2723
212 Ga0207702_10068689 3300026078 Bacteria 3045
213 Ga0207648_10003770 3300026089 Bacteria 15837
214 Ga0207648_10137052 3300026089 Bacteria 2156
215 Ga0207648_10319025 3300026089 Bacteria 1396
216 Ga0207674_11021400 3300026116 Bacteria 796
217 Ga0207675_100055309 3300026118 Bacteria 3702
218 Ga0207675_100061286 3300026118 Bacteria 3512
219 Ga0207675_100147972 3300026118 Bacteria 2234
220 Ga0207683_10001875 3300026121 Bacteria 18598
221 Ga0207683_10015891 3300026121 Bacteria 6410
222 Ga0207683_11095274 3300026121 Bacteria 739
223 Ga0209969_1010547 3300027360 Bacteria 1323
224 Ga0209981_1016502 3300027378 Bacteria 1038
225 Ga0209968_1008123 3300027526 Bacteria 1598
226 Ga0209588_1006783 3300027671 Bacteria 3347
227 Ga0209966_1000212 3300027695 Bacteria 23266
228 Ga0209998_10055036 3300027717 Bacteria 928
229 Ga0207428_10003794 3300027907 Bacteria 14495
230 Ga0207428_10017603 3300027907 Bacteria 6127
231 Ga0207428_10036523 3300027907 Bacteria 4006
232 Ga0207428_10267503 3300027907 Bacteria 1272
233 Ga0268266_10010165 3300028379 Bacteria 8246
234 Ga0268265_10042494 3300028380 Bacteria 3374
235 Ga0268265_10097279 3300028380 Bacteria 2368
236 Ga0268264_10005383 3300028381 Bacteria 10836
237 Ga0265318_10033144 3300028577 Bacteria 1995
238 Ga0265318_10046918 3300028577 Bacteria 1630
239 Ga0265332_10355412 3300031238 Bacteria 605
240 Ga0265320_10000037 3300031240 Bacteria 135828
241 Ga0265320_10000648 3300031240 Bacteria 26566
242 Ga0307509_10293201 3300031507 Bacteria 1380
243 Ga0307408_100082465 3300031548 Unclassified 2407
244 Ga0307508_10001087 3300031616 Bacteria 31474
245 Ga0307416_100188751 3300032002 Bacteria 1941
246 Ga0307416_100545488 3300032002 Bacteria 1232
247 Ga0307414_10519758 3300032004 Unclassified 1056
248 Ga0307415_100140200 3300032126 Bacteria 1845
249 Ga0373955_0400626 3300035172 Bacteria 834
250 Ga0373931_0476949 3300035691 Bacteria 801
251 Ga0373937_0595448 3300036401 Bacteria 1050
252 Ga0395900_0000147 3300037418 Bacteria 118678
253 Ga0395900_0022227 3300037418 Bacteria 6488
254 Ga0395900_0036019 3300037418 Bacteria 5099
255 Ga0395900_0053187 3300037418 Bacteria 4168
256 Ga0395900_0799592 3300037418 Bacteria 871
257 Ga0395900_0912750 3300037418 Bacteria 801
258 Ga0395898_0001704 3300037466 Bacteria 29248
259 Ga0395898_0055623 3300037466 Bacteria 3859
260 Ga0395898_0058471 3300037466 Bacteria 3753
261 Ga0395898_0085965 3300037466 Bacteria 3031
262 Ga0395898_0465808 3300037466 Bacteria 1203
263 Ga0395905_0157956 3300037471 Bacteria 2132
264 Ga0395905_0166526 3300037471 Bacteria 2071
265 Ga0395905_1451849 3300037471 Bacteria 590
266 Ga0436364_0988617 3300037853 Bacteria 914
267 Ga0395901_0078608 3300038443 Bacteria 3444
268 Ga0395901_0127521 3300038443 Bacteria 2674
269 Ga0395901_0400112 3300038443 Bacteria 1411
270 Ga0395901_0765826 3300038443 Bacteria 957
