F445325
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 444 | 264 | 437 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0791244|Ga0436364_0791244_5540_6424 |
| Length | 294 |
| Sequence | MKDHARAVFPAGTGIAHSSLVHHCPTDRAGKDNGMDLNLRGKTALVTGASKGIGRASAEALAEEGVNVILVSRTHADLDAVRDSIAARWNVRVEVHAFDISDSANVDRLAALHPDIDILVNNAGAIPGGNLQEVDERRWREAWDLKVYGYINMCRRFYALMKQRGRGVIINILGMAGERMDVGYIAGSAGNAGLMAFTRTLGGAASADNLRVVGINPGAIATDRLVTIMKKRAQDRLGDAGRWEELMQPLPFGRAGTPEEIGSMVAFLSSDKSAYTTGTIITIDGGAANRGPMF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 2 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 3 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 4 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 5 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 161 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 187 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 249 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 250 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 252 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 0 |
| Isolates | 1.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.83 |
| Nodule | 0 |
| Rhizoplane | 0.9 |
| Rhizosphere | 92.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10362135 | 3300003323 | Bacteria | 2048 |
| 2 | Ga0065707_10011384 | 3300005295 | Bacteria | 3181 |
| 3 | Ga0070658_10025736 | 3300005327 | Bacteria | 4717 |
| 4 | Ga0070683_100137867 | 3300005329 | Bacteria | 2311 |
| 5 | Ga0070683_100614817 | 3300005329 | Bacteria | 1040 |
| 6 | Ga0070690_100001285 | 3300005330 | Bacteria | 13046 |
| 7 | Ga0070690_100082118 | 3300005330 | Bacteria | 2110 |
| 8 | Ga0068869_100006971 | 3300005334 | Bacteria | 7193 |
| 9 | Ga0070680_100218347 | 3300005336 | Bacteria | 1609 |
| 10 | Ga0070682_100217373 | 3300005337 | Unclassified | 1358 |
| 11 | Ga0068868_100110066 | 3300005338 | Bacteria | 2238 |
| 12 | Ga0070689_100002710 | 3300005340 | Bacteria | 11597 |
| 13 | Ga0070689_100103954 | 3300005340 | Bacteria | 2252 |
| 14 | Ga0070689_100149134 | 3300005340 | Bacteria | 1885 |
| 15 | Ga0070689_100247175 | 3300005340 | Bacteria | 1471 |
| 16 | Ga0070691_10037041 | 3300005341 | Bacteria | 2300 |
| 17 | Ga0070661_100363077 | 3300005344 | Bacteria | 1138 |
| 18 | Ga0070692_10049261 | 3300005345 | Bacteria | 2185 |
| 19 | Ga0070692_10064038 | 3300005345 | Bacteria | 1944 |
| 20 | Ga0070668_100451438 | 3300005347 | Bacteria | 1105 |
| 21 | Ga0070675_100088213 | 3300005354 | Bacteria | 2595 |
| 22 | Ga0070675_100291167 | 3300005354 | Bacteria | 1437 |
| 23 | Ga0070675_100406829 | 3300005354 | Bacteria | 1215 |
| 24 | Ga0070674_100262936 | 3300005356 | Unclassified | 1360 |
| 25 | Ga0070673_100638087 | 3300005364 | Bacteria | 974 |
| 26 | Ga0070659_100050422 | 3300005366 | Bacteria | 3272 |
| 27 | Ga0070714_100017355 | 3300005435 | Bacteria | 5829 |
| 28 | Ga0070713_100056501 | 3300005436 | Bacteria | 3265 |
| 29 | Ga0070710_10202872 | 3300005437 | Bacteria | 1253 |
| 30 | Ga0070701_10131669 | 3300005438 | Bacteria | 1421 |
| 31 | Ga0070711_100309894 | 3300005439 | Bacteria | 1258 |
| 32 | Ga0070705_100038896 | 3300005440 | Bacteria | 2696 |
| 33 | Ga0070700_100001566 | 3300005441 | Bacteria | 11409 |
| 34 | Ga0070700_100326976 | 3300005441 | Bacteria | 1128 |
| 35 | Ga0070700_100331292 | 3300005441 | Bacteria | 1122 |
| 36 | Ga0070694_100010450 | 3300005444 | Bacteria | 5728 |
| 37 | Ga0070694_100105544 | 3300005444 | Bacteria | 1999 |
| 38 | Ga0070694_100160746 | 3300005444 | Bacteria | 1648 |
| 39 | Ga0070694_100220713 | 3300005444 | Bacteria | 1421 |
| 40 | Ga0070678_100029867 | 3300005456 | Bacteria | 3739 |
| 41 | Ga0070678_100141254 | 3300005456 | Bacteria | 1927 |
| 42 | Ga0070662_100130383 | 3300005457 | Bacteria | 1938 |
| 43 | Ga0070681_10023435 | 3300005458 | Bacteria | 6207 |
| 44 | Ga0070681_10255324 | 3300005458 | Bacteria | 1665 |
| 45 | Ga0068867_100007546 | 3300005459 | Bacteria | 7694 |
| 46 | Ga0070707_100120467 | 3300005468 | Bacteria | 2547 |
| 47 | Ga0070707_100647764 | 3300005468 | Bacteria | 1019 |
