F445325

General Info

Members Datasets Scaffolds Average Seq Length
444 264 437 254

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0791244|Ga0436364_0791244_5540_6424
Length 294
Sequence MKDHARAVFPAGTGIAHSSLVHHCPTDRAGKDNGMDLNLRGKTALVTGASKGIGRASAEALAEEGVNVILVSRTHADLDAVRDSIAARWNVRVEVHAFDISDSANVDRLAALHPDIDILVNNAGAIPGGNLQEVDERRWREAWDLKVYGYINMCRRFYALMKQRGRGVIINILGMAGERMDVGYIAGSAGNAGLMAFTRTLGGAASADNLRVVGINPGAIATDRLVTIMKKRAQDRLGDAGRWEELMQPLPFGRAGTPEEIGSMVAFLSSDKSAYTTGTIITIDGGAANRGPMF

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
3 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
4 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
5 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 0.9
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10362135 3300003323 Bacteria 2048
2 Ga0065707_10011384 3300005295 Bacteria 3181
3 Ga0070658_10025736 3300005327 Bacteria 4717
4 Ga0070683_100137867 3300005329 Bacteria 2311
5 Ga0070683_100614817 3300005329 Bacteria 1040
6 Ga0070690_100001285 3300005330 Bacteria 13046
7 Ga0070690_100082118 3300005330 Bacteria 2110
8 Ga0068869_100006971 3300005334 Bacteria 7193
9 Ga0070680_100218347 3300005336 Bacteria 1609
10 Ga0070682_100217373 3300005337 Unclassified 1358
11 Ga0068868_100110066 3300005338 Bacteria 2238
12 Ga0070689_100002710 3300005340 Bacteria 11597
13 Ga0070689_100103954 3300005340 Bacteria 2252
14 Ga0070689_100149134 3300005340 Bacteria 1885
15 Ga0070689_100247175 3300005340 Bacteria 1471
16 Ga0070691_10037041 3300005341 Bacteria 2300
17 Ga0070661_100363077 3300005344 Bacteria 1138
18 Ga0070692_10049261 3300005345 Bacteria 2185
19 Ga0070692_10064038 3300005345 Bacteria 1944
20 Ga0070668_100451438 3300005347 Bacteria 1105
21 Ga0070675_100088213 3300005354 Bacteria 2595
22 Ga0070675_100291167 3300005354 Bacteria 1437
23 Ga0070675_100406829 3300005354 Bacteria 1215
24 Ga0070674_100262936 3300005356 Unclassified 1360
25 Ga0070673_100638087 3300005364 Bacteria 974
26 Ga0070659_100050422 3300005366 Bacteria 3272
27 Ga0070714_100017355 3300005435 Bacteria 5829
28 Ga0070713_100056501 3300005436 Bacteria 3265
29 Ga0070710_10202872 3300005437 Bacteria 1253
30 Ga0070701_10131669 3300005438 Bacteria 1421
31 Ga0070711_100309894 3300005439 Bacteria 1258
32 Ga0070705_100038896 3300005440 Bacteria 2696
33 Ga0070700_100001566 3300005441 Bacteria 11409
34 Ga0070700_100326976 3300005441 Bacteria 1128
35 Ga0070700_100331292 3300005441 Bacteria 1122
36 Ga0070694_100010450 3300005444 Bacteria 5728
37 Ga0070694_100105544 3300005444 Bacteria 1999
38 Ga0070694_100160746 3300005444 Bacteria 1648
39 Ga0070694_100220713 3300005444 Bacteria 1421
40 Ga0070678_100029867 3300005456 Bacteria 3739
41 Ga0070678_100141254 3300005456 Bacteria 1927
42 Ga0070662_100130383 3300005457 Bacteria 1938
43 Ga0070681_10023435 3300005458 Bacteria 6207
44 Ga0070681_10255324 3300005458 Bacteria 1665
45 Ga0068867_100007546 3300005459 Bacteria 7694
46 Ga0070707_100120467 3300005468 Bacteria 2547
47 Ga0070707_100647764 3300005468 Bacteria 1019
48 Ga0070698_100017628 3300005471 Bacteria 7524
49 Ga0070699_100204595 3300005518 Bacteria 1756
50 Ga0070699_100259601 3300005518 Bacteria 1554
51 Ga0070679_100045173 3300005530 Bacteria 4390
52 Ga0070679_100181332 3300005530 Bacteria 2078
53 Ga0070679_100214137 3300005530 Bacteria 1889
54 Ga0070697_100303013 3300005536 Bacteria 1374
55 Ga0068853_100003905 3300005539 Bacteria 11429
56 Ga0068853_100413638 3300005539 Bacteria 1264
57 Ga0068853_100624687 3300005539 Bacteria 1024
58 Ga0070695_100009851 3300005545 Bacteria 5693
59 Ga0070695_100250631 3300005545 Bacteria 1289
60 Ga0070695_100251024 3300005545 Unclassified 1288
61 Ga0070696_100204497 3300005546 Bacteria 1475
62 Ga0070696_100483047 3300005546 Bacteria 983
63 Ga0070693_100234387 3300005547 Unclassified 1209
64 Ga0070693_100371408 3300005547 Bacteria 984
65 Ga0070665_100478402 3300005548 Bacteria 1256
66 Ga0070704_100012262 3300005549 Bacteria 5292
67 Ga0070704_100134083 3300005549 Bacteria 1924
68 Ga0070704_100143831 3300005549 Bacteria 1866
69 Ga0070704_100179765 3300005549 Bacteria 1691
70 Ga0070704_100274104 3300005549 Bacteria 1395
71 Ga0068855_100053404 3300005563 Bacteria 4754
72 Ga0068855_100148961 3300005563 Bacteria 2661
73 Ga0068855_100252250 3300005563 Bacteria 1968
74 Ga0068855_100261374 3300005563 Bacteria 1928
75 Ga0068855_100451518 3300005563 Bacteria 1403
76 Ga0070664_100235583 3300005564 Bacteria 1642
77 Ga0070664_100558307 3300005564 Unclassified 1059
78 Ga0068857_100118893 3300005577 Bacteria 2378
79 Ga0068857_100143991 3300005577 Bacteria 2156
80 Ga0068856_100093284 3300005614 Bacteria 2996
81 Ga0068856_100269613 3300005614 Bacteria 1718
82 Ga0068856_100299792 3300005614 Bacteria 1625
83 Ga0068856_100630284 3300005614 Bacteria 1093
84 Ga0070702_100000237 3300005615 Bacteria 18638
85 Ga0070702_100126981 3300005615 Bacteria 1605
86 Ga0070702_100434719 3300005615 Bacteria 948
87 Ga0068852_100018400 3300005616 Bacteria 5503
88 Ga0068852_100129924 3300005616 Bacteria 2318
89 Ga0068852_100630562 3300005616 Bacteria 1078
90 Ga0068859_100013168 3300005617 Bacteria 8307
91 Ga0068859_100092838 3300005617 Bacteria 3070
92 Ga0068859_100106055 3300005617 Bacteria 2869
93 Ga0068864_100358464 3300005618 Bacteria 1377
94 Ga0068866_10002731 3300005718 Bacteria 7280
95 Ga0068866_10114527 3300005718 Bacteria 1510
96 Ga0068861_100729414 3300005719 Bacteria 924
97 Ga0068863_100159056 3300005841 Bacteria 2164
98 Ga0068863_100518460 3300005841 Bacteria 1175