271 Ga0436360_0337884 3300039438 Bacteria 633
272 Ga0451853_1288055 3300041512 Bacteria 1198
273 Ga0439441_048335 3300042001 Bacteria 870
274 Ga0439449_0018046 3300042007 Bacteria 2649
275 Ga0450923_121335 3300042125 Bacteria 617
276 Ga0451577_0006208 3300042876 Bacteria 11987
277 Ga0466969_0068935 3300044656 Bacteria 1704
278 Ga0466972_0146771 3300044658 Bacteria 1110
279 Ga0466965_0046254 3300044683 Bacteria 2154
280 Ga0466966_0020740 3300044684 Bacteria 4319
281 Ga0466966_0310644 3300044684 Bacteria 947
282 Ga0466961_0111094 3300044693 Bacteria 1724
283 Ga0466961_0259658 3300044693 Bacteria 1065
284 Ga0466963_0101549 3300044694 Bacteria 1969
285 Ga0453684_0000325 3300044712 Bacteria 200781
286 Ga0453684_0029011 3300044712 Bacteria 7872
287 Ga0453684_0029354 3300044712 Bacteria 7811
288 Ga0453684_0286427 3300044712 Bacteria 1877
289 Ga0466971_0024373 3300044719 Bacteria 2699
290 Ga0466971_0083084 3300044719 Bacteria 1462
291 Ga0466968_0219413 3300044735 Bacteria 895
292 Ga0466970_0260167 3300044765 Bacteria 973
293 Ga0466957_0022384 3300044842 Bacteria 3729
294 Ga0466957_0026396 3300044842 Bacteria 3446
295 Ga0466957_0297819 3300044842 Bacteria 1083
296 Ga0466960_0088095 3300044901 Bacteria 1577
297 Ga0466960_0155098 3300044901 Bacteria 1226
298 Ga0466960_0330536 3300044901 Bacteria 865
299 Ga0466959_0060828 3300045049 Bacteria 2747
300 Ga0466959_0170702 3300045049 Bacteria 1525
301 Ga0466959_0185950 3300045049 Bacteria 1451
302 Ga0451576_0374524 3300045051 Bacteria 1492
303 Ga0466958_0037711 3300045836 Bacteria 2896
304 Ga0466958_0043441 3300045836 Bacteria 2707
305 Ga0466967_0718449 3300045976 Bacteria 990
306 Ga0466967_0759895 3300045976 Bacteria 961
307 Ga0495618_0011013 3300046514 Bacteria 5481
308 Ga0495620_0199110 3300046515 Bacteria 771
309 Ga0495666_0364814 3300046526 Bacteria 650
310 Ga0495634_0489764 3300046642 Bacteria 722
311 Ga0495625_0000093 3300046660 Bacteria 145874
312 Ga0495625_0182092 3300046660 Bacteria 1396
313 Ga0495589_0251717 3300046794 Bacteria 825
314 Ga0495636_0006032 3300047318 Bacteria 4755
315 Ga0495686_0025154 3300047472 Bacteria 3904
316 Ga0496101_0228645 3300048904 Bacteria 1445
317 Ga0496101_0779720 3300048904 Bacteria 754
318 Ga0496102_0036175 3300048905 Bacteria 4447
319 Ga0496102_0583723 3300048905 Bacteria 1040
320 Ga0496103_0011962 3300048906 Bacteria 5154
321 Ga0496104_0103965 3300048907 Bacteria 2721
322 Ga0496104_0417413 3300048907 Bacteria 1254
323 Ga0496104_1268585 3300048907 Bacteria 640
324 Ga0496105_0054453 3300048908 Bacteria 3303
325 Ga0496105_0259649 3300048908 Bacteria 1405
326 Ga0496106_0171277 3300048909 Bacteria 1721
327 Ga0496106_0178486 3300048909 Bacteria 1685
328 Ga0496107_0013058 3300048910 Bacteria 5803
329 Ga0496107_0200143 3300048910 Bacteria 1485
330 Ga0496107_0552404 3300048910 Bacteria 853
331 Ga0496108_0113678 3300048911 Bacteria 2317