| 48 | Ga0070698_100017628 | 3300005471 | Bacteria | 7524 |
| 49 | Ga0070699_100204595 | 3300005518 | Bacteria | 1756 |
| 50 | Ga0070699_100259601 | 3300005518 | Bacteria | 1554 |
| 51 | Ga0070679_100045173 | 3300005530 | Bacteria | 4390 |
| 52 | Ga0070679_100181332 | 3300005530 | Bacteria | 2078 |
| 53 | Ga0070679_100214137 | 3300005530 | Bacteria | 1889 |
| 54 | Ga0070697_100303013 | 3300005536 | Bacteria | 1374 |
| 55 | Ga0068853_100003905 | 3300005539 | Bacteria | 11429 |
| 56 | Ga0068853_100413638 | 3300005539 | Bacteria | 1264 |
| 57 | Ga0068853_100624687 | 3300005539 | Bacteria | 1024 |
| 58 | Ga0070695_100009851 | 3300005545 | Bacteria | 5693 |
| 59 | Ga0070695_100250631 | 3300005545 | Bacteria | 1289 |
| 60 | Ga0070695_100251024 | 3300005545 | Unclassified | 1288 |
| 61 | Ga0070696_100204497 | 3300005546 | Bacteria | 1475 |
| 62 | Ga0070696_100483047 | 3300005546 | Bacteria | 983 |
| 63 | Ga0070693_100234387 | 3300005547 | Unclassified | 1209 |
| 64 | Ga0070693_100371408 | 3300005547 | Bacteria | 984 |
| 65 | Ga0070665_100478402 | 3300005548 | Bacteria | 1256 |
| 66 | Ga0070704_100012262 | 3300005549 | Bacteria | 5292 |
| 67 | Ga0070704_100134083 | 3300005549 | Bacteria | 1924 |
| 68 | Ga0070704_100143831 | 3300005549 | Bacteria | 1866 |
| 69 | Ga0070704_100179765 | 3300005549 | Bacteria | 1691 |
| 70 | Ga0070704_100274104 | 3300005549 | Bacteria | 1395 |
| 71 | Ga0068855_100053404 | 3300005563 | Bacteria | 4754 |
| 72 | Ga0068855_100148961 | 3300005563 | Bacteria | 2661 |
| 73 | Ga0068855_100252250 | 3300005563 | Bacteria | 1968 |
| 74 | Ga0068855_100261374 | 3300005563 | Bacteria | 1928 |
| 75 | Ga0068855_100451518 | 3300005563 | Bacteria | 1403 |
| 76 | Ga0070664_100235583 | 3300005564 | Bacteria | 1642 |
| 77 | Ga0070664_100558307 | 3300005564 | Unclassified | 1059 |
| 78 | Ga0068857_100118893 | 3300005577 | Bacteria | 2378 |
| 79 | Ga0068857_100143991 | 3300005577 | Bacteria | 2156 |
| 80 | Ga0068856_100093284 | 3300005614 | Bacteria | 2996 |
| 81 | Ga0068856_100269613 | 3300005614 | Bacteria | 1718 |
| 82 | Ga0068856_100299792 | 3300005614 | Bacteria | 1625 |
| 83 | Ga0068856_100630284 | 3300005614 | Bacteria | 1093 |
| 84 | Ga0070702_100000237 | 3300005615 | Bacteria | 18638 |
| 85 | Ga0070702_100126981 | 3300005615 | Bacteria | 1605 |
| 86 | Ga0070702_100434719 | 3300005615 | Bacteria | 948 |
| 87 | Ga0068852_100018400 | 3300005616 | Bacteria | 5503 |
| 88 | Ga0068852_100129924 | 3300005616 | Bacteria | 2318 |
| 89 | Ga0068852_100630562 | 3300005616 | Bacteria | 1078 |
| 90 | Ga0068859_100013168 | 3300005617 | Bacteria | 8307 |
| 91 | Ga0068859_100092838 | 3300005617 | Bacteria | 3070 |
| 92 | Ga0068859_100106055 | 3300005617 | Bacteria | 2869 |
| 93 | Ga0068864_100358464 | 3300005618 | Bacteria | 1377 |
| 94 | Ga0068866_10002731 | 3300005718 | Bacteria | 7280 |
| 95 | Ga0068866_10114527 | 3300005718 | Bacteria | 1510 |
| 96 | Ga0068861_100729414 | 3300005719 | Bacteria | 924 |
| 97 | Ga0068863_100159056 | 3300005841 | Bacteria | 2164 |
| 98 | Ga0068863_100518460 | 3300005841 | Bacteria | 1175 |
| 99 | Ga0068863_100655913 | 3300005841 | Bacteria | 1041 |
| 100 | Ga0068858_100039659 | 3300005842 | Bacteria | 4367 |
| 101 | Ga0068858_100369953 | 3300005842 | Unclassified | 1374 |
| 102 | Ga0068860_100317767 | 3300005843 | Bacteria | 1528 |
| 103 | Ga0068862_100007234 | 3300005844 | Bacteria | 9216 |
| 104 | Ga0068862_100118531 | 3300005844 | Bacteria | 2330 |
| 105 | Ga0068862_100213762 | 3300005844 | Bacteria | 1743 |
| 106 | Ga0081538_10050028 | 3300005981 | Bacteria | 2529 |
| 107 | Ga0070717_10052286 | 3300006028 | Bacteria | 3365 |
| 108 | Ga0070717_10095075 | 3300006028 | Bacteria | 2522 |
| 109 | Ga0075365_10070467 | 3300006038 | Bacteria | 2351 |
| 110 | Ga0075365_10134770 | 3300006038 | Bacteria | 1711 |
| 111 | Ga0075368_10040451 | 3300006042 | Bacteria | 1831 |
| 112 | Ga0075363_100028057 | 3300006048 | Bacteria | 2892 |
| 113 | Ga0075364_10000241 | 3300006051 | Bacteria | 26213 |