99 Ga0068863_100655913 3300005841 Bacteria 1041
100 Ga0068858_100039659 3300005842 Bacteria 4367
101 Ga0068858_100369953 3300005842 Unclassified 1374
102 Ga0068860_100317767 3300005843 Bacteria 1528
103 Ga0068862_100007234 3300005844 Bacteria 9216
104 Ga0068862_100118531 3300005844 Bacteria 2330
105 Ga0068862_100213762 3300005844 Bacteria 1743
106 Ga0081538_10050028 3300005981 Bacteria 2529
107 Ga0070717_10052286 3300006028 Bacteria 3365
108 Ga0070717_10095075 3300006028 Bacteria 2522
109 Ga0075365_10070467 3300006038 Bacteria 2351
110 Ga0075365_10134770 3300006038 Bacteria 1711
111 Ga0075368_10040451 3300006042 Bacteria 1831
112 Ga0075363_100028057 3300006048 Bacteria 2892
113 Ga0075364_10000241 3300006051 Bacteria 26213
114 Ga0075364_10026214 3300006051 Bacteria 3716
115 Ga0070712_100019293 3300006175 Bacteria 4446
116 Ga0075367_10117475 3300006178 Bacteria 1637
117 Ga0097621_100054741 3300006237 Unclassified 3255
118 Ga0075370_10047195 3300006353 Bacteria 2439
119 Ga0068871_100004155 3300006358 Bacteria 10022
120 Ga0068871_100229223 3300006358 Bacteria 1612
121 Ga0075428_100062352 3300006844 Bacteria 4082
122 Ga0075430_100015812 3300006846 Bacteria 6426
123 Ga0075431_100000345 3300006847 Bacteria 36593
124 Ga0075431_100092424 3300006847 Bacteria 3123
125 Ga0075434_100016926 3300006871 Bacteria 7013
126 Ga0075429_100008907 3300006880 Bacteria 8722
127 Ga0075429_100139138 3300006880 Bacteria 2125
128 Ga0068865_100018161 3300006881 Bacteria 4535
129 Ga0097620_100013168 3300006931 Bacteria 8307
130 Ga0097620_100092838 3300006931 Bacteria 3070
131 Ga0097620_100106056 3300006931 Bacteria 2869
132 Ga0075435_100066028 3300007076 Bacteria 2942
133 Ga0075435_100150535 3300007076 Bacteria 1956
134 Ga0075435_100305072 3300007076 Bacteria 1362
135 Ga0111539_10037614 3300009094 Bacteria 5843
136 Ga0111539_10122500 3300009094 Bacteria 3047
137 Ga0111539_11269060 3300009094 Bacteria 855
138 Ga0105245_10001256 3300009098 Bacteria 22910
139 Ga0105245_10150347 3300009098 Bacteria 2201
140 Ga0105247_10145517 3300009101 Bacteria 1557
141 Ga0105247_10188450 3300009101 Bacteria 1380
142 Ga0114129_10016707 3300009147 Bacteria 10452
143 Ga0114129_10025697 3300009147 Bacteria 8342
144 Ga0114129_10315265 3300009147 Bacteria 2080
145 Ga0114129_10357984 3300009147 Bacteria 1931
146 Ga0105243_10002945 3300009148 Bacteria 14074
147 Ga0105243_10070629 3300009148 Bacteria 2820
148 Ga0105243_10096667 3300009148 Bacteria 2444
149 Ga0105241_10024794 3300009174 Bacteria 4455
150 Ga0105241_10165119 3300009174 Bacteria 1824
151 Ga0105242_10005883 3300009176 Bacteria 9453
152 Ga0105242_10129260 3300009176 Bacteria 2178
153 Ga0105248_10125263 3300009177 Bacteria 2898
154 Ga0105248_10126240 3300009177 Bacteria 2886
155 Ga0105248_10395056 3300009177 Bacteria 1557
156 Ga0105237_10052902 3300009545 Bacteria 4074
157 Ga0105237_10450660 3300009545 Bacteria 1293
158 Ga0105239_10084845 3300010375 Bacteria 3489
159 Ga0105239_10119348 3300010375 Bacteria 2927
160 Ga0105246_10228760 3300011119 Unclassified 1463
161 Ga0157371_10034562 3300013102 Bacteria 3625
162 Ga0157369_10127325 3300013105 Bacteria 2699
163 Ga0157369_10153003 3300013105 Bacteria 2438
164 Ga0157374_10412702 3300013296 Unclassified 1348
165 Ga0157378_10010883 3300013297 Bacteria 7956
166 Ga0157378_10163178 3300013297 Bacteria 2085
167 Ga0157378_10222064 3300013297 Bacteria 1797
168 Ga0163162_10203572 3300013306 Bacteria 2108
169 Ga0163162_10305949 3300013306 Bacteria 1722
170 Ga0163162_10504341 3300013306 Bacteria 1340
171 Ga0157372_10420866 3300013307 Bacteria 1557
172 Ga0157375_10053895 3300013308 Bacteria 3960
173 Ga0157375_10379800 3300013308 Bacteria 1580
174 Ga0163163_10459131 3300014325 Bacteria 1334
175 Ga0157380_10027371 3300014326 Bacteria 4336
176 Ga0157380_10037204 3300014326 Bacteria 3769
177 Ga0182008_10010870 3300014497 Bacteria 4856
178 Ga0157379_10025335 3300014968 Bacteria 5269
179 Ga0157379_10314638 3300014968 Bacteria 1429
180 Ga0157379_10580009 3300014968 Bacteria 1045
181 Ga0157376_10021851 3300014969 Bacteria 4975
182 Ga0157376_10120371 3300014969 Bacteria 2326
183 Ga0157376_10558426 3300014969 Unclassified 1134
184 Ga0163161_10294169 3300017792 Bacteria 1277
185 Ga0213872_10045318 3300021361 Bacteria 2001
186 Ga0213875_10019036 3300021388 Bacteria 3305
187 Ga0209025_1043690 3300025294 Bacteria 1884
188 Ga0207642_10037565 3300025899 Bacteria 2088
189 Ga0207642_10123692 3300025899 Bacteria 1339
190 Ga0207710_10161695 3300025900 Bacteria 1091
191 Ga0207685_10174906 3300025905 Bacteria 991
192 Ga0207699_10327010 3300025906 Bacteria 1077
193 Ga0207645_10185288 3300025907 Unclassified 1366
194 Ga0207643_10008619 3300025908 Bacteria 5468
195 Ga0207705_10003527 3300025909 Bacteria 11915
196 Ga0207684_10150418 3300025910 Bacteria 2003
197 Ga0207654_10104047 3300025911 Bacteria 1754
198 Ga0207707_10027093 3300025912 Bacteria 5011
199 Ga0207707_10037546 3300025912 Unclassified 4234
200 Ga0207707_10357101 3300025912 Bacteria 1258
201 Ga0207693_10058627 3300025915 Bacteria 3016
202 Ga0207663_10029222 3300025916 Bacteria 3235
203 Ga0207663_10359291 3300025916 Bacteria 1105
204 Ga0207662_10496419 3300025918 Bacteria 840
205 Ga0207652_10337141 3300025921 Bacteria 1361
206 Ga0207652_10342131 3300025921 Bacteria 1350
207 Ga0207652_10400188 3300025921 Bacteria 1239
208 Ga0207681_10668839 3300025923 Bacteria 862
209 Ga0207694_10091126 3300025924 Bacteria 2406
210 Ga0207659_10313731 3300025926 Bacteria 1292