332 Ga0496108_0485529 3300048911 Bacteria 1079
333 Ga0496109_0162533 3300048912 Bacteria 2092
334 Ga0496109_0754738 3300048912 Bacteria 911
335 Ga0496109_0864504 3300048912 Bacteria 842
336 Ga0496112_0000635 3300048915 Bacteria 24368
337 Ga0496112_0001889 3300048915 Bacteria 16523
338 Ga0496112_0461947 3300048915 Bacteria 1207
339 Ga0496112_0514506 3300048915 Bacteria 1132
340 Ga0496114_0021520 3300048917 Bacteria 5247
341 Ga0496115_0006228 3300048918 Bacteria 8730
342 Ga0496115_0077399 3300048918 Bacteria 2705
343 Ga0496115_0902093 3300048918 Bacteria 681
344 Ga0496122_0096788 3300048925 Bacteria 1989
345 Ga0496123_0274542 3300048926 Bacteria 818
346 Ga0501290_023994 3300049513 Bacteria 848
347 Ga0501291_027354 3300049514 Bacteria 944
348 Ga0501031_0029651 3300049568 Bacteria 3569
349 Ga0501032_0323835 3300049569 Bacteria 994
350 Ga0501033_0163004 3300049570 Bacteria 1604
351 Ga0501033_0333098 3300049570 Bacteria 1065
352 Ga0501036_0121876 3300049572 Bacteria 2202
353 Ga0501036_0174215 3300049572 Bacteria 1812
354 Ga0501037_0101877 3300049573 Bacteria 2072
355 Ga0501038_0013344 3300049574 Bacteria 7492
356 Ga0501039_0114472 3300049575 Bacteria 2110
357 Ga0501039_0136235 3300049575 Bacteria 1928
358 Ga0501040_0053976 3300049576 Bacteria 2754
359 Ga0501040_0207213 3300049576 Bacteria 1393
360 Ga0501040_0763478 3300049576 Bacteria 699
361 Ga0501041_0055117 3300049577 Bacteria 2426
362 Ga0501041_0358530 3300049577 Bacteria 922
363 Ga0501042_0008484 3300049578 Bacteria 6786
364 Ga0501042_0161278 3300049578 Bacteria 1618
365 Ga0501043_0011611 3300049579 Bacteria 6896
366 Ga0501043_0623738 3300049579 Bacteria 794
367 Ga0501046_0122779 3300049580 Bacteria 1975
368 Ga0501047_0000954 3300049581 Bacteria 29310
369 Ga0501048_0016521 3300049582 Bacteria 5442
370 Ga0501067_0825874 3300049583 Bacteria 522
371 Ga0501070_0014542 3300049586 Bacteria 6622
372 Ga0501070_0257688 3300049586 Bacteria 1426
373 Ga0501071_0110043 3300049587 Bacteria 2035
374 Ga0501071_0300341 3300049587 Bacteria 1217
375 Ga0501071_0443966 3300049587 Unclassified 993
376 Ga0501071_0466207 3300049587 Bacteria 967
377 Ga0501072_0003411 3300049588 Bacteria 11969
378 Ga0501072_0038127 3300049588 Bacteria 3771
379 Ga0501072_0364700 3300049588 Bacteria 1147
380 Ga0501073_0488588 3300049589 Bacteria 851
381 Ga0501073_1091906 3300049589 Bacteria 548
382 Ga0501074_0008458 3300049590 Bacteria 7460
383 Ga0501074_0028280 3300049590 Bacteria 4063
384 Ga0501074_0113108 3300049590 Bacteria 1942
385 Ga0501074_0836224 3300049590 Bacteria 648
386 Ga0501075_0038206 3300049591 Bacteria 3588
387 Ga0501075_0588132 3300049591 Bacteria 849
388 Ga0501075_0775828 3300049591 Bacteria 729
389 Ga0501075_0887480 3300049591 Bacteria 678
390 Ga0501076_0079710 3300049592 Bacteria 2627
391 Ga0501076_0337149 3300049592 Bacteria 1237