| 114 | Ga0075364_10026214 | 3300006051 | Bacteria | 3716 |
| 115 | Ga0070712_100019293 | 3300006175 | Bacteria | 4446 |
| 116 | Ga0075367_10117475 | 3300006178 | Bacteria | 1637 |
| 117 | Ga0097621_100054741 | 3300006237 | Unclassified | 3255 |
| 118 | Ga0075370_10047195 | 3300006353 | Bacteria | 2439 |
| 119 | Ga0068871_100004155 | 3300006358 | Bacteria | 10022 |
| 120 | Ga0068871_100229223 | 3300006358 | Bacteria | 1612 |
| 121 | Ga0075428_100062352 | 3300006844 | Bacteria | 4082 |
| 122 | Ga0075430_100015812 | 3300006846 | Bacteria | 6426 |
| 123 | Ga0075431_100000345 | 3300006847 | Bacteria | 36593 |
| 124 | Ga0075431_100092424 | 3300006847 | Bacteria | 3123 |
| 125 | Ga0075434_100016926 | 3300006871 | Bacteria | 7013 |
| 126 | Ga0075429_100008907 | 3300006880 | Bacteria | 8722 |
| 127 | Ga0075429_100139138 | 3300006880 | Bacteria | 2125 |
| 128 | Ga0068865_100018161 | 3300006881 | Bacteria | 4535 |
| 129 | Ga0097620_100013168 | 3300006931 | Bacteria | 8307 |
| 130 | Ga0097620_100092838 | 3300006931 | Bacteria | 3070 |
| 131 | Ga0097620_100106056 | 3300006931 | Bacteria | 2869 |
| 132 | Ga0075435_100066028 | 3300007076 | Bacteria | 2942 |
| 133 | Ga0075435_100150535 | 3300007076 | Bacteria | 1956 |
| 134 | Ga0075435_100305072 | 3300007076 | Bacteria | 1362 |
| 135 | Ga0111539_10037614 | 3300009094 | Bacteria | 5843 |
| 136 | Ga0111539_10122500 | 3300009094 | Bacteria | 3047 |
| 137 | Ga0111539_11269060 | 3300009094 | Bacteria | 855 |
| 138 | Ga0105245_10001256 | 3300009098 | Bacteria | 22910 |
| 139 | Ga0105245_10150347 | 3300009098 | Bacteria | 2201 |
| 140 | Ga0105247_10145517 | 3300009101 | Bacteria | 1557 |
| 141 | Ga0105247_10188450 | 3300009101 | Bacteria | 1380 |
| 142 | Ga0114129_10016707 | 3300009147 | Bacteria | 10452 |
| 143 | Ga0114129_10025697 | 3300009147 | Bacteria | 8342 |
| 144 | Ga0114129_10315265 | 3300009147 | Bacteria | 2080 |
| 145 | Ga0114129_10357984 | 3300009147 | Bacteria | 1931 |
| 146 | Ga0105243_10002945 | 3300009148 | Bacteria | 14074 |
| 147 | Ga0105243_10070629 | 3300009148 | Bacteria | 2820 |
| 148 | Ga0105243_10096667 | 3300009148 | Bacteria | 2444 |
| 149 | Ga0105241_10024794 | 3300009174 | Bacteria | 4455 |
| 150 | Ga0105241_10165119 | 3300009174 | Bacteria | 1824 |
| 151 | Ga0105242_10005883 | 3300009176 | Bacteria | 9453 |
| 152 | Ga0105242_10129260 | 3300009176 | Bacteria | 2178 |
| 153 | Ga0105248_10125263 | 3300009177 | Bacteria | 2898 |
| 154 | Ga0105248_10126240 | 3300009177 | Bacteria | 2886 |
| 155 | Ga0105248_10395056 | 3300009177 | Bacteria | 1557 |
| 156 | Ga0105237_10052902 | 3300009545 | Bacteria | 4074 |
| 157 | Ga0105237_10450660 | 3300009545 | Bacteria | 1293 |
| 158 | Ga0105239_10084845 | 3300010375 | Bacteria | 3489 |
| 159 | Ga0105239_10119348 | 3300010375 | Bacteria | 2927 |
| 160 | Ga0105246_10228760 | 3300011119 | Unclassified | 1463 |
| 161 | Ga0157371_10034562 | 3300013102 | Bacteria | 3625 |
| 162 | Ga0157369_10127325 | 3300013105 | Bacteria | 2699 |
| 163 | Ga0157369_10153003 | 3300013105 | Bacteria | 2438 |
| 164 | Ga0157374_10412702 | 3300013296 | Unclassified | 1348 |
| 165 | Ga0157378_10010883 | 3300013297 | Bacteria | 7956 |
| 166 | Ga0157378_10163178 | 3300013297 | Bacteria | 2085 |
| 167 | Ga0157378_10222064 | 3300013297 | Bacteria | 1797 |
| 168 | Ga0163162_10203572 | 3300013306 | Bacteria | 2108 |
| 169 | Ga0163162_10305949 | 3300013306 | Bacteria | 1722 |
| 170 | Ga0163162_10504341 | 3300013306 | Bacteria | 1340 |
| 171 | Ga0157372_10420866 | 3300013307 | Bacteria | 1557 |
| 172 | Ga0157375_10053895 | 3300013308 | Bacteria | 3960 |
| 173 | Ga0157375_10379800 | 3300013308 | Bacteria | 1580 |
| 174 | Ga0163163_10459131 | 3300014325 | Bacteria | 1334 |
| 175 | Ga0157380_10027371 | 3300014326 | Bacteria | 4336 |
| 176 | Ga0157380_10037204 | 3300014326 | Bacteria | 3769 |
| 177 | Ga0182008_10010870 | 3300014497 | Bacteria | 4856 |
| 178 | Ga0157379_10025335 | 3300014968 | Bacteria | 5269 |
| 179 | Ga0157379_10314638 | 3300014968 | Bacteria | 1429 |
| 180 | Ga0157379_10580009 | 3300014968 | Bacteria | 1045 |