211 Ga0207687_10349989 3300025927 Bacteria 1203
212 Ga0207700_10409350 3300025928 Bacteria 1190
213 Ga0207664_10263985 3300025929 Bacteria 1506
214 Ga0207706_10180899 3300025933 Bacteria 1852
215 Ga0207706_10417738 3300025933 Bacteria 1162
216 Ga0207686_10075836 3300025934 Bacteria 2178
217 Ga0207686_10133399 3300025934 Bacteria 1706
218 Ga0207709_10039940 3300025935 Bacteria 2806
219 Ga0207709_10254106 3300025935 Bacteria 1285
220 Ga0207670_10025421 3300025936 Bacteria 3716
221 Ga0207670_10043420 3300025936 Bacteria 2969
222 Ga0207670_10047857 3300025936 Bacteria 2851
223 Ga0207670_10137729 3300025936 Bacteria 1797
224 Ga0207670_10464318 3300025936 Bacteria 1023
225 Ga0207669_10033605 3300025937 Bacteria 2897
226 Ga0207691_10286426 3300025940 Bacteria 1417
227 Ga0207689_10000519 3300025942 Bacteria 36612
228 Ga0207689_10021940 3300025942 Bacteria 5369
229 Ga0207667_10096026 3300025949 Bacteria 3059
230 Ga0207667_10178598 3300025949 Bacteria 2180
231 Ga0207667_10222543 3300025949 Bacteria 1933
232 Ga0207651_10434638 3300025960 Bacteria 1123
233 Ga0207712_10074792 3300025961 Bacteria 2447
234 Ga0207658_10433104 3300025986 Bacteria 1162
235 Ga0207677_10127689 3300026023 Bacteria 1925
236 Ga0207677_10376906 3300026023 Bacteria 1196
237 Ga0207703_10276705 3300026035 Bacteria 1523
238 Ga0207703_10405804 3300026035 Bacteria 1265
239 Ga0207639_10003694 3300026041 Bacteria 10289
240 Ga0207639_10564687 3300026041 Bacteria 1046
241 Ga0207708_10001346 3300026075 Bacteria 18481
242 Ga0207708_10140751 3300026075 Bacteria 1892
243 Ga0207708_10398505 3300026075 Bacteria 1138
244 Ga0207702_10036799 3300026078 Bacteria 4095
245 Ga0207641_10506765 3300026088 Bacteria 1173
246 Ga0207641_10612487 3300026088 Bacteria 1067
247 Ga0207648_10000461 3300026089 Bacteria 45235
248 Ga0207676_10385824 3300026095 Bacteria 1305
249 Ga0207674_10032514 3300026116 Bacteria 5472
250 Ga0207674_10479848 3300026116 Bacteria 1202
251 Ga0207675_100001140 3300026118 Bacteria 26326
252 Ga0207675_100044721 3300026118 Bacteria 4138
253 Ga0207675_100285103 3300026118 Bacteria 1605
254 Ga0207683_10213032 3300026121 Bacteria 1759
255 Ga0207698_10025235 3300026142 Bacteria 4183
256 Ga0207698_10143871 3300026142 Unclassified 2059
257 Ga0207698_10266466 3300026142 Bacteria 1577
258 Ga0207698_10594017 3300026142 Bacteria 1091
259 Ga0207428_10094110 3300027907 Bacteria 2323
260 Ga0268266_10318517 3300028379 Bacteria 1455
261 Ga0268266_10555677 3300028379 Bacteria 1100
262 Ga0268264_10161183 3300028381 Unclassified 2020
263 Ga0268264_10229342 3300028381 Bacteria 1714
264 Ga0268264_10492329 3300028381 Bacteria 1194
265 Ga0265318_10023172 3300028577 Bacteria 2476
266 Ga0265338_10025620 3300028800 Bacteria 5979
267 Ga0265320_10138470 3300031240 Bacteria 1103
268 Ga0265340_10036728 3300031247 Bacteria 2427
269 Ga0307408_100354090 3300031548 Bacteria 1247
270 Ga0307408_100796244 3300031548 Bacteria 857
271 Ga0316575_10002967 3300031665 Bacteria 5773
272 Ga0316575_10014233 3300031665 Bacteria 2983
273 Ga0265314_10227927 3300031711 Bacteria 1083
274 Ga0316576_10120792 3300031727 Bacteria 1967
275 Ga0316578_10002596 3300031728 Bacteria 7997
276 Ga0307413_10266874 3300031824 Bacteria 1279
277 Ga0307412_10445078 3300031911 Bacteria 1066
278 Ga0373934_0214821 3300035086 Bacteria 793
279 Ga0373923_0222566 3300035111 Bacteria 877
280 Ga0373936_0097233 3300035113 Bacteria 1239
281 Ga0373936_0105099 3300035113 Bacteria 1194
282 Ga0373936_0165752 3300035113 Bacteria 964
283 Ga0373954_0062680 3300035118 Bacteria 1757
284 Ga0373956_0018596 3300035119 Bacteria 2943
285 Ga0373942_0005350 3300035207 Bacteria 2979
286 Ga0373961_0019652 3300035241 Bacteria 1777
287 Ga0373924_0027155 3300035410 Bacteria 2275
288 Ga0373931_0275758 3300035691 Bacteria 1031
289 Ga0373935_0015849 3300035692 Bacteria 4561
290 Ga0373935_0054720 3300035692 Bacteria 2542
291 Ga0373935_0183844 3300035692 Bacteria 1436
292 Ga0373935_0448006 3300035692 Bacteria 932
293 Ga0373927_0147416 3300035695 Bacteria 1541
294 Ga0373927_0253312 3300035695 Bacteria 1157
295 Ga0373933_0054448 3300035724 Bacteria 2398
296 Ga0373933_0162209 3300035724 Bacteria 1420
297 Ga0373933_0216323 3300035724 Bacteria 1229
298 Ga0373933_0265997 3300035724 Bacteria 1106
299 Ga0373947_0012320 3300035725 Bacteria 4901
300 Ga0373937_0001833 3300036401 Bacteria 17856
301 Ga0373937_0004886 3300036401 Bacteria 11394
302 Ga0373937_0016991 3300036401 Bacteria 6471
303 Ga0373937_0061173 3300036401 Bacteria 3461
304 Ga0373937_0077515 3300036401 Bacteria 3071
305 Ga0373937_0134153 3300036401 Bacteria 2314
306 Ga0373937_0354152 3300036401 Bacteria 1391
307 Ga0316584_0008110 3300036712 Bacteria 7216
308 Ga0373925_0066811 3300037068 Bacteria 2711
309 Ga0373925_0068203 3300037068 Bacteria 2684
310 Ga0373925_0093927 3300037068 Bacteria 2296
311 Ga0395898_0336745 3300037466 Bacteria 1439
312 Ga0316581_0013720 3300037588 Bacteria 2301
313 Ga0436364_0791244 3300037853 Bacteria 7761
314 Ga0395901_0015644 3300038443 Bacteria 7727
315 Ga0395901_0018973 3300038443 Bacteria 7032
316 Ga0400483_177006 3300039062 Bacteria 4117
317 Ga0436365_0939926 3300039437 Bacteria 2074
318 Ga0436361_0529066 3300039447 Bacteria 3432
319 Ga0439441_001040 3300042001 Bacteria 3439
320 Ga0439441_017846 3300042001 Bacteria 1279
321 Ga0495592_0006664 3300046454 Bacteria 8608
322 Ga0495629_0431999 3300046459 Bacteria 893
323 Ga0495651_0007983 3300046462 Bacteria 8115
324 Ga0495651_0224182 3300046462 Bacteria 1299