392 Ga0501076_0644928 3300049592 Bacteria 874
393 Ga0501077_0002047 3300049593 Bacteria 12159
394 Ga0501077_0326138 3300049593 Bacteria 979
395 Ga0501207_049248 3300049654 Bacteria 749
396 Ga0501227_102873 3300049665 Bacteria 761
397 Ga0501259_049262 3300049688 Bacteria 851
398 Ga0501225_0056845 3300049705 Bacteria 1096
399 Ga0501079_0006283 3300049741 Bacteria 8910
400 Ga0501079_0009336 3300049741 Bacteria 7433
401 Ga0501079_0380299 3300049741 Bacteria 1107
402 Ga0501079_0406825 3300049741 Bacteria 1067
403 Ga0501079_0884533 3300049741 Bacteria 703
404 Ga0501080_0015795 3300049742 Bacteria 6964
405 Ga0501080_0422997 3300049742 Bacteria 1196
406 Ga0501080_1153736 3300049742 Bacteria 667
407 Ga0501080_1259144 3300049742 Bacteria 634
408 Ga0501080_1746682 3300049742 Bacteria 524
409 Ga0501081_0054588 3300049743 Bacteria 2760
410 Ga0501081_0683713 3300049743 Bacteria 770
411 Ga0501083_0002114 3300049744 Bacteria 13633
412 Ga0501083_0263542 3300049744 Bacteria 1121
413 Ga0501045_0052232 3300049824 Bacteria 2983
414 Ga0501045_0353763 3300049824 Bacteria 1093
415 nmdc:mga0k408_243094_c1 3300050493 Bacteria 1075
416 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
417 nmdc:mga0qj67_164621_c1 3300050509 Bacteria 1800
418 nmdc:mga06r32_714_c1 3300050510 Bacteria 29059
419 nmdc:mga08y16_14544_c1 3300050511 Bacteria 8277
420 nmdc:mga08y16_242306_c1 3300050511 Bacteria 1864
421 nmdc:mga08y16_57830_c2 3300050511 Bacteria 3652
422 nmdc:mga08y16_9030_c1 3300050511 Bacteria 10468
423 nmdc:mga08x19_11683_c1 3300050514 Bacteria 5288
424 Ga0495601_0238099 3300053077 Bacteria 1188
425 Ga0495655_0131051 3300053083 Bacteria 772
426 Ga0495619_0266316 3300053085 Bacteria 1187
427 Ga0500556_0009332 3300053104 Bacteria 2849
428 Ga0500562_010907 3300053108 Bacteria 2306
429 Ga0500595_003373 3300053119 Bacteria 7481
430 Ga0500559_0089456 3300053136 Bacteria 1408
431 Ga0500559_0094998 3300053136 Bacteria 1368
432 Ga0500616_0225634 3300053153 Bacteria 814
433 Ga0500599_006286 3300053736 Bacteria 1512
434 Ga0500601_040734 3300053737 Bacteria 565
435 Ga0501084_0070712 3300054114 Bacteria 2921
436 Ga0501084_0311160 3300054114 Bacteria 1330
437 Ga0501084_0648671 3300054114 Bacteria 891
438 Ga0501082_0000993 3300060353 Bacteria 25057
439 Ga0501082_0021013 3300060353 Bacteria 5630
440 Ga0501082_0055589 3300060353 Bacteria 3409
441 Ga0501082_0058164 3300060353 Bacteria 3331
442 Ga0501082_0162199 3300060353 Bacteria 1943
443 Ga0501082_0872620 3300060353 Bacteria 787
444 Ga0530510_0006641 3300061734 Bacteria 8068
445 Ga0530510_0057571 3300061734 Bacteria 2808
446 Ga0070689_100495139
447 JGI25165J46597_1000089
448 Ga0065165_1002265
449 Ga0065165_1003370
450 Ga0065704_10141566
451 Ga0070658_10687324
452 Ga0070676_10106290
453 Ga0070683_100005392
454 Ga0070683_100471952
455 Ga0070690_100301775
456 Ga0068869_100086790
