F445362

General Info

Members Datasets Scaffolds Average Seq Length
444 353 308 275

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0184812|Ga0501067_0184812_311_1147
Length 268
Sequence MSDRDRKPPFRRGGGKPFEKGRKFARPTGRRDRDPSPDGPVILYGWHTVSAALANPERRIRKLFLTENAARRLADENIDTRVPQEIVRPSVIDQRLGPDAVHQGMLAEADPLPSPDIDTLPQQGIVLVLDQITDPHNVGAIFRSAAQRHSPETTGVLAKAASGAIEHVPLFTVQNLARALTALKANGFLTVGLDSEADETLEDVPLAAPLALVLGAEGKGLRQLTKETCDHLARLDLPGRIRSLNVSNAAALALHVASSRLKALSAGR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
7 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
19 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
20 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
21 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
22 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
23 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
24 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
25 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
26 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
27 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
28 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
29 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
30 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
31 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
32 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
33 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
34 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
35 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
36 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
37 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
42 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
43 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
44 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
45 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
46 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
47 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
48 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
49 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
50 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
51 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
52 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
53 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
54 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
55 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
56 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
57 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
58 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
59 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
60 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
61 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
62 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
63 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
64 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
65 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
66 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
67 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
68 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
69 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
70 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
71 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
72 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
73 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
74 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
75 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
76 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
77 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
78 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
79 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
80 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
81 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
82 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
83 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
84 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
85 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
86 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
87 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
88 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
89 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
90 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
91 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
92 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
93 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
94 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
95 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
96 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
97 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
98 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
99 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
100 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
101 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
102 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
103 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
104 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
105 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
106 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
107 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
108 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
109 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
110 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
111 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
112 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
114 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
115 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
116 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
117 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
118 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
122 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
123 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
124 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
125 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
126 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
127 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
128 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
129 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
130 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