| 181 | Ga0157376_10021851 | 3300014969 | Bacteria | 4975 |
| 182 | Ga0157376_10120371 | 3300014969 | Bacteria | 2326 |
| 183 | Ga0157376_10558426 | 3300014969 | Unclassified | 1134 |
| 184 | Ga0163161_10294169 | 3300017792 | Bacteria | 1277 |
| 185 | Ga0213872_10045318 | 3300021361 | Bacteria | 2001 |
| 186 | Ga0213875_10019036 | 3300021388 | Bacteria | 3305 |
| 187 | Ga0209025_1043690 | 3300025294 | Bacteria | 1884 |
| 188 | Ga0207642_10037565 | 3300025899 | Bacteria | 2088 |
| 189 | Ga0207642_10123692 | 3300025899 | Bacteria | 1339 |
| 190 | Ga0207710_10161695 | 3300025900 | Bacteria | 1091 |
| 191 | Ga0207685_10174906 | 3300025905 | Bacteria | 991 |
| 192 | Ga0207699_10327010 | 3300025906 | Bacteria | 1077 |
| 193 | Ga0207645_10185288 | 3300025907 | Unclassified | 1366 |
| 194 | Ga0207643_10008619 | 3300025908 | Bacteria | 5468 |
| 195 | Ga0207705_10003527 | 3300025909 | Bacteria | 11915 |
| 196 | Ga0207684_10150418 | 3300025910 | Bacteria | 2003 |
| 197 | Ga0207654_10104047 | 3300025911 | Bacteria | 1754 |
| 198 | Ga0207707_10027093 | 3300025912 | Bacteria | 5011 |
| 199 | Ga0207707_10037546 | 3300025912 | Unclassified | 4234 |
| 200 | Ga0207707_10357101 | 3300025912 | Bacteria | 1258 |
| 201 | Ga0207693_10058627 | 3300025915 | Bacteria | 3016 |
| 202 | Ga0207663_10029222 | 3300025916 | Bacteria | 3235 |
| 203 | Ga0207663_10359291 | 3300025916 | Bacteria | 1105 |
| 204 | Ga0207662_10496419 | 3300025918 | Bacteria | 840 |
| 205 | Ga0207652_10337141 | 3300025921 | Bacteria | 1361 |
| 206 | Ga0207652_10342131 | 3300025921 | Bacteria | 1350 |
| 207 | Ga0207652_10400188 | 3300025921 | Bacteria | 1239 |
| 208 | Ga0207681_10668839 | 3300025923 | Bacteria | 862 |
| 209 | Ga0207694_10091126 | 3300025924 | Bacteria | 2406 |
| 210 | Ga0207659_10313731 | 3300025926 | Bacteria | 1292 |
| 211 | Ga0207687_10349989 | 3300025927 | Bacteria | 1203 |
| 212 | Ga0207700_10409350 | 3300025928 | Bacteria | 1190 |
| 213 | Ga0207664_10263985 | 3300025929 | Bacteria | 1506 |
| 214 | Ga0207706_10180899 | 3300025933 | Bacteria | 1852 |
| 215 | Ga0207706_10417738 | 3300025933 | Bacteria | 1162 |
| 216 | Ga0207686_10075836 | 3300025934 | Bacteria | 2178 |
| 217 | Ga0207686_10133399 | 3300025934 | Bacteria | 1706 |
| 218 | Ga0207709_10039940 | 3300025935 | Bacteria | 2806 |
| 219 | Ga0207709_10254106 | 3300025935 | Bacteria | 1285 |
| 220 | Ga0207670_10025421 | 3300025936 | Bacteria | 3716 |
| 221 | Ga0207670_10043420 | 3300025936 | Bacteria | 2969 |
| 222 | Ga0207670_10047857 | 3300025936 | Bacteria | 2851 |
| 223 | Ga0207670_10137729 | 3300025936 | Bacteria | 1797 |
| 224 | Ga0207670_10464318 | 3300025936 | Bacteria | 1023 |
| 225 | Ga0207669_10033605 | 3300025937 | Bacteria | 2897 |
| 226 | Ga0207691_10286426 | 3300025940 | Bacteria | 1417 |
| 227 | Ga0207689_10000519 | 3300025942 | Bacteria | 36612 |
| 228 | Ga0207689_10021940 | 3300025942 | Bacteria | 5369 |
| 229 | Ga0207667_10096026 | 3300025949 | Bacteria | 3059 |
| 230 | Ga0207667_10178598 | 3300025949 | Bacteria | 2180 |
| 231 | Ga0207667_10222543 | 3300025949 | Bacteria | 1933 |
| 232 | Ga0207651_10434638 | 3300025960 | Bacteria | 1123 |
| 233 | Ga0207712_10074792 | 3300025961 | Bacteria | 2447 |
| 234 | Ga0207658_10433104 | 3300025986 | Bacteria | 1162 |
| 235 | Ga0207677_10127689 | 3300026023 | Bacteria | 1925 |
| 236 | Ga0207677_10376906 | 3300026023 | Bacteria | 1196 |
| 237 | Ga0207703_10276705 | 3300026035 | Bacteria | 1523 |
| 238 | Ga0207703_10405804 | 3300026035 | Bacteria | 1265 |
| 239 | Ga0207639_10003694 | 3300026041 | Bacteria | 10289 |
| 240 | Ga0207639_10564687 | 3300026041 | Bacteria | 1046 |
| 241 | Ga0207708_10001346 | 3300026075 | Bacteria | 18481 |
| 242 | Ga0207708_10140751 | 3300026075 | Bacteria | 1892 |
| 243 | Ga0207708_10398505 | 3300026075 | Bacteria | 1138 |
| 244 | Ga0207702_10036799 | 3300026078 | Bacteria | 4095 |
| 245 | Ga0207641_10506765 | 3300026088 | Bacteria | 1173 |
| 246 | Ga0207641_10612487 | 3300026088 | Bacteria | 1067 |