457 Ga0070666_10289538
458 Ga0070680_100169771
459 Ga0070660_100034857
460 Ga0070689_100155829
461 Ga0070689_100212450
462 Ga0070668_100298289
463 Ga0070668_101321708
464 Ga0070669_100008708
465 Ga0070675_100007399
466 Ga0070675_100309116
467 Ga0070675_100469811
468 Ga0070671_100000133
469 Ga0070671_100068795
470 Ga0070674_100008653
471 Ga0070673_100180116
472 Ga0070673_100206422
473 Ga0070659_100014527
474 Ga0070659_100052396
475 Ga0070659_100342385
476 Ga0070667_100062925
477 Ga0070667_100388812
478 Ga0070709_10184875
479 Ga0070709_11420603
480 Ga0070714_100043415
481 Ga0070714_100078883
482 Ga0070713_100467379
483 Ga0070713_100851106
484 Ga0070701_10075768
485 Ga0070701_10301415
486 Ga0070711_100488805
487 Ga0070705_100056811
488 Ga0070705_100884990
489 Ga0070694_100063127
490 Ga0070708_100385263
491 Ga0070708_101147012
492 Ga0070678_100006084
493 Ga0070678_100803677
494 Ga0070662_100053666
495 Ga0068867_100037767
496 Ga0068867_100185658
497 Ga0068867_100334836
498 Ga0068867_100486868
499 Ga0070707_100017616
500 Ga0070707_100058052
501 Ga0070707_100411345
502 Ga0070698_100022398
503 Ga0070698_100256520
504 Ga0070698_101817585
505 Ga0070699_100086765
506 Ga0070699_100452035
507 Ga0070679_100078564
508 Ga0070679_101041239
509 Ga0070697_100084586
510 Ga0070697_100153094
511 Ga0070697_100254595
512 Ga0068853_100317140
513 Ga0068853_100678194
514 Ga0070672_100007079
515 Ga0070672_101367008
516 Ga0070686_100346168
517 Ga0070695_100284087
518 Ga0070696_100050513
519 Ga0070696_100304744
520 Ga0070665_100032041
521 Ga0070665_100470098
522 Ga0070704_100119253
523 Ga0070704_100135207
524 Ga0070704_100148839
525 Ga0068855_100099567
526 Ga0068855_100496973
527 Ga0068855_101607742
528 Ga0070664_100232044
529 Ga0068859_100000331
530 Ga0068859_100768487
531 Ga0068859_101784130
532 Ga0068864_100000526
533 Ga0068861_100000810
534 Ga0068861_100034971
535 Ga0068861_100121588
536 Ga0068858_100000899
537 Ga0068858_101015436
538 Ga0068860_100001586
539 Ga0068860_100060737
540 Ga0068862_100159263
541 Ga0070717_10034915
542 Ga0070717_10093317
543 Ga0070717_10396290
544 Ga0075432_10086450
545 Ga0070716_100816692
546 Ga0075366_10252778
547 Ga0097621_100087480
548 Ga0075428_100001228
549 Ga0075430_100232329
550 Ga0075433_10094433
551 Ga0068865_100044104
552 Ga0075436_100004206
553 Ga0097620_100000331
554 Ga0097620_100768680
555 Ga0097620_101784147
556 Ga0099794_10002139
557 Ga0099795_10183048
558 Ga0111539_10001371
559 Ga0111539_10004914
560 Ga0111539_10029089
561 Ga0111539_10164407
562 Ga0105245_10016958
563 Ga0105245_10814762
564 Ga0105247_10011765
565 Ga0114129_10005820
566 Ga0105243_10064756
567 Ga0105241_10907738
568 Ga0105242_10499359
569 Ga0105237_10032311
570 Ga0105238_10035308
571 Ga0105249_10047977
572 Ga0099796_10002451
573 Ga0105239_10825941
574 Ga0105246_10152746
575 Ga0105246_10912903