131 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
132 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
133 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
134 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
135 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
136 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
137 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
140 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
141 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
142 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
143 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
144 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
145 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
146 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
149 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
150 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
151 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
152 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
153 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
154 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
155 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
156 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
157 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
158 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
168 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
169 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
170 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
176 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
177 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
224 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
225 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
226 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
231 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
232 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
311 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
312 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
313 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
314 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
315 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
316 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
317 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
318 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
319 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
323 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
324 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
325 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
326 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
329 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
330 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
331 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
332 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
333 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
334 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
335 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
336 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
337 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
338 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
339 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
340 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
341 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
342 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
343 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
344 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
345 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
346 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
347 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
348 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
349 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
350 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
351 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
352 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
353 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.37
Metatranscriptomes 0
Isolates 30.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.94
Nodule 21.85
Rhizoplane 6.76
Rhizosphere 45.72
Stem 0
Stem Tuber 0
Unclassified 13.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003139 3300003203 Bacteria 7765
2 JGI25165J46597_1010078 3300003214 Bacteria 1389
3 JGI25153J46596_10015198 3300003215 Bacteria 3152
4 JGI25160J50197_1019530 3300003354 Bacteria 2074
5 JGI25404J52841_10021870 3300003659 Bacteria 1384
6 Ga0055524_1043920 3300003775 Bacteria 1093
7 Ga0055531_10002011 3300003794 Bacteria 14106
8 Ga0065165_1001189 3300005262 Bacteria 30080
9 Ga0065165_1004749 3300005262 Bacteria 8129
10 Ga0065165_1031067 3300005262 Bacteria 1693
11 Ga0070658_10248227 3300005327 Bacteria 1509
12 Ga0070683_100041172 3300005329 Bacteria 4248
13 Ga0070680_100557192 3300005336 Bacteria 983
14 Ga0070682_100044435 3300005337 Bacteria 2750
15 Ga0068868_100275161 3300005338 Bacteria 1423
16 Ga0070689_100340327 3300005340 Bacteria 1256
17 Ga0070668_100356360 3300005347 Bacteria 1239
18 Ga0070675_100115572 3300005354 Bacteria 2275
19 Ga0070667_100465722 3300005367 Bacteria 1156
20 Ga0070714_100023019 3300005435 Bacteria 5113
21 Ga0070714_100026055 3300005435 Bacteria 4830
22 Ga0070714_100415008 3300005435 Bacteria 1274
23 Ga0070713_100125156 3300005436 Bacteria 2259
24 Ga0070713_100138870 3300005436 Bacteria 2150
25 Ga0070713_100391363 3300005436 Bacteria 1297
26 Ga0070713_100474037 3300005436 Bacteria 1178
27 Ga0070710_10002421 3300005437 Bacteria 8849
28 Ga0070711_100051562 3300005439 Bacteria 2826
29 Ga0070663_100112732 3300005455 Bacteria 2045
30 Ga0070663_100166924 3300005455 Bacteria 1699
31 Ga0070678_100034011 3300005456 Bacteria 3545
32 Ga0070681_10051892 3300005458 Bacteria 4090
33 Ga0070681_10108044 3300005458 Bacteria 2723
34 Ga0070706_100055652 3300005467 Bacteria 3651
35 Ga0070684_100223866 3300005535 Bacteria 1716
36 Ga0068855_100044798 3300005563 Bacteria 5234
37 Ga0070664_100262691 3300005564 Bacteria 1553
38 Ga0068857_100006741 3300005577 Bacteria 9875
39 Ga0068854_100052633 3300005578 Bacteria 2920
40 Ga0068856_100351092 3300005614 Bacteria 1493
41 Ga0068859_100140831 3300005617 Bacteria 2486
42 Ga0068859_100562127 3300005617 Bacteria 1235
43 Ga0068864_100100691 3300005618 Bacteria 2562