| 247 | Ga0207648_10000461 | 3300026089 | Bacteria | 45235 |
| 248 | Ga0207676_10385824 | 3300026095 | Bacteria | 1305 |
| 249 | Ga0207674_10032514 | 3300026116 | Bacteria | 5472 |
| 250 | Ga0207674_10479848 | 3300026116 | Bacteria | 1202 |
| 251 | Ga0207675_100001140 | 3300026118 | Bacteria | 26326 |
| 252 | Ga0207675_100044721 | 3300026118 | Bacteria | 4138 |
| 253 | Ga0207675_100285103 | 3300026118 | Bacteria | 1605 |
| 254 | Ga0207683_10213032 | 3300026121 | Bacteria | 1759 |
| 255 | Ga0207698_10025235 | 3300026142 | Bacteria | 4183 |
| 256 | Ga0207698_10143871 | 3300026142 | Unclassified | 2059 |
| 257 | Ga0207698_10266466 | 3300026142 | Bacteria | 1577 |
| 258 | Ga0207698_10594017 | 3300026142 | Bacteria | 1091 |
| 259 | Ga0207428_10094110 | 3300027907 | Bacteria | 2323 |
| 260 | Ga0268266_10318517 | 3300028379 | Bacteria | 1455 |
| 261 | Ga0268266_10555677 | 3300028379 | Bacteria | 1100 |
| 262 | Ga0268264_10161183 | 3300028381 | Unclassified | 2020 |
| 263 | Ga0268264_10229342 | 3300028381 | Bacteria | 1714 |
| 264 | Ga0268264_10492329 | 3300028381 | Bacteria | 1194 |
| 265 | Ga0265318_10023172 | 3300028577 | Bacteria | 2476 |
| 266 | Ga0265338_10025620 | 3300028800 | Bacteria | 5979 |
| 267 | Ga0265320_10138470 | 3300031240 | Bacteria | 1103 |
| 268 | Ga0265340_10036728 | 3300031247 | Bacteria | 2427 |
| 269 | Ga0307408_100354090 | 3300031548 | Bacteria | 1247 |
| 270 | Ga0307408_100796244 | 3300031548 | Bacteria | 857 |
| 271 | Ga0316575_10002967 | 3300031665 | Bacteria | 5773 |
| 272 | Ga0316575_10014233 | 3300031665 | Bacteria | 2983 |
| 273 | Ga0265314_10227927 | 3300031711 | Bacteria | 1083 |
| 274 | Ga0316576_10120792 | 3300031727 | Bacteria | 1967 |
| 275 | Ga0316578_10002596 | 3300031728 | Bacteria | 7997 |
| 276 | Ga0307413_10266874 | 3300031824 | Bacteria | 1279 |
| 277 | Ga0307412_10445078 | 3300031911 | Bacteria | 1066 |
| 278 | Ga0373934_0214821 | 3300035086 | Bacteria | 793 |
| 279 | Ga0373923_0222566 | 3300035111 | Bacteria | 877 |
| 280 | Ga0373936_0097233 | 3300035113 | Bacteria | 1239 |
| 281 | Ga0373936_0105099 | 3300035113 | Bacteria | 1194 |
| 282 | Ga0373936_0165752 | 3300035113 | Bacteria | 964 |
| 283 | Ga0373954_0062680 | 3300035118 | Bacteria | 1757 |
| 284 | Ga0373956_0018596 | 3300035119 | Bacteria | 2943 |
| 285 | Ga0373942_0005350 | 3300035207 | Bacteria | 2979 |
| 286 | Ga0373961_0019652 | 3300035241 | Bacteria | 1777 |
| 287 | Ga0373924_0027155 | 3300035410 | Bacteria | 2275 |
| 288 | Ga0373931_0275758 | 3300035691 | Bacteria | 1031 |
| 289 | Ga0373935_0015849 | 3300035692 | Bacteria | 4561 |
| 290 | Ga0373935_0054720 | 3300035692 | Bacteria | 2542 |
| 291 | Ga0373935_0183844 | 3300035692 | Bacteria | 1436 |
| 292 | Ga0373935_0448006 | 3300035692 | Bacteria | 932 |
| 293 | Ga0373927_0147416 | 3300035695 | Bacteria | 1541 |
| 294 | Ga0373927_0253312 | 3300035695 | Bacteria | 1157 |
| 295 | Ga0373933_0054448 | 3300035724 | Bacteria | 2398 |
| 296 | Ga0373933_0162209 | 3300035724 | Bacteria | 1420 |
| 297 | Ga0373933_0216323 | 3300035724 | Bacteria | 1229 |
| 298 | Ga0373933_0265997 | 3300035724 | Bacteria | 1106 |
| 299 | Ga0373947_0012320 | 3300035725 | Bacteria | 4901 |
| 300 | Ga0373937_0001833 | 3300036401 | Bacteria | 17856 |
| 301 | Ga0373937_0004886 | 3300036401 | Bacteria | 11394 |
| 302 | Ga0373937_0016991 | 3300036401 | Bacteria | 6471 |
| 303 | Ga0373937_0061173 | 3300036401 | Bacteria | 3461 |
| 304 | Ga0373937_0077515 | 3300036401 | Bacteria | 3071 |
| 305 | Ga0373937_0134153 | 3300036401 | Bacteria | 2314 |
| 306 | Ga0373937_0354152 | 3300036401 | Bacteria | 1391 |
| 307 | Ga0316584_0008110 | 3300036712 | Bacteria | 7216 |
| 308 | Ga0373925_0066811 | 3300037068 | Bacteria | 2711 |
| 309 | Ga0373925_0068203 | 3300037068 | Bacteria | 2684 |
| 310 | Ga0373925_0093927 | 3300037068 | Bacteria | 2296 |
| 311 | Ga0395898_0336745 | 3300037466 | Bacteria | 1439 |
| 312 | Ga0316581_0013720 | 3300037588 | Bacteria | 2301 |
| 313 | Ga0436364_0791244 | 3300037853 | Bacteria | 7761 |
| 314 | Ga0395901_0015644 | 3300038443 | Bacteria | 7727 |