325 Ga0495653_0113420 3300046463 Bacteria 1944
326 Ga0495653_0174070 3300046463 Bacteria 1483
327 Ga0495582_0257296 3300046473 Bacteria 1001
328 Ga0495582_0314455 3300046473 Bacteria 901
329 Ga0495639_0057187 3300046475 Bacteria 1782
330 Ga0495662_0007371 3300046476 Bacteria 5436
331 Ga0495664_0010758 3300046477 Bacteria 5142
332 Ga0495594_0303793 3300046499 Bacteria 909
333 Ga0495608_0004164 3300046511 Bacteria 10369
334 Ga0495608_0038620 3300046511 Bacteria 3205
335 Ga0495618_0002241 3300046514 Bacteria 12565
336 Ga0495628_0004512 3300046516 Bacteria 12336
337 Ga0495628_0035410 3300046516 Bacteria 4012
338 Ga0495628_0085334 3300046516 Bacteria 2450
339 Ga0495630_0003325 3300046517 Bacteria 11202
340 Ga0495630_0389866 3300046517 Bacteria 1067
341 Ga0495652_0038487 3300046529 Bacteria 4143
342 Ga0495640_0019946 3300046533 Bacteria 4944
343 Ga0495640_0034762 3300046533 Bacteria 3569
344 Ga0495586_0000357 3300046535 Bacteria 28588
345 Ga0495586_0056110 3300046535 Bacteria 2136
346 Ga0495621_0013302 3300046539 Bacteria 2583
347 Ga0495645_0004710 3300046543 Bacteria 9317
348 Ga0495645_0026596 3300046543 Bacteria 4201
349 Ga0495667_0003174 3300046559 Bacteria 11019
350 Ga0495667_0016308 3300046559 Bacteria 5020
351 Ga0495667_0028696 3300046559 Bacteria 3747
352 Ga0495634_0009887 3300046642 Bacteria 7014
353 Ga0495635_0015581 3300046663 Bacteria 5313
354 Ga0495659_0145172 3300046664 Bacteria 950
355 Ga0495657_0108505 3300046675 Bacteria 1761
356 Ga0495599_0003567 3300046678 Bacteria 9116
357 Ga0495599_0006228 3300046678 Bacteria 7191
358 Ga0495646_0176689 3300046680 Bacteria 1174
359 Ga0495658_0000597 3300046683 Bacteria 19759
360 Ga0495613_0003374 3300046689 Bacteria 11935
361 Ga0495624_0035269 3300046690 Bacteria 3230
362 Ga0495600_0008355 3300046809 Bacteria 6357
363 Ga0495600_0066393 3300046809 Bacteria 2358
364 Ga0495604_0005484 3300047317 Bacteria 10058
365 Ga0495604_0007829 3300047317 Bacteria 8458
366 Ga0495674_0097461 3300047319 Bacteria 2505
367 Ga0495674_0299821 3300047319 Bacteria 1313
368 Ga0495676_0063361 3300047321 Bacteria 2882
369 Ga0495680_0045703 3300047322 Bacteria 3457
370 Ga0495680_0074066 3300047322 Bacteria 2586
371 Ga0495680_0187059 3300047322 Bacteria 1491
372 Ga0495675_0005689 3300047444 Bacteria 7618
373 Ga0495675_0189240 3300047444 Bacteria 1257
374 Ga0495684_0038559 3300047471 Bacteria 3663
375 Ga0495593_0174966 3300047673 Bacteria 1081
376 Ga0495602_0015039 3300048088 Bacteria 7826
377 Ga0495602_0044926 3300048088 Bacteria 4002
378 Ga0495602_0476347 3300048088 Bacteria 877
379 Ga0496102_0088234 3300048905 Bacteria 2867
380 Ga0496110_0275855 3300048913 Bacteria 1531
381 Ga0496112_0464017 3300048915 Bacteria 1204
382 Ga0496114_0330899 3300048917 Bacteria 1347
383 Ga0496119_0021389 3300048922 Bacteria 4678
384 Ga0496122_0065319 3300048925 Bacteria 2639
385 Ga0501032_0051044 3300049569 Bacteria 2789
386 Ga0501034_0082778 3300049571 Bacteria 3211
387 Ga0501038_0159835 3300049574 Bacteria 1832
388 Ga0501039_0056841 3300049575 Bacteria 3031
389 Ga0501039_0232265 3300049575 Bacteria 1450
390 Ga0501041_0078474 3300049577 Bacteria 2032
391 Ga0501047_0006890 3300049581 Bacteria 10679
392 Ga0501068_0269251 3300049584 Bacteria 1087
393 Ga0501071_0011462 3300049587 Bacteria 5973
394 Ga0501072_0008383 3300049588 Bacteria 7845
395 Ga0501073_0024485 3300049589 Bacteria 4335
396 Ga0501073_0155127 3300049589 Bacteria 1587
397 Ga0501073_0320907 3300049589 Bacteria 1069
398 Ga0501074_0163891 3300049590 Bacteria 1587
399 Ga0501075_0062647 3300049591 Bacteria 2803
400 Ga0501076_0061554 3300049592 Bacteria 2987
401 Ga0501079_0015839 3300049741 Bacteria 5761
402 Ga0501079_0483149 3300049741 Unclassified 974
403 Ga0501080_0004531 3300049742 Bacteria 12383
404 Ga0501080_0231344 3300049742 Bacteria 1689
405 Ga0501080_0539104 3300049742 Bacteria 1040
406 Ga0501081_0112537 3300049743 Bacteria 1932
407 Ga0501083_0004063 3300049744 Bacteria 10295
408 Ga0501083_0108377 3300049744 Bacteria 1827
409 nmdc:mga03683_19664_c1 3300050489 Bacteria 2580
410 nmdc:mga03n38_13513_c1 3300050490 Bacteria 3104
411 nmdc:mga00v17_11498_c1 3300050491 Bacteria 4864
412 nmdc:mga00v17_141_c1 3300050491 Bacteria 41598
413 nmdc:mga0yw44_164435_c1 3300050492 Bacteria 1454
414 nmdc:mga0yw44_45121_c1 3300050492 Bacteria 2641
415 nmdc:mga06z11_104995_c1 3300050494 Bacteria 1556
416 nmdc:mga07m45_20769_c2 3300050496 Bacteria 3183
417 nmdc:mga05p37_1971_c1 3300050507 Bacteria 23923
418 nmdc:mga05p37_42418_c1 3300050507 Bacteria 5589
419 nmdc:mga05p37_752152_c1 3300050507 Bacteria 1074
420 nmdc:mga09592_1325_c1 3300050508 Bacteria 19875
421 nmdc:mga09592_46867_c1 3300050508 Bacteria 2178
422 nmdc:mga09592_87527_c1 3300050508 Bacteria 2659
423 nmdc:mga0qj67_189408_c1 3300050509 Bacteria 1672
424 nmdc:mga06r32_106425_c1 3300050510 Bacteria 2756
425 nmdc:mga06r32_26639_c1 3300050510 Bacteria 5393
426 nmdc:mga06r32_39520_c1 3300050510 Bacteria 4477
427 nmdc:mga06r32_74966_c1 3300050510 Bacteria 3281
428 nmdc:mga08y16_26724_c1 3300050511 Bacteria 6082
429 nmdc:mga08y16_551536_c1 3300050511 Bacteria 1166
430 nmdc:mga0rr50_4776_c1 3300050513 Bacteria 7995
431 Ga0495601_0006347 3300053077 Bacteria 6909
432 Ga0495601_0015635 3300053077 Bacteria 4588
433 Ga0495595_0013421 3300053084 Bacteria 3461
434 Ga0495595_0033483 3300053084 Bacteria 2319
435 Ga0501084_0127818 3300054114 Bacteria 2139
436 Ga0501082_0000202 3300060353 Bacteria 52074
437 Ga0501082_0036876 3300060353 Bacteria 4212