44 Ga0068864_100508473 3300005618 Bacteria 1160
45 Ga0068866_10201355 3300005718 Bacteria 1190
46 Ga0068851_10140392 3300005834 Bacteria 1313
47 Ga0068863_100097362 3300005841 Bacteria 2794
48 Ga0081455_10004854 3300005937 Bacteria 14919
49 Ga0081455_10177204 3300005937 Bacteria 1617
50 Ga0081540_1000001 3300005983 Bacteria 293507
51 Ga0081540_1000795 3300005983 Bacteria 28960
52 Ga0081540_1018464 3300005983 Bacteria 4276
53 Ga0081540_1034345 3300005983 Bacteria 2738
54 Ga0081540_1057199 3300005983 Bacteria 1888
55 Ga0081539_10000203 3300005985 Bacteria 138096
56 Ga0070717_10156082 3300006028 Bacteria 1977
57 Ga0070717_10187151 3300006028 Bacteria 1807
58 Ga0070717_10225151 3300006028 Bacteria 1650
59 Ga0070717_10537966 3300006028 Bacteria 1058
60 Ga0075364_10034521 3300006051 Bacteria 3264
61 Ga0075364_10213587 3300006051 Bacteria 1308
62 Ga0070715_10004167 3300006163 Bacteria 4704
63 Ga0070715_10093162 3300006163 Bacteria 1390
64 Ga0070716_100038932 3300006173 Bacteria 2635
65 Ga0070716_100181623 3300006173 Bacteria 1382
66 Ga0075369_10100985 3300006186 Bacteria 1294
67 Ga0097620_100140825 3300006931 Bacteria 2486
68 Ga0097620_100562067 3300006931 Bacteria 1235
69 Ga0099794_10012862 3300007265 Bacteria 3627
70 Ga0099795_10066574 3300007788 Bacteria 1349
71 Ga0105240_10007334 3300009093 Bacteria 16044
72 Ga0105240_10197740 3300009093 Bacteria 2358
73 Ga0111539_10211071 3300009094 Bacteria 2262
74 Ga0105245_10399980 3300009098 Bacteria 1372
75 Ga0105243_10843223 3300009148 Bacteria 907
76 Ga0105241_10003633 3300009174 Bacteria 11461
77 Ga0105241_10058026 3300009174 Bacteria 2971
78 Ga0105238_10039058 3300009551 Bacteria 4816
79 Ga0105238_10044210 3300009551 Bacteria 4504
80 Ga0105239_10025595 3300010375 Bacteria 6497
81 Ga0105239_10081175 3300010375 Bacteria 3569
82 Ga0105239_10172465 3300010375 Bacteria 2419
83 Ga0105239_10267889 3300010375 Bacteria 1921
84 Ga0105239_10531813 3300010375 Bacteria 1338
85 Ga0105246_10030558 3300011119 Bacteria 3559
86 Ga0105246_10380822 3300011119 Bacteria 1166
87 Ga0157370_10089973 3300013104 Bacteria 2882
88 Ga0157370_10106313 3300013104 Bacteria 2626
89 Ga0157369_10026662 3300013105 Bacteria 6408
90 Ga0157369_10375463 3300013105 Bacteria 1476
91 Ga0157374_10168957 3300013296 Bacteria 2132
92 Ga0157374_10418691 3300013296 Bacteria 1338
93 Ga0157378_10003497 3300013297 Bacteria 13946
94 Ga0157378_10275739 3300013297 Bacteria 1619
95 Ga0157378_10543239 3300013297 Bacteria 1166
96 Ga0157375_10107998 3300013308 Bacteria 2877
97 Ga0157375_10439486 3300013308 Bacteria 1470
98 Ga0163163_10011860 3300014325 Bacteria 7924
99 Ga0157380_10430235 3300014326 Bacteria 1261
100 Ga0157379_10111231 3300014968 Bacteria 2460
101 Ga0213872_10183723 3300021361 Bacteria 902
102 Ga0213871_10044473 3300021441 Bacteria 1200
103 Ga0209563_101769 3300025230 Bacteria 5429
104 Ga0209677_100763 3300025253 Bacteria 16325
105 Ga0209677_103510 3300025253 Bacteria 5028
106 Ga0209148_1017765 3300025254 Bacteria 1203
107 Ga0209233_1006176 3300025261 Bacteria 3882
108 Ga0209233_1021287 3300025261 Bacteria 1682
109 Ga0209455_1004351 3300025272 Bacteria 4674
110 Ga0209455_1026086 3300025272 Bacteria 1053
111 Ga0209758_1000065 3300025297 Bacteria 306288
112 Ga0209758_1000189 3300025297 Bacteria 138296
113 Ga0209256_1007790 3300025299 Bacteria 5164
114 Ga0207426_1004361 3300025302 Bacteria 6949
115 Ga0209051_1042513 3300025303 Bacteria 1605
116 Ga0209257_1000678 3300025304 Bacteria 52929
117 Ga0207656_10014975 3300025321 Bacteria 2997
118 Ga0207647_10277797 3300025904 Bacteria 956
119 Ga0207685_10082682 3300025905 Bacteria 1333
120 Ga0207699_10090494 3300025906 Bacteria 1920
121 Ga0207699_10116078 3300025906 Bacteria 1723
122 Ga0207699_10255072 3300025906 Bacteria 1210
123 Ga0207705_10131164 3300025909 Bacteria 1865
124 Ga0207654_10010654 3300025911 Bacteria 4683
125 Ga0207707_10588309 3300025912 Bacteria 943
126 Ga0207695_10108866 3300025913 Bacteria 2754
127 Ga0207671_10339265 3300025914 Bacteria 1191
128 Ga0207693_10060211 3300025915 Bacteria 2974
129 Ga0207693_10070383 3300025915 Bacteria 2737
130 Ga0207693_10226491 3300025915 Bacteria 1468
131 Ga0207663_10031743 3300025916 Bacteria 3129
132 Ga0207663_10256443 3300025916 Bacteria 1289
133 Ga0207660_10060068 3300025917 Bacteria 2731
134 Ga0207657_10289624 3300025919 Bacteria 1299
135 Ga0207649_10027899 3300025920 Bacteria 3319
136 Ga0207652_10117415 3300025921 Bacteria 2364
137 Ga0207646_10039113 3300025922 Bacteria 4268
138 Ga0207694_10000271 3300025924 Bacteria 49284
139 Ga0207694_10156875 3300025924 Bacteria 1836
140 Ga0207694_10183474 3300025924 Bacteria 1698
141 Ga0207659_10288011 3300025926 Bacteria 1345
142 Ga0207700_10039513 3300025928 Bacteria 3436
143 Ga0207664_10031273 3300025929 Bacteria 4071
144 Ga0207665_10018212 3300025939 Bacteria 4615
145 Ga0207665_10142372 3300025939 Bacteria 1711
146 Ga0207691_10066651 3300025940 Bacteria 3257
147 Ga0207689_10221700 3300025942 Bacteria 1562
148 Ga0207661_10087102 3300025944 Bacteria 2593
149 Ga0207679_10570595 3300025945 Bacteria 1017
150 Ga0207667_10719919 3300025949 Bacteria 999
151 Ga0207668_10221265 3300025972 Bacteria 1520
152 Ga0207640_10112291 3300025981 Bacteria 1934
153 Ga0207658_10356508 3300025986 Bacteria 1275
154 Ga0207639_10551502 3300026041 Bacteria 1058
155 Ga0207678_10017888 3300026067 Bacteria 6226
156 Ga0207702_10000005 3300026078 Bacteria 420296
157 Ga0207676_10200659 3300026095 Bacteria 1762
158 Ga0207674_10014792 3300026116 Bacteria 8606
159 Ga0207683_10069544 3300026121 Bacteria 3109
160 Ga0207683_10069914 3300026121 Bacteria 3101
161 Ga0207683_10607780 3300026121 Bacteria 1012
162 Ga0207698_10101722 3300026142 Bacteria 2384
163 Ga0209589_1000009 3300027357 Bacteria 252104
164 Ga0209489_100010 3300027361 Bacteria 252139
165 Ga0209700_100017 3300027363 Bacteria 252104
166 Ga0209588_1025407 3300027671 Bacteria 1875
167 Ga0268266_10042804 3300028379 Bacteria 3869
168 Ga0265336_10000261 3300028666 Bacteria 37381
169 Ga0265338_10000090 3300028800 Bacteria 171540
170 Ga0265324_10024546 3300029957 Bacteria 2140
171 Ga0307512_10171017 3300030522 Bacteria 1246
172 Ga0265330_10037977 3300031235 Bacteria 2141
173 Ga0265320_10121095 3300031240 Bacteria 1193
174 Ga0265340_10003349 3300031247 Bacteria 9074
175 Ga0265340_10082012 3300031247 Bacteria 1517
176 Ga0265339_10067530 3300031249 Bacteria 1912
177 Ga0265316_10492873 3300031344 Bacteria 876
178 Ga0307508_10193384 3300031616 Bacteria 1636
179 Ga0265314_10150585 3300031711 Bacteria 1427
180 Ga0265314_10219397 3300031711 Bacteria 1111