| 315 | Ga0395901_0018973 | 3300038443 | Bacteria | 7032 |
| 316 | Ga0400483_177006 | 3300039062 | Bacteria | 4117 |
| 317 | Ga0436365_0939926 | 3300039437 | Bacteria | 2074 |
| 318 | Ga0436361_0529066 | 3300039447 | Bacteria | 3432 |
| 319 | Ga0439441_001040 | 3300042001 | Bacteria | 3439 |
| 320 | Ga0439441_017846 | 3300042001 | Bacteria | 1279 |
| 321 | Ga0495592_0006664 | 3300046454 | Bacteria | 8608 |
| 322 | Ga0495629_0431999 | 3300046459 | Bacteria | 893 |
| 323 | Ga0495651_0007983 | 3300046462 | Bacteria | 8115 |
| 324 | Ga0495651_0224182 | 3300046462 | Bacteria | 1299 |
| 325 | Ga0495653_0113420 | 3300046463 | Bacteria | 1944 |
| 326 | Ga0495653_0174070 | 3300046463 | Bacteria | 1483 |
| 327 | Ga0495582_0257296 | 3300046473 | Bacteria | 1001 |
| 328 | Ga0495582_0314455 | 3300046473 | Bacteria | 901 |
| 329 | Ga0495639_0057187 | 3300046475 | Bacteria | 1782 |
| 330 | Ga0495662_0007371 | 3300046476 | Bacteria | 5436 |
| 331 | Ga0495664_0010758 | 3300046477 | Bacteria | 5142 |
| 332 | Ga0495594_0303793 | 3300046499 | Bacteria | 909 |
| 333 | Ga0495608_0004164 | 3300046511 | Bacteria | 10369 |
| 334 | Ga0495608_0038620 | 3300046511 | Bacteria | 3205 |
| 335 | Ga0495618_0002241 | 3300046514 | Bacteria | 12565 |
| 336 | Ga0495628_0004512 | 3300046516 | Bacteria | 12336 |
| 337 | Ga0495628_0035410 | 3300046516 | Bacteria | 4012 |
| 338 | Ga0495628_0085334 | 3300046516 | Bacteria | 2450 |
| 339 | Ga0495630_0003325 | 3300046517 | Bacteria | 11202 |
| 340 | Ga0495630_0389866 | 3300046517 | Bacteria | 1067 |
| 341 | Ga0495652_0038487 | 3300046529 | Bacteria | 4143 |
| 342 | Ga0495640_0019946 | 3300046533 | Bacteria | 4944 |
| 343 | Ga0495640_0034762 | 3300046533 | Bacteria | 3569 |
| 344 | Ga0495586_0000357 | 3300046535 | Bacteria | 28588 |
| 345 | Ga0495586_0056110 | 3300046535 | Bacteria | 2136 |
| 346 | Ga0495621_0013302 | 3300046539 | Bacteria | 2583 |
| 347 | Ga0495645_0004710 | 3300046543 | Bacteria | 9317 |
| 348 | Ga0495645_0026596 | 3300046543 | Bacteria | 4201 |
| 349 | Ga0495667_0003174 | 3300046559 | Bacteria | 11019 |
| 350 | Ga0495667_0016308 | 3300046559 | Bacteria | 5020 |
| 351 | Ga0495667_0028696 | 3300046559 | Bacteria | 3747 |
| 352 | Ga0495634_0009887 | 3300046642 | Bacteria | 7014 |
| 353 | Ga0495635_0015581 | 3300046663 | Bacteria | 5313 |
| 354 | Ga0495659_0145172 | 3300046664 | Bacteria | 950 |
| 355 | Ga0495657_0108505 | 3300046675 | Bacteria | 1761 |
| 356 | Ga0495599_0003567 | 3300046678 | Bacteria | 9116 |
| 357 | Ga0495599_0006228 | 3300046678 | Bacteria | 7191 |
| 358 | Ga0495646_0176689 | 3300046680 | Bacteria | 1174 |
| 359 | Ga0495658_0000597 | 3300046683 | Bacteria | 19759 |
| 360 | Ga0495613_0003374 | 3300046689 | Bacteria | 11935 |
| 361 | Ga0495624_0035269 | 3300046690 | Bacteria | 3230 |
| 362 | Ga0495600_0008355 | 3300046809 | Bacteria | 6357 |
| 363 | Ga0495600_0066393 | 3300046809 | Bacteria | 2358 |
| 364 | Ga0495604_0005484 | 3300047317 | Bacteria | 10058 |
| 365 | Ga0495604_0007829 | 3300047317 | Bacteria | 8458 |
| 366 | Ga0495674_0097461 | 3300047319 | Bacteria | 2505 |
| 367 | Ga0495674_0299821 | 3300047319 | Bacteria | 1313 |
| 368 | Ga0495676_0063361 | 3300047321 | Bacteria | 2882 |
| 369 | Ga0495680_0045703 | 3300047322 | Bacteria | 3457 |
| 370 | Ga0495680_0074066 | 3300047322 | Bacteria | 2586 |
| 371 | Ga0495680_0187059 | 3300047322 | Bacteria | 1491 |
| 372 | Ga0495675_0005689 | 3300047444 | Bacteria | 7618 |
| 373 | Ga0495675_0189240 | 3300047444 | Bacteria | 1257 |
| 374 | Ga0495684_0038559 | 3300047471 | Bacteria | 3663 |
| 375 | Ga0495593_0174966 | 3300047673 | Bacteria | 1081 |
| 376 | Ga0495602_0015039 | 3300048088 | Bacteria | 7826 |
| 377 | Ga0495602_0044926 | 3300048088 | Bacteria | 4002 |
| 378 | Ga0495602_0476347 | 3300048088 | Bacteria | 877 |
| 379 | Ga0496102_0088234 | 3300048905 | Bacteria | 2867 |
| 380 | Ga0496110_0275855 | 3300048913 | Bacteria | 1531 |
| 381 | Ga0496112_0464017 | 3300048915 | Bacteria | 1204 |
| 382 | Ga0496114_0330899 | 3300048917 | Bacteria | 1347 |