576 Ga0157373_10271169
577 Ga0157370_11065389
578 Ga0157374_10078668
579 Ga0157374_11144519
580 Ga0157374_11449296
581 Ga0157378_10016975
582 Ga0157378_10049551
583 Ga0157378_10202284
584 Ga0157378_10609519
585 Ga0163162_10052369
586 Ga0163162_12456098
587 Ga0157372_10017667
588 Ga0157372_10098898
589 Ga0157375_10069877
590 Ga0157375_10229592
591 Ga0163163_10448748
592 Ga0157380_10287329
593 Ga0157380_11099152
594 Ga0157379_10000045
595 Ga0157376_10019973
596 Ga0206356_10678058
597 Ga0209563_123678
598 Ga0209437_105170
599 Ga0209233_1000154
600 Ga0209257_1048418
601 Ga0207680_10236885
602 Ga0207647_10072255
603 Ga0207699_10644312
604 Ga0207645_10113133
605 Ga0207705_10488635
606 Ga0207705_10705759
607 Ga0207707_10373762
608 Ga0207695_10528069
609 Ga0207671_10222140
610 Ga0207671_10474509
611 Ga0207693_10109062
612 Ga0207663_10073645
613 Ga0207660_10195647
614 Ga0207660_10203712
615 Ga0207660_11159846
616 Ga0207657_10009308
617 Ga0207657_10062317
618 Ga0207649_10248535
619 Ga0207652_11080485
620 Ga0207646_10000622
621 Ga0207646_10000747
622 Ga0207646_10074095
623 Ga0207646_10328274
624 Ga0207646_10574179
625 Ga0207694_10018002
626 Ga0207687_10029708
627 Ga0207700_11251396
628 Ga0207664_10079596
629 Ga0207664_10762932
630 Ga0207644_10000256
631 Ga0207644_10115465
632 Ga0207706_10059300
633 Ga0207709_10078730
634 Ga0207670_10428071
635 Ga0207669_10012244
636 Ga0207669_10068049
637 Ga0207704_10892896
638 Ga0207665_10603635
639 Ga0207665_10649862
640 Ga0207691_10040919
641 Ga0207689_10000030
642 Ga0207661_10175326
643 Ga0207667_10639232
644 Ga0207667_10808878
645 Ga0207667_10831590
646 Ga0207651_10004803
647 Ga0207651_10261449
648 Ga0207651_10605529
649 Ga0207712_10507337
650 Ga0207668_10083623
651 Ga0207658_10040153
652 Ga0207658_10059915
653 Ga0207658_10911049
654 Ga0207703_10000143
655 Ga0207639_11937069
656 Ga0207708_10068143
657 Ga0207702_10068689
658 Ga0207648_10003770
659 Ga0207648_10137052
660 Ga0207648_10319025
661 Ga0207674_11021400
662 Ga0207675_100055309
663 Ga0207675_100061286
664 Ga0207675_100147972
665 Ga0207683_10001875
666 Ga0207683_10015891
667 Ga0207683_11095274
668 Ga0209969_1010547
669 Ga0209981_1016502
670 Ga0209968_1008123
671 Ga0209588_1006783
672 Ga0209966_1000212
673 Ga0209998_10055036
674 Ga0207428_10003794
675 Ga0207428_10017603
676 Ga0207428_10036523
677 Ga0207428_10267503
678 Ga0268266_10010165
679 Ga0268265_10042494
680 Ga0268265_10097279
681 Ga0268264_10005383
682 Ga0265318_10033144
683 Ga0265318_10046918
684 Ga0265332_10355412
685 Ga0265320_10000037
686 Ga0265320_10000648
687 Ga0307509_10293201
688 Ga0307408_100082465
689 Ga0307508_10001087
690 Ga0307416_100188751
691 Ga0307416_100545488
692 Ga0307414_10519758
693 Ga0307415_100140200
694 Ga0373955_0400626
695 Ga0373931_0476949
696 Ga0373937_0595448
697 Ga0395900_0000147
698 Ga0395900_0022227