181 Ga0307406_10388509 3300031901 Bacteria 1103
182 Ga0307510_10004439 3300033180 Bacteria 16505
183 Ga0307510_10007284 3300033180 Bacteria 13179
184 Ga0373928_0030773 3300035084 Bacteria 1188
185 Ga0373940_0018472 3300035088 Bacteria 1750
186 Ga0373962_0023746 3300035242 Bacteria 1635
187 Ga0373931_0001012 3300035691 Bacteria 11890
188 Ga0373931_0130211 3300035691 Bacteria 1447
189 Ga0373935_0052819 3300035692 Bacteria 2585
190 Ga0373927_0129639 3300035695 Bacteria 1647
191 Ga0373927_0188124 3300035695 Bacteria 1354
192 Ga0373925_0038572 3300037068 Bacteria 3532
193 Ga0373925_0325204 3300037068 Bacteria 1245
194 Ga0395899_0226489 3300037312 Bacteria 1293
195 Ga0395900_0006086 3300037418 Bacteria 12582
196 Ga0395900_0063349 3300037418 Bacteria 3801
197 Ga0395898_0055379 3300037466 Bacteria 3868
198 Ga0395898_0098015 3300037466 Bacteria 2815
199 Ga0395898_0157499 3300037466 Bacteria 2172
200 Ga0395905_0389402 3300037471 Bacteria 1288
201 Ga0436364_1146339 3300037853 Bacteria 2737
202 Ga0395901_0055465 3300038443 Bacteria 4121
203 Ga0395901_0184047 3300038443 Bacteria 2191
204 Ga0436365_0048281 3300039437 Bacteria 1224
205 Ga0436365_0108376 3300039437 Bacteria 7153
206 Ga0436365_0162157 3300039437 Bacteria 1538
207 Ga0436365_0949599 3300039437 Bacteria 4110
208 Ga0436360_0126917 3300039438 Bacteria 1413
209 Ga0436360_1210671 3300039438 Bacteria 1560
210 Ga0436361_0737018 3300039447 Bacteria 1208
211 Ga0436363_1584368 3300039450 Bacteria 3049
212 Ga0466972_0003457 3300044658 Bacteria 7838
213 Ga0466972_0063720 3300044658 Bacteria 1765
214 Ga0495638_0083509 3300046460 Bacteria 1934
215 Ga0495580_0180103 3300046472 Bacteria 1459
216 Ga0495606_0205106 3300046507 Bacteria 1121
217 Ga0495644_0093970 3300046523 Bacteria 1132
218 Ga0495666_0082903 3300046526 Bacteria 1516
219 Ga0495621_0070953 3300046539 Bacteria 1283
220 Ga0495656_0023523 3300046615 Bacteria 2425
221 Ga0495659_0008537 3300046664 Bacteria 3261
222 Ga0495588_0002162 3300046674 Bacteria 8409
223 Ga0495658_0006572 3300046683 Bacteria 5711
224 Ga0495669_0118439 3300046684 Bacteria 1240
225 Ga0495670_0174746 3300046691 Bacteria 1132
226 Ga0496100_0061178 3300048903 Bacteria 2481
227 Ga0496100_0140476 3300048903 Bacteria 1711
228 Ga0496101_0010676 3300048904 Bacteria 6069
229 Ga0496103_0124197 3300048906 Bacteria 1645
230 Ga0496103_0287853 3300048906 Bacteria 1057
231 Ga0496104_0008545 3300048907 Bacteria 9103
232 Ga0496104_0036708 3300048907 Bacteria 4582
233 Ga0496104_0039170 3300048907 Bacteria 4436
234 Ga0496105_0010156 3300048908 Bacteria 7396
235 Ga0496106_0040954 3300048909 Bacteria 3470
236 Ga0496106_0111101 3300048909 Bacteria 2134
237 Ga0496106_0256764 3300048909 Bacteria 1398
238 Ga0496106_0268537 3300048909 Bacteria 1366
239 Ga0496107_0007996 3300048910 Bacteria 7299
240 Ga0496107_0010588 3300048910 Bacteria 6412
241 Ga0496108_0008829 3300048911 Bacteria 8170
242 Ga0496108_0018643 3300048911 Bacteria 5686
243 Ga0496108_0040814 3300048911 Bacteria 3871
244 Ga0496109_0076769 3300048912 Bacteria 3073
245 Ga0496109_0530296 3300048912 Bacteria 1111
246 Ga0496110_0001582 3300048913 Bacteria 16633
247 Ga0496110_0073000 3300048913 Bacteria 3045
248 Ga0496110_0457384 3300048913 Bacteria 1163
249 Ga0496111_0100228 3300048914 Bacteria 2127
250 Ga0496112_0022246 3300048915 Bacteria 6040
251 Ga0496112_0125057 3300048915 Bacteria 2542
252 Ga0496112_0152962 3300048915 Bacteria 2274
253 Ga0496112_0755174 3300048915 Bacteria 899
254 Ga0496114_0196109 3300048917 Bacteria 1767
255 Ga0496115_0337927 3300048918 Bacteria 1229
256 Ga0496117_0049399 3300048920 Bacteria 2993
257 Ga0496118_0031241 3300048921 Bacteria 4420
258 Ga0496119_0103735 3300048922 Bacteria 1592
259 Ga0496120_0073367 3300048923 Bacteria 1873
260 Ga0496121_0000330 3300048924 Bacteria 98687
261 Ga0496121_0080199 3300048924 Bacteria 2588
262 Ga0496125_0048821 3300048928 Bacteria 3524
263 Ga0496126_0012658 3300048929 Bacteria 8631
264 Ga0496126_0026823 3300048929 Bacteria 5515
265 Ga0496126_0232365 3300048929 Bacteria 1544
266 Ga0501038_0063459 3300049574 Bacteria 3152
267 Ga0501039_0339016 3300049575 Bacteria 1181
268 Ga0501047_0051864 3300049581 Bacteria 3965
269 Ga0501067_0184812 3300049583 Bacteria 1161
270 Ga0501072_0314629 3300049588 Bacteria 1244
271 Ga0501035_0126303 3300049822 Bacteria 2233
272 Ga0501044_0348517 3300049823 Bacteria 1401
273 Ga0501044_0423015 3300049823 Bacteria 1242
274 nmdc:mga03n38_72128_c1 3300050490 Bacteria 1600
275 nmdc:mga0yw44_413025_c1 3300050492 Bacteria 913
276 nmdc:mga0k408_122918_c1 3300050493 Bacteria 1538
277 nmdc:mga05p37_8282_c1 3300050507 Bacteria 12293
278 nmdc:mga06r32_262517_c1 3300050510 Bacteria 1714
279 nmdc:mga08y16_249542_c1 3300050511 Bacteria 1834
280 nmdc:mga0a205_27978_c2 3300050515 Bacteria 3432
281 Ga0495601_0177560 3300053077 Bacteria 1392
282 Ga0495612_0054455 3300053078 Bacteria 1648
283 Ga0495595_0133642 3300053084 Bacteria 1214
284 Ga0500643_000040 3300053087 Bacteria 168108
285 Ga0500640_014491 3300053095 Bacteria 3283
286 Ga0500650_0083614 3300053098 Bacteria 1493
287 Ga0500555_002376 3300053103 Bacteria 5471
288 Ga0500562_007246 3300053108 Bacteria 2799
289 Ga0500572_001341 3300053111 Bacteria 6819
290 Ga0500572_001386 3300053111 Bacteria 6679
291 Ga0500595_001587 3300053119 Bacteria 11999
292 Ga0500595_003033 3300053119 Bacteria 7977
293 Ga0500614_007232 3300053123 Bacteria 2338
294 Ga0500655_024294 3300053133 Bacteria 1147
295 Ga0500559_0000519 3300053136 Bacteria 27027
296 Ga0500603_002051 3300053150 Bacteria 4450
297 Ga0500616_0004401 3300053153 Bacteria 10059
298 Ga0500622_0075833 3300053156 Bacteria 1691
299 Ga0500627_0002435 3300053158 Bacteria 5517
300 Ga0500630_006388 3300053159 Bacteria 5767
301 Ga0500634_0051367 3300053161 Bacteria 2218
302 Ga0500639_000595 3300053163 Bacteria 18171
303 Ga0500639_049461 3300053163 Bacteria 2193
304 Ga0500639_141500 3300053163 Bacteria 1124
305 Ga0500637_0031601 3300053178 Bacteria 2950
306 Ga0500645_064629 3300053730 Bacteria 1055
307 Ga0500596_000686 3300053735 Bacteria 6591
308 Ga0500596_003414 3300053735 Bacteria 3024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025261 Ga0209233_1006176 Ga0209233_10061762 243
2 3300025272 Ga0209455_1004351 Ga0209455_10043513 243
3 3300039437 Ga0436365_0949599 Ga0436365_0949599_3276_4079 244
4 3300039450 Ga0436363_1584368 Ga0436363_1584368_1490_2293 244
5 3300006028 Ga0070717_10537966 Ga0070717_105379662 245
6 3300025915 Ga0207693_10226491 Ga0207693_102264911 245
7 3300039438 Ga0436360_0126917 Ga0436360_0126917_396_1190 245