| 383 | Ga0496119_0021389 | 3300048922 | Bacteria | 4678 |
| 384 | Ga0496122_0065319 | 3300048925 | Bacteria | 2639 |
| 385 | Ga0501032_0051044 | 3300049569 | Bacteria | 2789 |
| 386 | Ga0501034_0082778 | 3300049571 | Bacteria | 3211 |
| 387 | Ga0501038_0159835 | 3300049574 | Bacteria | 1832 |
| 388 | Ga0501039_0056841 | 3300049575 | Bacteria | 3031 |
| 389 | Ga0501039_0232265 | 3300049575 | Bacteria | 1450 |
| 390 | Ga0501041_0078474 | 3300049577 | Bacteria | 2032 |
| 391 | Ga0501047_0006890 | 3300049581 | Bacteria | 10679 |
| 392 | Ga0501068_0269251 | 3300049584 | Bacteria | 1087 |
| 393 | Ga0501071_0011462 | 3300049587 | Bacteria | 5973 |
| 394 | Ga0501072_0008383 | 3300049588 | Bacteria | 7845 |
| 395 | Ga0501073_0024485 | 3300049589 | Bacteria | 4335 |
| 396 | Ga0501073_0155127 | 3300049589 | Bacteria | 1587 |
| 397 | Ga0501073_0320907 | 3300049589 | Bacteria | 1069 |
| 398 | Ga0501074_0163891 | 3300049590 | Bacteria | 1587 |
| 399 | Ga0501075_0062647 | 3300049591 | Bacteria | 2803 |
| 400 | Ga0501076_0061554 | 3300049592 | Bacteria | 2987 |
| 401 | Ga0501079_0015839 | 3300049741 | Bacteria | 5761 |
| 402 | Ga0501079_0483149 | 3300049741 | Unclassified | 974 |
| 403 | Ga0501080_0004531 | 3300049742 | Bacteria | 12383 |
| 404 | Ga0501080_0231344 | 3300049742 | Bacteria | 1689 |
| 405 | Ga0501080_0539104 | 3300049742 | Bacteria | 1040 |
| 406 | Ga0501081_0112537 | 3300049743 | Bacteria | 1932 |
| 407 | Ga0501083_0004063 | 3300049744 | Bacteria | 10295 |
| 408 | Ga0501083_0108377 | 3300049744 | Bacteria | 1827 |
| 409 | nmdc:mga03683_19664_c1 | 3300050489 | Bacteria | 2580 |
| 410 | nmdc:mga03n38_13513_c1 | 3300050490 | Bacteria | 3104 |
| 411 | nmdc:mga00v17_11498_c1 | 3300050491 | Bacteria | 4864 |
| 412 | nmdc:mga00v17_141_c1 | 3300050491 | Bacteria | 41598 |
| 413 | nmdc:mga0yw44_164435_c1 | 3300050492 | Bacteria | 1454 |
| 414 | nmdc:mga0yw44_45121_c1 | 3300050492 | Bacteria | 2641 |
| 415 | nmdc:mga06z11_104995_c1 | 3300050494 | Bacteria | 1556 |
| 416 | nmdc:mga07m45_20769_c2 | 3300050496 | Bacteria | 3183 |
| 417 | nmdc:mga05p37_1971_c1 | 3300050507 | Bacteria | 23923 |
| 418 | nmdc:mga05p37_42418_c1 | 3300050507 | Bacteria | 5589 |
| 419 | nmdc:mga05p37_752152_c1 | 3300050507 | Bacteria | 1074 |
| 420 | nmdc:mga09592_1325_c1 | 3300050508 | Bacteria | 19875 |
| 421 | nmdc:mga09592_46867_c1 | 3300050508 | Bacteria | 2178 |
| 422 | nmdc:mga09592_87527_c1 | 3300050508 | Bacteria | 2659 |
| 423 | nmdc:mga0qj67_189408_c1 | 3300050509 | Bacteria | 1672 |
| 424 | nmdc:mga06r32_106425_c1 | 3300050510 | Bacteria | 2756 |
| 425 | nmdc:mga06r32_26639_c1 | 3300050510 | Bacteria | 5393 |
| 426 | nmdc:mga06r32_39520_c1 | 3300050510 | Bacteria | 4477 |
| 427 | nmdc:mga06r32_74966_c1 | 3300050510 | Bacteria | 3281 |
| 428 | nmdc:mga08y16_26724_c1 | 3300050511 | Bacteria | 6082 |
| 429 | nmdc:mga08y16_551536_c1 | 3300050511 | Bacteria | 1166 |
| 430 | nmdc:mga0rr50_4776_c1 | 3300050513 | Bacteria | 7995 |
| 431 | Ga0495601_0006347 | 3300053077 | Bacteria | 6909 |
| 432 | Ga0495601_0015635 | 3300053077 | Bacteria | 4588 |
| 433 | Ga0495595_0013421 | 3300053084 | Bacteria | 3461 |
| 434 | Ga0495595_0033483 | 3300053084 | Bacteria | 2319 |
| 435 | Ga0501084_0127818 | 3300054114 | Bacteria | 2139 |
| 436 | Ga0501082_0000202 | 3300060353 | Bacteria | 52074 |
| 437 | Ga0501082_0036876 | 3300060353 | Bacteria | 4212 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006353 | Ga0075370_10047195 | Ga0075370_100471952 | 192 |
| 2 | 3300050496 | nmdc:mga07m45_20769_c2 | nmdc:mga07m45_20769_c2_1959_2594 | 192 |
| 3 | 3300047321 | Ga0495676_0063361 | Ga0495676_0063361_2233_2871 | 194 |
| 4 | 3300049584 | Ga0501068_0269251 | Ga0501068_0269251_19_654 | 206 |
| 5 | 3300014326 | Ga0157380_10037204 | Ga0157380_100372042 | 215 |
| 6 | 3300025935 | Ga0207709_10254106 | Ga0207709_102541062 | 215 |
| 7 | 3300048917 | Ga0496114_0330899 | Ga0496114_0330899_11_775 | 215 |
| 8 | 3300005435 | Ga0070714_100017355 | Ga0070714_1000173555 | 228 |