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10047195 Ga0075370_100471952 192
2 3300050496 nmdc:mga07m45_20769_c2 nmdc:mga07m45_20769_c2_1959_2594 192
3 3300047321 Ga0495676_0063361 Ga0495676_0063361_2233_2871 194
4 3300049584 Ga0501068_0269251 Ga0501068_0269251_19_654 206
5 3300014326 Ga0157380_10037204 Ga0157380_100372042 215
6 3300025935 Ga0207709_10254106 Ga0207709_102541062 215
7 3300048917 Ga0496114_0330899 Ga0496114_0330899_11_775 215
8 3300005435 Ga0070714_100017355 Ga0070714_1000173555 228
9 3300005563 Ga0068855_100451518 Ga0068855_1004515182 228
10 3300005616 Ga0068852_100129924 Ga0068852_1001299243 228
11 3300025929 Ga0207664_10263985 Ga0207664_102639852 228
12 3300026142 Ga0207698_10143871 Ga0207698_101438712 228
13 3300025936 Ga0207670_10047857 Ga0207670_100478574 230
14 3300025940 Ga0207691_10286426 Ga0207691_102864262 230
15 3300026075 Ga0207708_10398505 Ga0207708_103985052 230
16 3300035086 Ga0373934_0214821 Ga0373934_0214821_25_729 230
17 3300035113 Ga0373936_0165752 Ga0373936_0165752_249_953 230
18 3300005549 Ga0070704_100134083 Ga0070704_1001340831 233
19 3300035118 Ga0373954_0062680 Ga0373954_0062680_881_1669 234
20 iso_pu_bacteria 2904434214 2904434954 234
21 iso_pu_bacteria 2597490356 2599103346 235
22 iso_pu_bacteria 2846952575 2846953230 235
23 iso_pu_bacteria 2848858292 2848860663 235
24 iso_pu_bacteria 2898795034 2898795668 235
25 iso_pu_bacteria 8054563764 8054566587 235
26 iso_pu_bacteria 8054563764 8054567509 235
27 3300005354 Ga0070675_100291167 Ga0070675_1002911672 236
28 3300005364 Ga0070673_100638087 Ga0070673_1006380871 236
29 3300005618 Ga0068864_100358464 Ga0068864_1003584642 236
30 3300009177 Ga0105248_10395056 Ga0105248_103950562 236
31 3300017792 Ga0163161_10294169 Ga0163161_102941691 236
32 3300025986 Ga0207658_10433104 Ga0207658_104331041 236
33 3300026095 Ga0207676_10385824 Ga0207676_103858242 236
34 3300026118 Ga0207675_100285103 Ga0207675_1002851032 236
35 3300039062 Ga0400483_177006 Ga0400483_177006_2818_3582 236
36 3300049589 Ga0501073_0320907 Ga0501073_0320907_229_954 237
37 3300007076 Ga0075435_100305072 Ga0075435_1003050722 238
38 3300009094 Ga0111539_11269060 Ga0111539_112690602 238
39 3300031665 Ga0316575_10014233 Ga0316575_100142331 238
40 3300049569 Ga0501032_0051044 Ga0501032_0051044_1121_1888 238
41 3300049571 Ga0501034_0082778 Ga0501034_0082778_998_1765 238
42 3300049581 Ga0501047_0006890 Ga0501047_0006890_3415_4182 238
43 3300049589 Ga0501073_0024485 Ga0501073_0024485_3173_3940 238
44 3300049742 Ga0501080_0539104 Ga0501080_0539104_150_878 238
45 3300049744 Ga0501083_0004063 Ga0501083_0004063_6799_7566 238
46 3300060353 Ga0501082_0036876 Ga0501082_0036876_922_1689 238
47 3300003323 rootH1_10362135 rootH1_103621352 239
48 3300005295 Ga0065707_10011384 Ga0065707_100113842 239
49 3300005327 Ga0070658_10025736 Ga0070658_100257364 239
50 3300005329 Ga0070683_100137867 Ga0070683_1001378672 239
51 3300005329 Ga0070683_100614817 Ga0070683_1006148172 239
52 3300005330 Ga0070690_100001285 Ga0070690_1000012859 239
53 3300005330 Ga0070690_100082118 Ga0070690_1000821182 239
54 3300005334 Ga0068869_100006971 Ga0068869_1000069716 239
55 3300005336 Ga0070680_100218347 Ga0070680_1002183472 239
56 3300005337 Ga0070682_100217373 Ga0070682_1002173732 239
57 3300005338 Ga0068868_100110066 Ga0068868_1001100661 239
58 3300005340 Ga0070689_100002710 Ga0070689_1000027104 239
59 3300005340 Ga0070689_100103954 Ga0070689_1001039541 239
60 3300005340 Ga0070689_100149134 Ga0070689_1001491343 239
61 3300005340 Ga0070689_100247175 Ga0070689_1002471752 239
62 3300005341 Ga0070691_10037041 Ga0070691_100370412 239
63 3300005344 Ga0070661_100363077 Ga0070661_1003630772 239
64 3300005345 Ga0070692_10049261 Ga0070692_100492612 239
65 3300005345 Ga0070692_10064038 Ga0070692_100640382 239
66 3300005347 Ga0070668_100451438 Ga0070668_1004514381 239
67 3300005354 Ga0070675_100088213 Ga0070675_1000882132 239
68 3300005354 Ga0070675_100406829 Ga0070675_1004068292 239
69 3300005356 Ga0070674_100262936 Ga0070674_1002629362 239
70 3300005366 Ga0070659_100050422 Ga0070659_1000504223 239
71 3300005436 Ga0070713_100056501 Ga0070713_1000565012 239
72 3300005437 Ga0070710_10202872 Ga0070710_102028722 239
73 3300005438 Ga0070701_10131669 Ga0070701_101316692 239
74 3300005439 Ga0070711_100309894 Ga0070711_1003098943 239
75 3300005440 Ga0070705_100038896 Ga0070705_1000388962 239
76 3300005441 Ga0070700_100001566 Ga0070700_1000015668 239
77 3300005441 Ga0070700_100326976 Ga0070700_1003269762 239
78 3300005441 Ga0070700_100331292 Ga0070700_1003312922 239
79 3300005444 Ga0070694_100010450 Ga0070694_1000104503 239
80 3300005444 Ga0070694_100105544 Ga0070694_1001055442 239
81 3300005444 Ga0070694_100160746 Ga0070694_1001607462 239
82 3300005444 Ga0070694_100220713 Ga0070694_1002207132 239
83 3300005456 Ga0070678_100029867 Ga0070678_1000298675 239
84 3300005456 Ga0070678_100141254 Ga0070678_1001412542 239
85 3300005457 Ga0070662_100130383 Ga0070662_1001303832 239
86 3300005458 Ga0070681_10023435 Ga0070681_100234355 239
87 3300005458 Ga0070681_10255324 Ga0070681_102553242 239
88 3300005459 Ga0068867_100007546 Ga0068867_1000075468 239
89 3300005468 Ga0070707_100120467 Ga0070707_1001204673 239
90 3300005468 Ga0070707_100647764 Ga0070707_1006477641 239
91 3300005471 Ga0070698_100017628 Ga0070698_1000176282 239
92 3300005518 Ga0070699_100204595 Ga0070699_1002045952 239
93 3300005518 Ga0070699_100259601 Ga0070699_1002596012 239
94 3300005530 Ga0070679_100045173 Ga0070679_1000451733 239
95 3300005530 Ga0070679_100181332 Ga0070679_1001813322 239
96 3300005530 Ga0070679_100214137 Ga0070679_1002141373 239
97 3300005536 Ga0070697_100303013 Ga0070697_1003030131 239
98 3300005539 Ga0068853_100003905 Ga0068853_1000039057 239
99 3300005539 Ga0068853_100413638 Ga0068853_1004136381 239
100 3300005539 Ga0068853_100624687 Ga0068853_1006246872 239
101 3300005545 Ga0070695_100009851 Ga0070695_1000098511 239
102 3300005545 Ga0070695_100250631 Ga0070695_1002506312 239
103 3300005545 Ga0070695_100251024 Ga0070695_1002510241 239
104 3300005546 Ga0070696_100204497 Ga0070696_1002044971 239
105 3300005546 Ga0070696_100483047 Ga0070696_1004830472 239
106 3300005547 Ga0070693_100234387 Ga0070693_1002343871 239
107 3300005547 Ga0070693_100371408 Ga0070693_1003714081 239
108 3300005548 Ga0070665_100478402 Ga0070665_1004784022 239
109 3300005549 Ga0070704_100012262 Ga0070704_1000122627 239
110 3300005549 Ga0070704_100143831 Ga0070704_1001438312 239
111 3300005549 Ga0070704_100179765 Ga0070704_1001797652 239
112 3300005549 Ga0070704_100274104 Ga0070704_1002741041 239
113 3300005563 Ga0068855_100053404 Ga0068855_1000534044 239
114 3300005563 Ga0068855_100148961 Ga0068855_1001489613 239
115 3300005563 Ga0068855_100252250 Ga0068855_1002522502 239
116 3300005563 Ga0068855_100261374 Ga0068855_1002613742 239
117 3300005564 Ga0070664_100235583 Ga0070664_1002355832 239
118 3300005564 Ga0070664_100558307 Ga0070664_1005583071 239
119 3300005577 Ga0068857_100118893 Ga0068857_1001188933 239
120 3300005577 Ga0068857_100143991 Ga0068857_1001439912 239
121 3300005614 Ga0068856_100093284 Ga0068856_1000932842 239
122 3300005614 Ga0068856_100269613 Ga0068856_1002696131 239