8 3300005467 Ga0070706_100055652 Ga0070706_1000556525 247
9 3300039437 Ga0436365_0108376 Ga0436365_0108376_5557_6381 249
10 3300031240 Ga0265320_10121095 Ga0265320_101210952 250
11 3300031247 Ga0265340_10082012 Ga0265340_100820122 250
12 3300039437 Ga0436365_0162157 Ga0436365_0162157_637_1461 250
13 3300046526 Ga0495666_0082903 Ga0495666_0082903_184_1002 250
14 3300046683 Ga0495658_0006572 Ga0495658_0006572_3687_4505 250
15 3300053087 Ga0500643_000040 Ga0500643_000040_138368_139198 250
16 3300053098 Ga0500650_0083614 Ga0500650_0083614_128_958 250
17 3300053103 Ga0500555_002376 Ga0500555_002376_4492_5322 250
18 3300053158 Ga0500627_0002435 Ga0500627_0002435_2706_3536 250
19 3300053161 Ga0500634_0051367 Ga0500634_0051367_292_1122 250
20 3300005841 Ga0068863_100097362 Ga0068863_1000973622 251
21 3300013297 Ga0157378_10275739 Ga0157378_102757392 251
22 3300035691 Ga0373931_0130211 Ga0373931_0130211_493_1335 251
23 3300048907 Ga0496104_0036708 Ga0496104_0036708_1562_2404 251
24 3300048909 Ga0496106_0111101 Ga0496106_0111101_282_1124 251
25 3300049583 Ga0501067_0184812 Ga0501067_0184812_311_1147 251
26 3300003215 JGI25153J46596_10015198 JGI25153J46596_100151985 252
27 3300003354 JGI25160J50197_1019530 JGI25160J50197_10195301 252
28 3300003775 Ga0055524_1043920 Ga0055524_10439201 252
29 3300003794 Ga0055531_10002011 Ga0055531_1000201120 252
30 3300005262 Ga0065165_1004749 Ga0065165_100474914 252
31 3300005262 Ga0065165_1031067 Ga0065165_10310672 252
32 3300025297 Ga0209758_1000065 Ga0209758_1000065269 252
33 3300025299 Ga0209256_1007790 Ga0209256_10077902 252
34 3300025302 Ga0207426_1004361 Ga0207426_10043616 252
35 3300025303 Ga0209051_1042513 Ga0209051_10425132 252
36 3300025304 Ga0209257_1000678 Ga0209257_100067885 252
37 3300025912 Ga0207707_10588309 Ga0207707_105883091 252
38 3300031344 Ga0265316_10492873 Ga0265316_104928731 252
39 3300037068 Ga0373925_0038572 Ga0373925_0038572_2297_3124 252
40 3300035695 Ga0373927_0129639 Ga0373927_0129639_646_1467 253
41 3300037853 Ga0436364_1146339 Ga0436364_1146339_999_1847 253
42 3300049823 Ga0501044_0348517 Ga0501044_0348517_38_901 253
43 3300031235 Ga0265330_10037977 Ga0265330_100379773 254
44 3300031711 Ga0265314_10219397 Ga0265314_102193971 254
45 3300050507 nmdc:mga05p37_8282_c1 nmdc:mga05p37_8282_c1_2252_3085 254
46 3300049574 Ga0501038_0063459 Ga0501038_0063459_247_1098 255
47 3300049575 Ga0501039_0339016 Ga0501039_0339016_205_1056 255
48 3300049588 Ga0501072_0314629 Ga0501072_0314629_20_883 255
49 3300005354 Ga0070675_100115572 Ga0070675_1001155722 256
50 3300005436 Ga0070713_100138870 Ga0070713_1001388702 256
51 3300006028 Ga0070717_10156082 Ga0070717_101560823 256
52 3300013104 Ga0157370_10106313 Ga0157370_101063132 256
53 3300025905 Ga0207685_10082682 Ga0207685_100826822 256
54 3300025906 Ga0207699_10090494 Ga0207699_100904943 256
55 3300025924 Ga0207694_10156875 Ga0207694_101568752 256
56 3300025926 Ga0207659_10288011 Ga0207659_102880113 256
57 3300048903 Ga0496100_0061178 Ga0496100_0061178_1350_2165 256
58 3300048909 Ga0496106_0268537 Ga0496106_0268537_192_1007 256
59 iso_pu_bacteria 2513237137 2513861665 256
60 iso_pu_bacteria 2517572143 2517893646 256
61 iso_pu_bacteria 2906660503 2906666028 256
62 iso_pu_bacteria 2935630451 2935635607 256
63 iso_pu_bacteria 2941507105 2941509256 256
64 iso_pu_bacteria 2941515067 2941517085 256
65 iso_pu_bacteria 2941523033 2941524820 256
66 iso_pu_bacteria 8019555841 8019558161 256
67 iso_pu_bacteria 8019565922 8019567133 256
68 3300009148 Ga0105243_10843223 Ga0105243_108432231 257
69 3300037466 Ga0395898_0157499 Ga0395898_0157499_1019_1840 257
70 3300038443 Ga0395901_0055465 Ga0395901_0055465_580_1401 257
71 3300049822 Ga0501035_0126303 Ga0501035_0126303_1378_2196 257
72 3300049823 Ga0501044_0423015 Ga0501044_0423015_331_1149 257
73 iso_pu_bacteria 2513237101 2513695988 257
74 iso_pu_bacteria 2513237161 2514011390 257
75 iso_pu_bacteria 2517093001 2517103431 257
76 iso_pu_bacteria 2802429603 2805917518 257
77 iso_pu_bacteria 2824671348 2824677122 257
78 iso_pu_bacteria 2824687955 2824693886 257
79 iso_pu_bacteria 2824696289 2824697017 257
80 iso_pu_bacteria 2824704595 2824707558 257
81 iso_pu_bacteria 2824753945 2824760164 257
82 iso_pu_bacteria 2824763712 2824764813 257
83 iso_pu_bacteria 2824773399 2824774125 257
84 iso_pu_bacteria 2838122688 2838127705 257
85 iso_pu_bacteria 2841941048 2841941347 257
86 iso_pu_bacteria 2841949485 2841952645 257
87 iso_pu_bacteria 2841957949 2841959676 257
88 iso_pu_bacteria 2841966195 2841967482 257
89 iso_pu_bacteria 2841974524 2841979121 257
90 iso_pu_bacteria 2841983080 2841986664 257
91 iso_pu_bacteria 2847939898 2847945302 257
92 iso_pu_bacteria 2874604998 2874610820 257
93 iso_pu_bacteria 2874612657 2874618390 257
94 iso_pu_bacteria 2904690495 2904694399 257
95 iso_pu_bacteria 2904711408 2904718277 257
96 iso_pu_bacteria 2922361189 2922362028 257
97 iso_pu_bacteria 8006964411 8006964598 257
98 iso_pu_bacteria 8006994254 8007001078 257
99 iso_pu_bacteria 8056689827 8056696072 257
100 3300005340 Ga0070689_100340327 Ga0070689_1003403272 258
101 3300005367 Ga0070667_100465722 Ga0070667_1004657222 258
102 3300005617 Ga0068859_100562127 Ga0068859_1005621272 258
103 3300005937 Ga0081455_10177204 Ga0081455_101772042 258
104 3300005983 Ga0081540_1000001 Ga0081540_1000001126 258
105 3300006028 Ga0070717_10187151 Ga0070717_101871512 258
106 3300006931 Ga0097620_100562067 Ga0097620_1005620672 258
107 3300009094 Ga0111539_10211071 Ga0111539_102110713 258
108 3300013296 Ga0157374_10418691 Ga0157374_104186912 258
109 3300014325 Ga0163163_10011860 Ga0163163_1001186013 258
110 3300014968 Ga0157379_10111231 Ga0157379_101112314 258
111 3300025916 Ga0207663_10256443 Ga0207663_102564432 258
112 3300025986 Ga0207658_10356508 Ga0207658_103565082 258
113 3300048906 Ga0496103_0287853 Ga0496103_0287853_170_997 258
114 3300048909 Ga0496106_0256764 Ga0496106_0256764_117_944 258
115 3300048911 Ga0496108_0040814 Ga0496108_0040814_2722_3549 258
116 3300049581 Ga0501047_0051864 Ga0501047_0051864_2174_3013 258
117 3300050510 nmdc:mga06r32_262517_c1 nmdc:mga06r32_262517_c1_268_1107 258
118 3300050511 nmdc:mga08y16_249542_c1 nmdc:mga08y16_249542_c1_449_1288 258
119 3300050515 nmdc:mga0a205_27978_c2 nmdc:mga0a205_27978_c2_2118_2957 258
120 3300053084 Ga0495595_0133642 Ga0495595_0133642_96_923 258
121 iso_pu_bacteria 2507262055 2507509861 258
122 iso_pu_bacteria 2508501009 2508543872 258
123 iso_pu_bacteria 2508501042 2508698194 258
124 iso_pu_bacteria 2511231028 2511397975 258