699 Ga0395900_0036019
700 Ga0395900_0053187
701 Ga0395900_0799592
702 Ga0395900_0912750
703 Ga0395898_0001704
704 Ga0395898_0055623
705 Ga0395898_0058471
706 Ga0395898_0085965
707 Ga0395898_0465808
708 Ga0395905_0157956
709 Ga0395905_0166526
710 Ga0395905_1451849
711 Ga0436364_0988617
712 Ga0395901_0078608
713 Ga0395901_0127521
714 Ga0395901_0400112
715 Ga0395901_0765826
716 Ga0436360_0337884
717 Ga0451853_1288055
718 Ga0439441_048335
719 Ga0439449_0018046
720 Ga0450923_121335
721 Ga0451577_0006208
722 Ga0466969_0068935
723 Ga0466972_0146771
724 Ga0466965_0046254
725 Ga0466966_0020740
726 Ga0466966_0310644
727 Ga0466961_0111094
728 Ga0466961_0259658
729 Ga0466963_0101549
730 Ga0453684_0000325
731 Ga0453684_0029011
732 Ga0453684_0029354
733 Ga0453684_0286427
734 Ga0466971_0024373
735 Ga0466971_0083084
736 Ga0466968_0219413
737 Ga0466970_0260167
738 Ga0466957_0022384
739 Ga0466957_0026396
740 Ga0466957_0297819
741 Ga0466960_0088095
742 Ga0466960_0155098
743 Ga0466960_0330536
744 Ga0466959_0060828
745 Ga0466959_0170702
746 Ga0466959_0185950
747 Ga0451576_0374524
748 Ga0466958_0037711
749 Ga0466958_0043441
750 Ga0466967_0718449
751 Ga0466967_0759895
752 Ga0495618_0011013
753 Ga0495620_0199110
754 Ga0495666_0364814
755 Ga0495634_0489764
756 Ga0495625_0000093
757 Ga0495625_0182092
758 Ga0495589_0251717
759 Ga0495636_0006032
760 Ga0495686_0025154
761 Ga0496101_0228645
762 Ga0496101_0779720
763 Ga0496102_0036175
764 Ga0496102_0583723
765 Ga0496103_0011962
766 Ga0496104_0103965
767 Ga0496104_0417413
768 Ga0496104_1268585
769 Ga0496105_0054453
770 Ga0496105_0259649
771 Ga0496106_0171277
772 Ga0496106_0178486
773 Ga0496107_0013058
774 Ga0496107_0200143
775 Ga0496107_0552404
776 Ga0496108_0113678
777 Ga0496108_0485529
778 Ga0496109_0162533
779 Ga0496109_0754738
780 Ga0496109_0864504
781 Ga0496112_0000635
782 Ga0496112_0001889
783 Ga0496112_0461947
784 Ga0496112_0514506
785 Ga0496114_0021520
786 Ga0496115_0006228
787 Ga0496115_0077399
788 Ga0496115_0902093
789 Ga0496122_0096788
790 Ga0496123_0274542
791 Ga0501290_023994
792 Ga0501291_027354
793 Ga0501031_0029651
794 Ga0501032_0323835
795 Ga0501033_0163004
796 Ga0501033_0333098
797 Ga0501036_0121876
798 Ga0501036_0174215
799 Ga0501037_0101877
800 Ga0501038_0013344
801 Ga0501039_0114472
802 Ga0501039_0136235
803 Ga0501040_0053976
804 Ga0501040_0207213
805 Ga0501040_0763478
806 Ga0501041_0055117
807 Ga0501041_0358530
808 Ga0501042_0008484
809 Ga0501042_0161278
810 Ga0501043_0011611
811 Ga0501043_0623738
812 Ga0501046_0122779
813 Ga0501047_0000954
814 Ga0501048_0016521
815 Ga0501067_0825874
816 Ga0501070_0014542
817 Ga0501070_0257688
818 Ga0501071_0110043
819 Ga0501071_0300341
820 Ga0501071_0443966
821 Ga0501071_0466207
822 Ga0501072_0003411
823 Ga0501072_0038127
824 Ga0501072_0364700
825 Ga0501073_0488588
826 Ga0501073_1091906
827 Ga0501074_0008458