123 3300005614 Ga0068856_100299792 Ga0068856_1002997922 239
124 3300005614 Ga0068856_100630284 Ga0068856_1006302842 239
125 3300005615 Ga0070702_100000237 Ga0070702_10000023718 239
126 3300005615 Ga0070702_100126981 Ga0070702_1001269812 239
127 3300005615 Ga0070702_100434719 Ga0070702_1004347191 239
128 3300005616 Ga0068852_100018400 Ga0068852_1000184004 239
129 3300005616 Ga0068852_100630562 Ga0068852_1006305622 239
130 3300005617 Ga0068859_100013168 Ga0068859_1000131689 239
131 3300005617 Ga0068859_100092838 Ga0068859_1000928382 239
132 3300005617 Ga0068859_100106055 Ga0068859_1001060553 239
133 3300005718 Ga0068866_10002731 Ga0068866_100027317 239
134 3300005718 Ga0068866_10114527 Ga0068866_101145272 239
135 3300005719 Ga0068861_100729414 Ga0068861_1007294141 239
136 3300005841 Ga0068863_100159056 Ga0068863_1001590562 239
137 3300005841 Ga0068863_100518460 Ga0068863_1005184602 239
138 3300005841 Ga0068863_100655913 Ga0068863_1006559131 239
139 3300005842 Ga0068858_100039659 Ga0068858_1000396592 239
140 3300005842 Ga0068858_100369953 Ga0068858_1003699531 239
141 3300005843 Ga0068860_100317767 Ga0068860_1003177672 239
142 3300005844 Ga0068862_100007234 Ga0068862_1000072348 239
143 3300005844 Ga0068862_100118531 Ga0068862_1001185312 239
144 3300005844 Ga0068862_100213762 Ga0068862_1002137622 239
145 3300005981 Ga0081538_10050028 Ga0081538_100500282 239
146 3300006028 Ga0070717_10052286 Ga0070717_100522862 239
147 3300006028 Ga0070717_10095075 Ga0070717_100950752 239
148 3300006038 Ga0075365_10070467 Ga0075365_100704672 239
149 3300006038 Ga0075365_10134770 Ga0075365_101347702 239
150 3300006042 Ga0075368_10040451 Ga0075368_100404512 239
151 3300006048 Ga0075363_100028057 Ga0075363_1000280572 239
152 3300006051 Ga0075364_10000241 Ga0075364_1000024118 239
153 3300006051 Ga0075364_10026214 Ga0075364_100262143 239
154 3300006175 Ga0070712_100019293 Ga0070712_1000192932 239
155 3300006178 Ga0075367_10117475 Ga0075367_101174752 239
156 3300006237 Ga0097621_100054741 Ga0097621_1000547414 239
157 3300006358 Ga0068871_100004155 Ga0068871_1000041557 239
158 3300006358 Ga0068871_100229223 Ga0068871_1002292232 239
159 3300006844 Ga0075428_100062352 Ga0075428_1000623523 239
160 3300006846 Ga0075430_100015812 Ga0075430_1000158122 239
161 3300006847 Ga0075431_100000345 Ga0075431_10000034531 239
162 3300006847 Ga0075431_100092424 Ga0075431_1000924243 239
163 3300006871 Ga0075434_100016926 Ga0075434_1000169262 239
164 3300006880 Ga0075429_100008907 Ga0075429_1000089077 239
165 3300006880 Ga0075429_100139138 Ga0075429_1001391382 239
166 3300006881 Ga0068865_100018161 Ga0068865_1000181614 239
167 3300006931 Ga0097620_100013168 Ga0097620_1000131682 239
168 3300006931 Ga0097620_100092838 Ga0097620_1000928382 239
169 3300006931 Ga0097620_100106056 Ga0097620_1001060563 239
170 3300007076 Ga0075435_100066028 Ga0075435_1000660282 239
171 3300007076 Ga0075435_100150535 Ga0075435_1001505352 239
172 3300009094 Ga0111539_10037614 Ga0111539_100376143 239
173 3300009094 Ga0111539_10122500 Ga0111539_101225002 239
174 3300009098 Ga0105245_10001256 Ga0105245_100012563 239
175 3300009098 Ga0105245_10150347 Ga0105245_101503472 239
176 3300009101 Ga0105247_10145517 Ga0105247_101455172 239
177 3300009101 Ga0105247_10188450 Ga0105247_101884502 239
178 3300009147 Ga0114129_10016707 Ga0114129_100167071 239
179 3300009147 Ga0114129_10025697 Ga0114129_100256975 239
180 3300009147 Ga0114129_10315265 Ga0114129_103152652 239
181 3300009147 Ga0114129_10357984 Ga0114129_103579843 239
182 3300009148 Ga0105243_10002945 Ga0105243_100029453 239
183 3300009148 Ga0105243_10070629 Ga0105243_100706293 239
184 3300009148 Ga0105243_10096667 Ga0105243_100966673 239
185 3300009174 Ga0105241_10024794 Ga0105241_100247942 239
186 3300009174 Ga0105241_10165119 Ga0105241_101651193 239
187 3300009176 Ga0105242_10005883 Ga0105242_100058838 239
188 3300009176 Ga0105242_10129260 Ga0105242_101292603 239
189 3300009177 Ga0105248_10125263 Ga0105248_101252632 239
190 3300009177 Ga0105248_10126240 Ga0105248_101262404 239
191 3300009545 Ga0105237_10052902 Ga0105237_100529023 239
192 3300009545 Ga0105237_10450660 Ga0105237_104506601 239
193 3300010375 Ga0105239_10084845 Ga0105239_100848453 239
194 3300010375 Ga0105239_10119348 Ga0105239_101193483 239
195 3300011119 Ga0105246_10228760 Ga0105246_102287602 239
196 3300013102 Ga0157371_10034562 Ga0157371_100345622 239
197 3300013105 Ga0157369_10127325 Ga0157369_101273252 239
198 3300013105 Ga0157369_10153003 Ga0157369_101530033 239
199 3300013296 Ga0157374_10412702 Ga0157374_104127021 239
200 3300013297 Ga0157378_10010883 Ga0157378_100108837 239
201 3300013297 Ga0157378_10163178 Ga0157378_101631782 239
202 3300013297 Ga0157378_10222064 Ga0157378_102220642 239
203 3300013306 Ga0163162_10203572 Ga0163162_102035722 239
204 3300013306 Ga0163162_10305949 Ga0163162_103059492 239
205 3300013306 Ga0163162_10504341 Ga0163162_105043412 239
206 3300013307 Ga0157372_10420866 Ga0157372_104208662 239
207 3300013308 Ga0157375_10053895 Ga0157375_100538952 239
208 3300013308 Ga0157375_10379800 Ga0157375_103798002 239
209 3300014325 Ga0163163_10459131 Ga0163163_104591312 239
210 3300014326 Ga0157380_10027371 Ga0157380_100273713 239
211 3300014497 Ga0182008_10010870 Ga0182008_100108707 239
212 3300014968 Ga0157379_10025335 Ga0157379_100253354 239
213 3300014968 Ga0157379_10314638 Ga0157379_103146381 239
214 3300014968 Ga0157379_10580009 Ga0157379_105800091 239
215 3300014969 Ga0157376_10021851 Ga0157376_100218515 239
216 3300014969 Ga0157376_10120371 Ga0157376_101203711 239
217 3300014969 Ga0157376_10558426 Ga0157376_105584262 239
218 3300021361 Ga0213872_10045318 Ga0213872_100453182 239
219 3300021388 Ga0213875_10019036 Ga0213875_100190361 239
220 3300025294 Ga0209025_1043690 Ga0209025_10436902 239
221 3300025899 Ga0207642_10037565 Ga0207642_100375653 239
222 3300025899 Ga0207642_10123692 Ga0207642_101236922 239
223 3300025900 Ga0207710_10161695 Ga0207710_101616952 239
224 3300025905 Ga0207685_10174906 Ga0207685_101749062 239
225 3300025906 Ga0207699_10327010 Ga0207699_103270102 239
226 3300025907 Ga0207645_10185288 Ga0207645_101852882 239
227 3300025908 Ga0207643_10008619 Ga0207643_100086196 239
228 3300025909 Ga0207705_10003527 Ga0207705_100035274 239
229 3300025910 Ga0207684_10150418 Ga0207684_101504182 239
230 3300025911 Ga0207654_10104047 Ga0207654_101040473 239
231 3300025912 Ga0207707_10027093 Ga0207707_100270934 239
232 3300025912 Ga0207707_10037546 Ga0207707_100375461 239
233 3300025912 Ga0207707_10357101 Ga0207707_103571012 239
234 3300025915 Ga0207693_10058627 Ga0207693_100586273 239
235 3300025916 Ga0207663_10029222 Ga0207663_100292224 239
236 3300025916 Ga0207663_10359291 Ga0207663_103592911 239
237 3300025918 Ga0207662_10496419 Ga0207662_104964191 239
238 3300025921 Ga0207652_10337141 Ga0207652_103371411 239
239 3300025921 Ga0207652_10342131 Ga0207652_103421312 239
240 3300025921 Ga0207652_10400188 Ga0207652_104001881 239
241 3300025923 Ga0207681_10668839 Ga0207681_106688391 239
242 3300025924 Ga0207694_10091126 Ga0207694_100911262 239
243 3300025926 Ga0207659_10313731 Ga0207659_103137312 239
244 3300025927 Ga0207687_10349989 Ga0207687_103499891 239