125 iso_pu_bacteria 2513237102 2513706788 258
126 iso_pu_bacteria 2513237104 2513720888 258
127 iso_pu_bacteria 2515154112 2515630989 258
128 iso_pu_bacteria 2524023205 2524441585 258
129 iso_pu_bacteria 2617270735 2617349390 258
130 iso_pu_bacteria 2617270741 2617378095 258
131 iso_pu_bacteria 2744054633 2745074651 258
132 iso_pu_bacteria 2791355196 2793060159 258
133 iso_pu_bacteria 2824600985 2824602034 258
134 iso_pu_bacteria 2824609381 2824610022 258
135 iso_pu_bacteria 2824617872 2824620182 258
136 iso_pu_bacteria 2824626560 2824627607 258
137 iso_pu_bacteria 2824635225 2824639417 258
138 iso_pu_bacteria 2824644064 2824646525 258
139 iso_pu_bacteria 2824653114 2824654878 258
140 iso_pu_bacteria 2824679649 2824682463 258
141 iso_pu_bacteria 2824714736 2824722457 258
142 iso_pu_bacteria 2824723954 2824726987 258
143 iso_pu_bacteria 2824732956 2824733634 258
144 iso_pu_bacteria 2824746037 2824747358 258
145 iso_pu_bacteria 2842038055 2842038537 258
146 iso_pu_bacteria 2842045827 2842048518 258
147 iso_pu_bacteria 2844315083 2844317893 258
148 iso_pu_bacteria 2847930680 2847934682 258
149 iso_pu_bacteria 2857509624 2857510138 258
150 iso_pu_bacteria 2874590934 2874596478 258
151 iso_pu_bacteria 2874620515 2874621782 258
152 iso_pu_bacteria 2874645413 2874653291 258
153 iso_pu_bacteria 2876771140 2876777225 258
154 iso_pu_bacteria 2876818435 2876825025 258
155 iso_pu_bacteria 2879074833 2879081363 258
156 iso_pu_bacteria 2879083081 2879088117 258
157 iso_pu_bacteria 2879127579 2879131989 258
158 iso_pu_bacteria 2879142872 2879149023 258
159 iso_pu_bacteria 2881364244 2881366061 258
160 iso_pu_bacteria 2885366525 2885372673 258
161 iso_pu_bacteria 2885409591 2885409748 258
162 iso_pu_bacteria 2888388044 2888395046 258
163 iso_pu_bacteria 2888419890 2888423215 258
164 iso_pu_bacteria 2903727486 2903729771 258
165 iso_pu_bacteria 2904666416 2904668501 258
166 iso_pu_bacteria 2906602504 2906608615 258
167 iso_pu_bacteria 2906643746 2906644138 258
168 iso_pu_bacteria 2908775508 2908778862 258
169 iso_pu_bacteria 2922393267 2922395140 258
170 iso_pu_bacteria 2932801729 2932804638 258
171 iso_pu_bacteria 2935608549 2935611283 258
172 iso_pu_bacteria 2935648319 2935648666 258
173 iso_pu_bacteria 2935656913 2935657346 258
174 iso_pu_bacteria 2935777560 2935779409 258
175 iso_pu_bacteria 2935785616 2935791019 258
176 iso_pu_bacteria 2935793552 2935800103 258
177 iso_pu_bacteria 2935819856 2935820760 258
178 iso_pu_bacteria 2935847175 2935850980 258
179 iso_pu_bacteria 2935883170 2935885131 258
180 iso_pu_bacteria 2935908558 2935913656 258
181 iso_pu_bacteria 2935916978 2935920369 258
182 iso_pu_bacteria 2935926038 2935930721 258
183 iso_pu_bacteria 2935934488 2935939307 258
184 iso_pu_bacteria 2935942939 2935946255 258
185 iso_pu_bacteria 2935951376 2935955905 258
186 iso_pu_bacteria 2935959822 2935963518 258
187 iso_pu_bacteria 2935967501 2935972385 258
188 iso_pu_bacteria 2935975950 2935978968 258
189 iso_pu_bacteria 2935984226 2935989734 258
190 iso_pu_bacteria 2936011229 2936011576 258
191 iso_pu_bacteria 2936019824 2936020171 258
192 iso_pu_bacteria 2936028420 2936028767 258
193 iso_pu_bacteria 2936046547 2936046894 258
194 iso_pu_bacteria 2936055302 2936058221 258
195 iso_pu_bacteria 2941531003 2941536186 258
196 iso_pu_bacteria 3005483717 3005488091 258
197 iso_pu_bacteria 3005587118 3005590551 258
198 iso_pu_bacteria 3005710791 3005713681 258
199 iso_pu_bacteria 3005718088 3005721068 258
200 iso_pu_bacteria 8016522445 8016530904 258
201 iso_pu_bacteria 8016530956 8016536196 258
202 iso_pu_bacteria 8016539877 8016540482 258
203 iso_pu_bacteria 8016548790 8016552762 258
204 iso_pu_bacteria 8016557553 8016561142 258
205 iso_pu_bacteria 8016575299 8016578640 258
206 iso_pu_bacteria 8016583857 8016591065 258
207 iso_pu_bacteria 8016595262 8016598999 258
208 iso_pu_bacteria 8016603502 8016612073 258
209 iso_pu_bacteria 8016613128 8016621734 258
210 iso_pu_bacteria 8016622563 8016628144 258
211 iso_pu_bacteria 8016630954 8016632420 258
212 iso_pu_bacteria 8019530166 8019535921 258
213 iso_pu_bacteria 8019538911 8019543546 258
214 iso_pu_bacteria 8019619141 8019626712 258
215 iso_pu_bacteria 8019638758 8019643858 258
216 iso_pu_bacteria 8019659431 8019663569 258
217 iso_pu_bacteria 8019668869 8019673197 258
218 iso_pu_bacteria 8019678201 8019682932 258
219 iso_pu_bacteria 8019687851 8019688633 258
220 3300005455 Ga0070663_100112732 Ga0070663_1001127324 259
221 3300005458 Ga0070681_10108044 Ga0070681_101080442 259
222 3300005563 Ga0068855_100044798 Ga0068855_1000447983 259
223 3300005577 Ga0068857_100006741 Ga0068857_1000067411 259
224 3300005578 Ga0068854_100052633 Ga0068854_1000526333 259
225 3300005834 Ga0068851_10140392 Ga0068851_101403921 259
226 3300007788 Ga0099795_10066574 Ga0099795_100665741 259
227 3300009093 Ga0105240_10007334 Ga0105240_1000733417 259
228 3300009174 Ga0105241_10003633 Ga0105241_1000363316 259
229 3300009551 Ga0105238_10039058 Ga0105238_100390583 259
230 3300013104 Ga0157370_10089973 Ga0157370_100899733 259
231 3300025321 Ga0207656_10014975 Ga0207656_100149754 259
232 3300025911 Ga0207654_10010654 Ga0207654_100106546 259
233 3300025913 Ga0207695_10108866 Ga0207695_101088663 259
234 3300025914 Ga0207671_10339265 Ga0207671_103392651 259
235 3300025924 Ga0207694_10000271 Ga0207694_1000027118 259
236 3300025949 Ga0207667_10719919 Ga0207667_107199192 259
237 3300025981 Ga0207640_10112291 Ga0207640_101122912 259
238 3300026078 Ga0207702_10000005 Ga0207702_10000005236 259
239 3300026116 Ga0207674_10014792 Ga0207674_1001479213 259
240 3300005327 Ga0070658_10248227 Ga0070658_102482272 260
241 3300005336 Ga0070680_100557192 Ga0070680_1005571922 260
242 3300025253 Ga0209677_100763 Ga0209677_10076316 260
243 3300025272 Ga0209455_1026086 Ga0209455_10260861 260
244 3300025904 Ga0207647_10277797 Ga0207647_102777971 260
245 3300025909 Ga0207705_10131164 Ga0207705_101311643 260
246 3300025917 Ga0207660_10060068 Ga0207660_100600682 260
247 3300025921 Ga0207652_10117415 Ga0207652_101174153 260
248 3300027357 Ga0209589_1000009 Ga0209589_1000009115 260
249 3300027361 Ga0209489_100010 Ga0209489_100010155 260
250 3300027363 Ga0209700_100017 Ga0209700_100017155 260
251 3300037418 Ga0395900_0063349 Ga0395900_0063349_2667_3491 260
252 3300037466 Ga0395898_0098015 Ga0395898_0098015_481_1305 260
253 3300046472 Ga0495580_0180103 Ga0495580_0180103_64_882 260
254 3300046523 Ga0495644_0093970 Ga0495644_0093970_257_1084 260
255 3300046539 Ga0495621_0070953 Ga0495621_0070953_70_897 260