828 Ga0501074_0028280
829 Ga0501074_0113108
830 Ga0501074_0836224
831 Ga0501075_0038206
832 Ga0501075_0588132
833 Ga0501075_0775828
834 Ga0501075_0887480
835 Ga0501076_0079710
836 Ga0501076_0337149
837 Ga0501076_0644928
838 Ga0501077_0002047
839 Ga0501077_0326138
840 Ga0501207_049248
841 Ga0501227_102873
842 Ga0501259_049262
843 Ga0501225_0056845
844 Ga0501079_0006283
845 Ga0501079_0009336
846 Ga0501079_0380299
847 Ga0501079_0406825
848 Ga0501079_0884533
849 Ga0501080_0015795
850 Ga0501080_0422997
851 Ga0501080_1153736
852 Ga0501080_1259144
853 Ga0501080_1746682
854 Ga0501081_0054588
855 Ga0501081_0683713
856 Ga0501083_0002114
857 Ga0501083_0263542
858 Ga0501045_0052232
859 Ga0501045_0353763
860 nmdc:mga0k408_243094_c1
861 nmdc:mga05p37_14_c1
862 nmdc:mga0qj67_164621_c1
863 nmdc:mga06r32_714_c1
864 nmdc:mga08y16_14544_c1
865 nmdc:mga08y16_242306_c1
866 nmdc:mga08y16_57830_c2
867 nmdc:mga08y16_9030_c1
868 nmdc:mga08x19_11683_c1
869 Ga0495601_0238099
870 Ga0495655_0131051
871 Ga0495619_0266316
872 Ga0500556_0009332
873 Ga0500562_010907
874 Ga0500595_003373
875 Ga0500559_0089456
876 Ga0500559_0094998
877 Ga0500616_0225634
878 Ga0500599_006286
879 Ga0500601_040734
880 Ga0501084_0070712
881 Ga0501084_0311160
882 Ga0501084_0648671
883 Ga0501082_0000993
884 Ga0501082_0021013
885 Ga0501082_0055589
886 Ga0501082_0058164
887 Ga0501082_0162199
888 Ga0501082_0872620
889 Ga0530510_0006641
890 Ga0530510_0057571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

49

184

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ohd-assembly1.cif.gz_D crystal structure of hypothetical molybdenum cofactor biosynthesis protein c from sulfolobus tokodaii 0.9864 13 143
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9805 11 145
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9746 12 155
2ekn-assembly1.cif.gz_A structure of ph1811 protein from pyrococcus horikoshii 0.9703 15 146
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9676 12 155
ID Description Score Start End Superfamily
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9805 11 145 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9797 4 156 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9749 13 143 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9682 2 156 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9621 3 156 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A0C9N681-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9977 15 155 GO:0006777
GO:0061799
AF-A0A4Q2XSH4-F1-model_v4 deleted 0.9977 27 155
AF-A0A2E5ZGQ7-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9943 15 157 GO:0006777
GO:0061799
AF-A0A7V9C274-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9943 15 146 GO:0006777
GO:0061799
AF-A0A2V8TUX9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9933 15 156 GO:0006777
GO:0061799

Map