245 3300025928 Ga0207700_10409350 Ga0207700_104093502 239
246 3300025933 Ga0207706_10180899 Ga0207706_101808991 239
247 3300025933 Ga0207706_10417738 Ga0207706_104177382 239
248 3300025934 Ga0207686_10075836 Ga0207686_100758362 239
249 3300025934 Ga0207686_10133399 Ga0207686_101333992 239
250 3300025935 Ga0207709_10039940 Ga0207709_100399402 239
251 3300025936 Ga0207670_10025421 Ga0207670_100254213 239
252 3300025936 Ga0207670_10043420 Ga0207670_100434202 239
253 3300025936 Ga0207670_10137729 Ga0207670_101377293 239
254 3300025936 Ga0207670_10464318 Ga0207670_104643182 239
255 3300025937 Ga0207669_10033605 Ga0207669_100336051 239
256 3300025942 Ga0207689_10000519 Ga0207689_1000051918 239
257 3300025942 Ga0207689_10021940 Ga0207689_100219403 239
258 3300025949 Ga0207667_10096026 Ga0207667_100960262 239
259 3300025949 Ga0207667_10178598 Ga0207667_101785982 239
260 3300025949 Ga0207667_10222543 Ga0207667_102225432 239
261 3300025960 Ga0207651_10434638 Ga0207651_104346381 239
262 3300025961 Ga0207712_10074792 Ga0207712_100747923 239
263 3300026023 Ga0207677_10127689 Ga0207677_101276891 239
264 3300026023 Ga0207677_10376906 Ga0207677_103769061 239
265 3300026035 Ga0207703_10276705 Ga0207703_102767051 239
266 3300026035 Ga0207703_10405804 Ga0207703_104058041 239
267 3300026041 Ga0207639_10003694 Ga0207639_100036945 239
268 3300026041 Ga0207639_10564687 Ga0207639_105646872 239
269 3300026075 Ga0207708_10001346 Ga0207708_100013469 239
270 3300026075 Ga0207708_10140751 Ga0207708_101407511 239
271 3300026078 Ga0207702_10036799 Ga0207702_100367995 239
272 3300026088 Ga0207641_10506765 Ga0207641_105067652 239
273 3300026088 Ga0207641_10612487 Ga0207641_106124872 239
274 3300026089 Ga0207648_10000461 Ga0207648_1000046121 239
275 3300026116 Ga0207674_10032514 Ga0207674_100325143 239
276 3300026116 Ga0207674_10479848 Ga0207674_104798481 239
277 3300026118 Ga0207675_100001140 Ga0207675_10000114025 239
278 3300026118 Ga0207675_100044721 Ga0207675_1000447215 239
279 3300026121 Ga0207683_10213032 Ga0207683_102130322 239
280 3300026142 Ga0207698_10025235 Ga0207698_100252353 239
281 3300026142 Ga0207698_10266466 Ga0207698_102664661 239
282 3300026142 Ga0207698_10594017 Ga0207698_105940172 239
283 3300027907 Ga0207428_10094110 Ga0207428_100941103 239
284 3300028379 Ga0268266_10318517 Ga0268266_103185172 239
285 3300028379 Ga0268266_10555677 Ga0268266_105556771 239
286 3300028381 Ga0268264_10161183 Ga0268264_101611832 239
287 3300028381 Ga0268264_10229342 Ga0268264_102293421 239
288 3300028381 Ga0268264_10492329 Ga0268264_104923291 239
289 3300028577 Ga0265318_10023172 Ga0265318_100231721 239
290 3300028800 Ga0265338_10025620 Ga0265338_100256202 239
291 3300031240 Ga0265320_10138470 Ga0265320_101384701 239
292 3300031247 Ga0265340_10036728 Ga0265340_100367282 239
293 3300031548 Ga0307408_100354090 Ga0307408_1003540901 239
294 3300031548 Ga0307408_100796244 Ga0307408_1007962441 239
295 3300031665 Ga0316575_10002967 Ga0316575_100029674 239
296 3300031711 Ga0265314_10227927 Ga0265314_102279271 239
297 3300031727 Ga0316576_10120792 Ga0316576_101207923 239
298 3300031728 Ga0316578_10002596 Ga0316578_100025964 239
299 3300031824 Ga0307413_10266874 Ga0307413_102668742 239
300 3300031911 Ga0307412_10445078 Ga0307412_104450782 239
301 3300035111 Ga0373923_0222566 Ga0373923_0222566_89_820 239
302 3300035113 Ga0373936_0097233 Ga0373936_0097233_307_1038 239
303 3300035113 Ga0373936_0105099 Ga0373936_0105099_31_813 239
304 3300035119 Ga0373956_0018596 Ga0373956_0018596_613_1395 239
305 3300035207 Ga0373942_0005350 Ga0373942_0005350_1877_2617 239
306 3300035241 Ga0373961_0019652 Ga0373961_0019652_827_1609 239
307 3300035410 Ga0373924_0027155 Ga0373924_0027155_881_1663 239
308 3300035691 Ga0373931_0275758 Ga0373931_0275758_56_787 239
309 3300035692 Ga0373935_0015849 Ga0373935_0015849_1326_2057 239
310 3300035692 Ga0373935_0054720 Ga0373935_0054720_401_1183 239
311 3300035692 Ga0373935_0183844 Ga0373935_0183844_516_1298 239
312 3300035692 Ga0373935_0448006 Ga0373935_0448006_28_810 239
313 3300035695 Ga0373927_0147416 Ga0373927_0147416_266_1048 239
314 3300035695 Ga0373927_0253312 Ga0373927_0253312_264_1046 239
315 3300035724 Ga0373933_0054448 Ga0373933_0054448_1503_2276 239
316 3300035724 Ga0373933_0162209 Ga0373933_0162209_160_891 239
317 3300035724 Ga0373933_0216323 Ga0373933_0216323_211_951 239
318 3300035724 Ga0373933_0265997 Ga0373933_0265997_54_836 239
319 3300035725 Ga0373947_0012320 Ga0373947_0012320_2768_3550 239
320 3300036401 Ga0373937_0001833 Ga0373937_0001833_11442_12224 239
321 3300036401 Ga0373937_0004886 Ga0373937_0004886_6878_7660 239
322 3300036401 Ga0373937_0016991 Ga0373937_0016991_5494_6276 239
323 3300036401 Ga0373937_0061173 Ga0373937_0061173_200_931 239
324 3300036401 Ga0373937_0077515 Ga0373937_0077515_1165_1947 239
325 3300036401 Ga0373937_0134153 Ga0373937_0134153_794_1525 239
326 3300036401 Ga0373937_0354152 Ga0373937_0354152_590_1321 239
327 3300036712 Ga0316584_0008110 Ga0316584_0008110_1498_2295 239
328 3300037068 Ga0373925_0066811 Ga0373925_0066811_947_1729 239
329 3300037068 Ga0373925_0068203 Ga0373925_0068203_1013_1744 239
330 3300037068 Ga0373925_0093927 Ga0373925_0093927_354_1136 239
331 3300037466 Ga0395898_0336745 Ga0395898_0336745_138_923 239
332 3300037588 Ga0316581_0013720 Ga0316581_0013720_1320_2054 239
333 3300037853 Ga0436364_0791244 Ga0436364_0791244_5540_6424 239
334 3300038443 Ga0395901_0015644 Ga0395901_0015644_4017_4799 239
335 3300038443 Ga0395901_0018973 Ga0395901_0018973_5518_6303 239
336 3300039437 Ga0436365_0939926 Ga0436365_0939926_649_1428 239
337 3300039447 Ga0436361_0529066 Ga0436361_0529066_2388_3170 239
338 3300042001 Ga0439441_001040 Ga0439441_001040_1727_2461 239
339 3300042001 Ga0439441_017846 Ga0439441_017846_118_852 239
340 3300046454 Ga0495592_0006664 Ga0495592_0006664_191_922 239
341 3300046459 Ga0495629_0431999 Ga0495629_0431999_136_867 239
342 3300046462 Ga0495651_0007983 Ga0495651_0007983_3668_4450 239
343 3300046462 Ga0495651_0224182 Ga0495651_0224182_373_1104 239
344 3300046463 Ga0495653_0113420 Ga0495653_0113420_170_901 239
345 3300046463 Ga0495653_0174070 Ga0495653_0174070_642_1424 239
346 3300046473 Ga0495582_0257296 Ga0495582_0257296_187_918 239
347 3300046473 Ga0495582_0314455 Ga0495582_0314455_100_831 239
348 3300046475 Ga0495639_0057187 Ga0495639_0057187_863_1645 239
349 3300046476 Ga0495662_0007371 Ga0495662_0007371_59_790 239
350 3300046477 Ga0495664_0010758 Ga0495664_0010758_192_974 239
351 3300046499 Ga0495594_0303793 Ga0495594_0303793_83_814 239
352 3300046511 Ga0495608_0004164 Ga0495608_0004164_9448_10179 239
353 3300046511 Ga0495608_0038620 Ga0495608_0038620_1720_2502 239
354 3300046514 Ga0495618_0002241 Ga0495618_0002241_9653_10384 239
355 3300046516 Ga0495628_0004512 Ga0495628_0004512_5745_6476 239
356 3300046516 Ga0495628_0035410 Ga0495628_0035410_2233_2964 239
357 3300046516 Ga0495628_0085334 Ga0495628_0085334_1472_2254 239
358 3300046517 Ga0495630_0003325 Ga0495630_0003325_880_1611 239
359 3300046517 Ga0495630_0389866 Ga0495630_0389866_270_1010 239
360 3300046529 Ga0495652_0038487 Ga0495652_0038487_1590_2321 239
361 3300046533 Ga0495640_0019946 Ga0495640_0019946_1315_2046 239