256 3300046615 Ga0495656_0023523 Ga0495656_0023523_275_1102 260
257 3300046664 Ga0495659_0008537 Ga0495659_0008537_670_1497 260
258 3300046674 Ga0495588_0002162 Ga0495588_0002162_6032_6859 260
259 3300046691 Ga0495670_0174746 Ga0495670_0174746_281_1108 260
260 3300048920 Ga0496117_0049399 Ga0496117_0049399_2139_2966 260
261 3300048922 Ga0496119_0103735 Ga0496119_0103735_23_850 260
262 3300048924 Ga0496121_0080199 Ga0496121_0080199_1309_2136 260
263 3300048929 Ga0496126_0026823 Ga0496126_0026823_2939_3766 260
264 3300048929 Ga0496126_0232365 Ga0496126_0232365_545_1369 260
265 3300053119 Ga0500595_003033 Ga0500595_003033_1519_2346 260
266 3300005329 Ga0070683_100041172 Ga0070683_1000411723 261
267 3300005338 Ga0068868_100275161 Ga0068868_1002751612 261
268 3300005347 Ga0070668_100356360 Ga0070668_1003563601 261
269 3300005435 Ga0070714_100023019 Ga0070714_1000230197 261
270 3300005435 Ga0070714_100026055 Ga0070714_1000260555 261
271 3300005435 Ga0070714_100415008 Ga0070714_1004150082 261
272 3300005436 Ga0070713_100125156 Ga0070713_1001251563 261
273 3300005436 Ga0070713_100391363 Ga0070713_1003913631 261
274 3300005436 Ga0070713_100474037 Ga0070713_1004740371 261
275 3300005437 Ga0070710_10002421 Ga0070710_100024217 261
276 3300005439 Ga0070711_100051562 Ga0070711_1000515622 261
277 3300005455 Ga0070663_100166924 Ga0070663_1001669243 261
278 3300005456 Ga0070678_100034011 Ga0070678_1000340112 261
279 3300005458 Ga0070681_10051892 Ga0070681_100518925 261
280 3300005535 Ga0070684_100223866 Ga0070684_1002238662 261
281 3300005564 Ga0070664_100262691 Ga0070664_1002626913 261
282 3300005618 Ga0068864_100100691 Ga0068864_1001006914 261
283 3300005618 Ga0068864_100508473 Ga0068864_1005084732 261
284 3300005718 Ga0068866_10201355 Ga0068866_102013552 261
285 3300005983 Ga0081540_1034345 Ga0081540_10343454 261
286 3300006028 Ga0070717_10225151 Ga0070717_102251511 261
287 3300006163 Ga0070715_10004167 Ga0070715_100041674 261
288 3300006163 Ga0070715_10093162 Ga0070715_100931621 261
289 3300006173 Ga0070716_100038932 Ga0070716_1000389323 261
290 3300006173 Ga0070716_100181623 Ga0070716_1001816231 261
291 3300007265 Ga0099794_10012862 Ga0099794_100128625 261
292 3300009098 Ga0105245_10399980 Ga0105245_103999802 261
293 3300009174 Ga0105241_10058026 Ga0105241_100580265 261
294 3300009551 Ga0105238_10044210 Ga0105238_100442107 261
295 3300010375 Ga0105239_10081175 Ga0105239_100811757 261
296 3300010375 Ga0105239_10172465 Ga0105239_101724652 261
297 3300011119 Ga0105246_10030558 Ga0105246_100305584 261
298 3300011119 Ga0105246_10380822 Ga0105246_103808221 261
299 3300013105 Ga0157369_10026662 Ga0157369_100266622 261
300 3300013296 Ga0157374_10168957 Ga0157374_101689573 261
301 3300013297 Ga0157378_10003497 Ga0157378_100034973 261
302 3300013308 Ga0157375_10107998 Ga0157375_101079984 261
303 3300013308 Ga0157375_10439486 Ga0157375_104394862 261
304 3300014326 Ga0157380_10430235 Ga0157380_104302352 261
305 3300021361 Ga0213872_10183723 Ga0213872_101837231 261
306 3300021441 Ga0213871_10044473 Ga0213871_100444731 261
307 3300025254 Ga0209148_1017765 Ga0209148_10177652 261
308 3300025261 Ga0209233_1021287 Ga0209233_10212872 261
309 3300025906 Ga0207699_10116078 Ga0207699_101160782 261
310 3300025906 Ga0207699_10255072 Ga0207699_102550722 261
311 3300025915 Ga0207693_10060211 Ga0207693_100602113 261
312 3300025915 Ga0207693_10070383 Ga0207693_100703831 261
313 3300025916 Ga0207663_10031743 Ga0207663_100317433 261
314 3300025920 Ga0207649_10027899 Ga0207649_100278994 261
315 3300025922 Ga0207646_10039113 Ga0207646_100391135 261
316 3300025924 Ga0207694_10183474 Ga0207694_101834743 261
317 3300025929 Ga0207664_10031273 Ga0207664_100312736 261
318 3300025939 Ga0207665_10018212 Ga0207665_100182125 261
319 3300025939 Ga0207665_10142372 Ga0207665_101423721 261
320 3300025940 Ga0207691_10066651 Ga0207691_100666511 261
321 3300025942 Ga0207689_10221700 Ga0207689_102217001 261
322 3300025944 Ga0207661_10087102 Ga0207661_100871022 261
323 3300025945 Ga0207679_10570595 Ga0207679_105705951 261
324 3300025972 Ga0207668_10221265 Ga0207668_102212651 261
325 3300026067 Ga0207678_10017888 Ga0207678_100178881 261
326 3300026095 Ga0207676_10200659 Ga0207676_102006592 261
327 3300026121 Ga0207683_10069544 Ga0207683_100695442 261
328 3300026121 Ga0207683_10069914 Ga0207683_100699142 261
329 3300026121 Ga0207683_10607780 Ga0207683_106077801 261
330 3300026142 Ga0207698_10101722 Ga0207698_101017222 261
331 3300027671 Ga0209588_1025407 Ga0209588_10254071 261
332 3300030522 Ga0307512_10171017 Ga0307512_101710172 261
333 3300031247 Ga0265340_10003349 Ga0265340_100033493 261
334 3300031249 Ga0265339_10067530 Ga0265339_100675302 261
335 3300031616 Ga0307508_10193384 Ga0307508_101933843 261
336 3300031901 Ga0307406_10388509 Ga0307406_103885091 261
337 3300033180 Ga0307510_10007284 Ga0307510_1000728414 261
338 3300035084 Ga0373928_0030773 Ga0373928_0030773_85_912 261
339 3300035088 Ga0373940_0018472 Ga0373940_0018472_177_1004 261
340 3300035242 Ga0373962_0023746 Ga0373962_0023746_83_910 261
341 3300035691 Ga0373931_0001012 Ga0373931_0001012_6506_7333 261
342 3300035692 Ga0373935_0052819 Ga0373935_0052819_328_1155 261
343 3300035695 Ga0373927_0188124 Ga0373927_0188124_104_931 261
344 3300037068 Ga0373925_0325204 Ga0373925_0325204_158_985 261
345 3300037471 Ga0395905_0389402 Ga0395905_0389402_293_1120 261
346 3300039437 Ga0436365_0048281 Ga0436365_0048281_316_1143 261
347 3300039438 Ga0436360_1210671 Ga0436360_1210671_453_1295 261
348 3300039447 Ga0436361_0737018 Ga0436361_0737018_161_997 261
349 3300044658 Ga0466972_0063720 Ga0466972_0063720_33_860 261
350 3300046507 Ga0495606_0205106 Ga0495606_0205106_191_1018 261
351 3300046684 Ga0495669_0118439 Ga0495669_0118439_192_1019 261
352 3300048903 Ga0496100_0140476 Ga0496100_0140476_290_1117 261
353 3300048904 Ga0496101_0010676 Ga0496101_0010676_948_1775 261
354 3300048906 Ga0496103_0124197 Ga0496103_0124197_525_1352 261
355 3300048907 Ga0496104_0008545 Ga0496104_0008545_694_1521 261
356 3300048907 Ga0496104_0039170 Ga0496104_0039170_865_1692 261
357 3300048908 Ga0496105_0010156 Ga0496105_0010156_1770_2597 261
358 3300048909 Ga0496106_0040954 Ga0496106_0040954_267_1094 261
359 3300048910 Ga0496107_0007996 Ga0496107_0007996_4097_4924 261
360 3300048910 Ga0496107_0010588 Ga0496107_0010588_104_931 261
361 3300048911 Ga0496108_0008829 Ga0496108_0008829_4052_4879 261
362 3300048911 Ga0496108_0018643 Ga0496108_0018643_4528_5355 261
363 3300048912 Ga0496109_0076769 Ga0496109_0076769_219_1046 261
364 3300048912 Ga0496109_0530296 Ga0496109_0530296_264_1091 261
365 3300048913 Ga0496110_0001582 Ga0496110_0001582_302_1129 261
366 3300048913 Ga0496110_0073000 Ga0496110_0073000_54_881 261
367 3300048913 Ga0496110_0457384 Ga0496110_0457384_42_869 261
368 3300048914 Ga0496111_0100228 Ga0496111_0100228_396_1223 261
369 3300048915 Ga0496112_0022246 Ga0496112_0022246_521_1348 261
370 3300048915 Ga0496112_0152962 Ga0496112_0152962_887_1714 261
371 3300048917 Ga0496114_0196109 Ga0496114_0196109_604_1431 261
372 3300048918 Ga0496115_0337927 Ga0496115_0337927_326_1153 261
373 3300048924 Ga0496121_0000330 Ga0496121_0000330_13157_13984 261
374 3300050490 nmdc:mga03n38_72128_c1 nmdc:mga03n38_72128_c1_720_1547 261
375 3300050492 nmdc:mga0yw44_413025_c1 nmdc:mga0yw44_413025_c1_39_866 261
376 3300053077 Ga0495601_0177560 Ga0495601_0177560_173_997 261
377 3300053078 Ga0495612_0054455 Ga0495612_0054455_281_1105 261
378 3300053095 Ga0500640_014491 Ga0500640_014491_773_1627 261
379 3300053111 Ga0500572_001341 Ga0500572_001341_825_1652 261
380 3300053111 Ga0500572_001386 Ga0500572_001386_5065_5919 261
381 3300053119 Ga0500595_001587 Ga0500595_001587_7848_8675 261
382 3300053123 Ga0500614_007232 Ga0500614_007232_202_1056 261
383 3300053136 Ga0500559_0000519 Ga0500559_0000519_23847_24674 261
384 3300053150 Ga0500603_002051 Ga0500603_002051_3411_4265 261
385 3300053159 Ga0500630_006388 Ga0500630_006388_4504_5358 261
386 3300053163 Ga0500639_000595 Ga0500639_000595_5637_6491 261
387 3300053163 Ga0500639_049461 Ga0500639_049461_232_1059 261
388 3300053178 Ga0500637_0031601 Ga0500637_0031601_1971_2828 261
389 3300053735 Ga0500596_000686 Ga0500596_000686_3414_4268 261
390 3300053735 Ga0500596_003414 Ga0500596_003414_1483_2310 261
391 3300003203 JGI25406J46586_10003139 JGI25406J46586_100031397 262
392 3300003214 JGI25165J46597_1010078 JGI25165J46597_10100781 262
393 3300003659 JGI25404J52841_10021870 JGI25404J52841_100218702 262
394 3300005262 Ga0065165_1001189 Ga0065165_100118926 262
395 3300005337 Ga0070682_100044435 Ga0070682_1000444353 262
396 3300005614 Ga0068856_100351092 Ga0068856_1003510921 262
397 3300005617 Ga0068859_100140831 Ga0068859_1001408312 262
398 3300005937 Ga0081455_10004854 Ga0081455_1000485415 262
399 3300005983 Ga0081540_1000795 Ga0081540_100079523 262
400 3300005983 Ga0081540_1018464 Ga0081540_10184644 262
401 3300005983 Ga0081540_1057199 Ga0081540_10571993 262
402 3300005985 Ga0081539_10000203 Ga0081539_1000020360 262
403 3300006051 Ga0075364_10034521 Ga0075364_100345212 262
404 3300006051 Ga0075364_10213587 Ga0075364_102135872 262
405 3300006186 Ga0075369_10100985 Ga0075369_101009852 262
406 3300006931 Ga0097620_100140825 Ga0097620_1001408252 262
407 3300009093 Ga0105240_10197740 Ga0105240_101977404 262
408 3300010375 Ga0105239_10025595 Ga0105239_100255954 262
409 3300010375 Ga0105239_10267889 Ga0105239_102678893 262
410 3300010375 Ga0105239_10531813 Ga0105239_105318131 262
411 3300013105 Ga0157369_10375463 Ga0157369_103754632 262
412 3300013297 Ga0157378_10543239 Ga0157378_105432392 262
413 3300025230 Ga0209563_101769 Ga0209563_1017693 262
414 3300025253 Ga0209677_103510 Ga0209677_1035102 262
415 3300025297 Ga0209758_1000189 Ga0209758_100018944 262
416 3300025919 Ga0207657_10289624 Ga0207657_102896241 262
417 3300025928 Ga0207700_10039513 Ga0207700_100395132 262
418 3300026041 Ga0207639_10551502 Ga0207639_105515021 262
419 3300028379 Ga0268266_10042804 Ga0268266_100428044 262
420 3300028666 Ga0265336_10000261 Ga0265336_100002614 262
421 3300028800 Ga0265338_10000090 Ga0265338_10000090127 262
422 3300029957 Ga0265324_10024546 Ga0265324_100245462 262
423 3300031711 Ga0265314_10150585 Ga0265314_101505852 262
424 3300033180 Ga0307510_10004439 Ga0307510_100044394 262
425 3300037312 Ga0395899_0226489 Ga0395899_0226489_209_1039 262
426 3300037418 Ga0395900_0006086 Ga0395900_0006086_9432_10262 262
427 3300037466 Ga0395898_0055379 Ga0395898_0055379_1392_2222 262
428 3300038443 Ga0395901_0184047 Ga0395901_0184047_1082_1912 262
429 3300044658 Ga0466972_0003457 Ga0466972_0003457_6748_7578 262
430 3300046460 Ga0495638_0083509 Ga0495638_0083509_555_1385 262
431 3300048915 Ga0496112_0125057 Ga0496112_0125057_75_905 262
432 3300048915 Ga0496112_0755174 Ga0496112_0755174_29_859 262
433 3300048921 Ga0496118_0031241 Ga0496118_0031241_94_924 262
434 3300048923 Ga0496120_0073367 Ga0496120_0073367_108_938 262
435 3300048928 Ga0496125_0048821 Ga0496125_0048821_2271_3113 262
436 3300048929 Ga0496126_0012658 Ga0496126_0012658_3132_3962 262
437 3300050493 nmdc:mga0k408_122918_c1 nmdc:mga0k408_122918_c1_644_1474 262
438 3300053108 Ga0500562_007246 Ga0500562_007246_453_1283 262
439 3300053133 Ga0500655_024294 Ga0500655_024294_229_1059 262
440 3300053153 Ga0500616_0004401 Ga0500616_0004401_8018_8848 262
441 3300053156 Ga0500622_0075833 Ga0500622_0075833_130_960 262
442 3300053163 Ga0500639_141500 Ga0500639_141500_34_864 262
443 3300053730 Ga0500645_064629 Ga0500645_064629_39_869 262
444 iso_pu_bacteria 2816332527 2818242371 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

124

255

0.93

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

42

115

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9247 107 257
1x7p-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.8576 35 256
1x7o-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes 0.8442 32 256
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8404 107 257
4x3m-assembly1.cif.gz_B crystal structure of ttha0275 from thermus thermophilus (hb8) in complex with adenosine in space group p212121 0.8393 35 258
ID Description Score Start End Superfamily
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9101 103 256 3.40.1280.10
1gz0F02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9048 103 257 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8984 108 258 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8917 101 251 3.40.1280.10
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8853 110 252 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A533J5Y6-F1-model_v4 deleted 0.9537 136 262
AF-A0A533J5Y6-F1-model_v4 deleted 0.9464 136 262
AF-A0A1J5I3W5-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9347 34 255 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A4Q2XXW0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9344 167 257 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A3A5IZ75-F1-model_v4 deleted 0.9311 113 257

Feature Viewer

pLDDT pTM Quality
85.19 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map