362 3300046533 Ga0495640_0034762 Ga0495640_0034762_191_922 239
363 3300046535 Ga0495586_0000357 Ga0495586_0000357_15176_15907 239
364 3300046535 Ga0495586_0056110 Ga0495586_0056110_220_951 239
365 3300046539 Ga0495621_0013302 Ga0495621_0013302_238_972 239
366 3300046543 Ga0495645_0004710 Ga0495645_0004710_2446_3228 239
367 3300046543 Ga0495645_0026596 Ga0495645_0026596_2743_3474 239
368 3300046559 Ga0495667_0003174 Ga0495667_0003174_3734_4516 239
369 3300046559 Ga0495667_0016308 Ga0495667_0016308_1758_2540 239
370 3300046559 Ga0495667_0028696 Ga0495667_0028696_2813_3544 239
371 3300046642 Ga0495634_0009887 Ga0495634_0009887_2868_3599 239
372 3300046663 Ga0495635_0015581 Ga0495635_0015581_2046_2777 239
373 3300046664 Ga0495659_0145172 Ga0495659_0145172_25_759 239
374 3300046675 Ga0495657_0108505 Ga0495657_0108505_74_856 239
375 3300046678 Ga0495599_0003567 Ga0495599_0003567_900_1682 239
376 3300046678 Ga0495599_0006228 Ga0495599_0006228_2625_3356 239
377 3300046680 Ga0495646_0176689 Ga0495646_0176689_30_812 239
378 3300046683 Ga0495658_0000597 Ga0495658_0000597_7589_8320 239
379 3300046689 Ga0495613_0003374 Ga0495613_0003374_7854_8585 239
380 3300046690 Ga0495624_0035269 Ga0495624_0035269_206_937 239
381 3300046809 Ga0495600_0008355 Ga0495600_0008355_4002_4733 239
382 3300046809 Ga0495600_0066393 Ga0495600_0066393_1121_1903 239
383 3300047317 Ga0495604_0005484 Ga0495604_0005484_3582_4313 239
384 3300047317 Ga0495604_0007829 Ga0495604_0007829_3285_4067 239
385 3300047319 Ga0495674_0097461 Ga0495674_0097461_1630_2412 239
386 3300047319 Ga0495674_0299821 Ga0495674_0299821_165_896 239
387 3300047322 Ga0495680_0045703 Ga0495680_0045703_1692_2474 239
388 3300047322 Ga0495680_0074066 Ga0495680_0074066_1537_2268 239
389 3300047322 Ga0495680_0187059 Ga0495680_0187059_84_866 239
390 3300047444 Ga0495675_0005689 Ga0495675_0005689_6058_6840 239
391 3300047444 Ga0495675_0189240 Ga0495675_0189240_54_785 239
392 3300047471 Ga0495684_0038559 Ga0495684_0038559_1332_2063 239
393 3300047673 Ga0495593_0174966 Ga0495593_0174966_21_752 239
394 3300048088 Ga0495602_0015039 Ga0495602_0015039_2197_2979 239
395 3300048088 Ga0495602_0044926 Ga0495602_0044926_1252_2034 239
396 3300048088 Ga0495602_0476347 Ga0495602_0476347_69_809 239
397 3300048905 Ga0496102_0088234 Ga0496102_0088234_118_903 239
398 3300048913 Ga0496110_0275855 Ga0496110_0275855_558_1343 239
399 3300048915 Ga0496112_0464017 Ga0496112_0464017_140_922 239
400 3300048922 Ga0496119_0021389 Ga0496119_0021389_1623_2507 239
401 3300048925 Ga0496122_0065319 Ga0496122_0065319_1380_2162 239
402 3300049574 Ga0501038_0159835 Ga0501038_0159835_734_1468 239
403 3300049575 Ga0501039_0056841 Ga0501039_0056841_1621_2355 239
404 3300049575 Ga0501039_0232265 Ga0501039_0232265_129_899 239
405 3300049577 Ga0501041_0078474 Ga0501041_0078474_1215_1949 239
406 3300049587 Ga0501071_0011462 Ga0501071_0011462_4480_5214 239
407 3300049588 Ga0501072_0008383 Ga0501072_0008383_257_991 239
408 3300049589 Ga0501073_0155127 Ga0501073_0155127_665_1399 239
409 3300049590 Ga0501074_0163891 Ga0501074_0163891_460_1194 239
410 3300049591 Ga0501075_0062647 Ga0501075_0062647_1074_1808 239
411 3300049592 Ga0501076_0061554 Ga0501076_0061554_1838_2572 239
412 3300049741 Ga0501079_0015839 Ga0501079_0015839_3871_4605 239
413 3300049741 Ga0501079_0483149 Ga0501079_0483149_182_964 239
414 3300049742 Ga0501080_0004531 Ga0501080_0004531_5187_5921 239
415 3300049742 Ga0501080_0231344 Ga0501080_0231344_468_1253 239
416 3300049743 Ga0501081_0112537 Ga0501081_0112537_106_840 239
417 3300049744 Ga0501083_0108377 Ga0501083_0108377_922_1704 239
418 3300050489 nmdc:mga03683_19664_c1 nmdc:mga03683_19664_c1_1040_1825 239
419 3300050490 nmdc:mga03n38_13513_c1 nmdc:mga03n38_13513_c1_346_1131 239
420 3300050491 nmdc:mga00v17_11498_c1 nmdc:mga00v17_11498_c1_3839_4624 239
421 3300050491 nmdc:mga00v17_141_c1 nmdc:mga00v17_141_c1_6634_7416 239
422 3300050492 nmdc:mga0yw44_164435_c1 nmdc:mga0yw44_164435_c1_560_1345 239
423 3300050492 nmdc:mga0yw44_45121_c1 nmdc:mga0yw44_45121_c1_261_1046 239
424 3300050494 nmdc:mga06z11_104995_c1 nmdc:mga06z11_104995_c1_669_1454 239
425 3300050507 nmdc:mga05p37_1971_c1 nmdc:mga05p37_1971_c1_15401_16135 239
426 3300050507 nmdc:mga05p37_42418_c1 nmdc:mga05p37_42418_c1_2713_3450 239
427 3300050507 nmdc:mga05p37_752152_c1 nmdc:mga05p37_752152_c1_222_953 239
428 3300050508 nmdc:mga09592_1325_c1 nmdc:mga09592_1325_c1_15185_15919 239
429 3300050508 nmdc:mga09592_46867_c1 nmdc:mga09592_46867_c1_1404_2135 239
430 3300050508 nmdc:mga09592_87527_c1 nmdc:mga09592_87527_c1_1674_2411 239
431 3300050509 nmdc:mga0qj67_189408_c1 nmdc:mga0qj67_189408_c1_184_918 239
432 3300050510 nmdc:mga06r32_106425_c1 nmdc:mga06r32_106425_c1_747_1484 239
433 3300050510 nmdc:mga06r32_26639_c1 nmdc:mga06r32_26639_c1_4461_5276 239
434 3300050510 nmdc:mga06r32_39520_c1 nmdc:mga06r32_39520_c1_2048_2782 239
435 3300050510 nmdc:mga06r32_74966_c1 nmdc:mga06r32_74966_c1_1050_1784 239
436 3300050511 nmdc:mga08y16_26724_c1 nmdc:mga08y16_26724_c1_1575_2306 239
437 3300050511 nmdc:mga08y16_551536_c1 nmdc:mga08y16_551536_c1_152_886 239
438 3300050513 nmdc:mga0rr50_4776_c1 nmdc:mga0rr50_4776_c1_6488_7231 239
439 3300053077 Ga0495601_0006347 Ga0495601_0006347_4207_4938 239
440 3300053077 Ga0495601_0015635 Ga0495601_0015635_3735_4517 239
441 3300053084 Ga0495595_0013421 Ga0495595_0013421_1347_2129 239
442 3300053084 Ga0495595_0033483 Ga0495595_0033483_1135_1917 239
443 3300054114 Ga0501084_0127818 Ga0501084_0127818_1303_2037 239
444 3300060353 Ga0501082_0000202 Ga0501082_0000202_44205_44987 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

42

233

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

288

0.89

PF08659

KR

KR domain

42

214

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

44

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9484 4 166
5vps-assembly1.cif.gz_A crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct 0.9402 1 239
5vps-assembly1.cif.gz_A crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct 0.9365 1 239
5va8-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase/reductase sdr from burkholderia phymatum in complex with nadp 0.9305 1 239
6jhb-assembly1.cif.gz_B-2 crystal structure of nadph and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa 0.9294 1 236
ID Description Score Start End Superfamily
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 4 166 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 71 171 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 5 176 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9378 65 234 3.40.50.720
af_Q53GQ0_49_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9308 7 174 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R1IQH4-F1-model_v4 deleted 0.9714 1 238
AF-A0A1H1KN24-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9701 1 239 GO:0016491
AF-A0A7Z0FCU5-F1-model_v4 deleted 0.9693 96 238
AF-A0A1H1KN24-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9662 1 239 GO:0016491
AF-A0A6F8NHQ1-F1-model_v4 deleted 0.9647 1 238

Feature Viewer

pLDDT pTM Quality
92.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map