| 9 | 3300005563 | Ga0068855_100451518 | Ga0068855_1004515182 | 228 |
| 10 | 3300005616 | Ga0068852_100129924 | Ga0068852_1001299243 | 228 |
| 11 | 3300025929 | Ga0207664_10263985 | Ga0207664_102639852 | 228 |
| 12 | 3300026142 | Ga0207698_10143871 | Ga0207698_101438712 | 228 |
| 13 | 3300025936 | Ga0207670_10047857 | Ga0207670_100478574 | 230 |
| 14 | 3300025940 | Ga0207691_10286426 | Ga0207691_102864262 | 230 |
| 15 | 3300026075 | Ga0207708_10398505 | Ga0207708_103985052 | 230 |
| 16 | 3300035086 | Ga0373934_0214821 | Ga0373934_0214821_25_729 | 230 |
| 17 | 3300035113 | Ga0373936_0165752 | Ga0373936_0165752_249_953 | 230 |
| 18 | 3300005549 | Ga0070704_100134083 | Ga0070704_1001340831 | 233 |
| 19 | 3300035118 | Ga0373954_0062680 | Ga0373954_0062680_881_1669 | 234 |
| 20 | iso_pu_bacteria | 2904434214 | 2904434954 | 234 |
| 21 | iso_pu_bacteria | 2597490356 | 2599103346 | 235 |
| 22 | iso_pu_bacteria | 2846952575 | 2846953230 | 235 |
| 23 | iso_pu_bacteria | 2848858292 | 2848860663 | 235 |
| 24 | iso_pu_bacteria | 2898795034 | 2898795668 | 235 |
| 25 | iso_pu_bacteria | 8054563764 | 8054566587 | 235 |
| 26 | iso_pu_bacteria | 8054563764 | 8054567509 | 235 |
| 27 | 3300005354 | Ga0070675_100291167 | Ga0070675_1002911672 | 236 |
| 28 | 3300005364 | Ga0070673_100638087 | Ga0070673_1006380871 | 236 |
| 29 | 3300005618 | Ga0068864_100358464 | Ga0068864_1003584642 | 236 |
| 30 | 3300009177 | Ga0105248_10395056 | Ga0105248_103950562 | 236 |
| 31 | 3300017792 | Ga0163161_10294169 | Ga0163161_102941691 | 236 |
| 32 | 3300025986 | Ga0207658_10433104 | Ga0207658_104331041 | 236 |
| 33 | 3300026095 | Ga0207676_10385824 | Ga0207676_103858242 | 236 |
| 34 | 3300026118 | Ga0207675_100285103 | Ga0207675_1002851032 | 236 |
| 35 | 3300039062 | Ga0400483_177006 | Ga0400483_177006_2818_3582 | 236 |
| 36 | 3300049589 | Ga0501073_0320907 | Ga0501073_0320907_229_954 | 237 |
| 37 | 3300007076 | Ga0075435_100305072 | Ga0075435_1003050722 | 238 |
| 38 | 3300009094 | Ga0111539_11269060 | Ga0111539_112690602 | 238 |
| 39 | 3300031665 | Ga0316575_10014233 | Ga0316575_100142331 | 238 |
| 40 | 3300049569 | Ga0501032_0051044 | Ga0501032_0051044_1121_1888 | 238 |
| 41 | 3300049571 | Ga0501034_0082778 | Ga0501034_0082778_998_1765 | 238 |
| 42 | 3300049581 | Ga0501047_0006890 | Ga0501047_0006890_3415_4182 | 238 |
| 43 | 3300049589 | Ga0501073_0024485 | Ga0501073_0024485_3173_3940 | 238 |
| 44 | 3300049742 | Ga0501080_0539104 | Ga0501080_0539104_150_878 | 238 |
| 45 | 3300049744 | Ga0501083_0004063 | Ga0501083_0004063_6799_7566 | 238 |
| 46 | 3300060353 | Ga0501082_0036876 | Ga0501082_0036876_922_1689 | 238 |
| 47 | 3300003323 | rootH1_10362135 | rootH1_103621352 | 239 |
| 48 | 3300005295 | Ga0065707_10011384 | Ga0065707_100113842 | 239 |
| 49 | 3300005327 | Ga0070658_10025736 | Ga0070658_100257364 | 239 |
| 50 | 3300005329 | Ga0070683_100137867 | Ga0070683_1001378672 | 239 |
| 51 | 3300005329 | Ga0070683_100614817 | Ga0070683_1006148172 | 239 |
| 52 | 3300005330 | Ga0070690_100001285 | Ga0070690_1000012859 | 239 |
| 53 | 3300005330 | Ga0070690_100082118 | Ga0070690_1000821182 | 239 |
| 54 | 3300005334 | Ga0068869_100006971 | Ga0068869_1000069716 | 239 |
| 55 | 3300005336 | Ga0070680_100218347 | Ga0070680_1002183472 | 239 |
| 56 | 3300005337 | Ga0070682_100217373 | Ga0070682_1002173732 | 239 |
| 57 | 3300005338 | Ga0068868_100110066 | Ga0068868_1001100661 | 239 |
| 58 | 3300005340 | Ga0070689_100002710 | Ga0070689_1000027104 | 239 |
| 59 | 3300005340 | Ga0070689_100103954 | Ga0070689_1001039541 | 239 |
| 60 | 3300005340 | Ga0070689_100149134 | Ga0070689_1001491343 | 239 |
| 61 | 3300005340 | Ga0070689_100247175 | Ga0070689_1002471752 | 239 |
| 62 | 3300005341 | Ga0070691_10037041 | Ga0070691_100370412 | 239 |
| 63 | 3300005344 | Ga0070661_100363077 | Ga0070661_1003630772 | 239 |
| 64 | 3300005345 | Ga0070692_10049261 | Ga0070692_100492612 | 239 |
| 65 | 3300005345 | Ga0070692_10064038 | Ga0070692_100640382 | 239 |
| 66 | 3300005347 | Ga0070668_100451438 | Ga0070668_1004514381 | 239 |
| 67 | 3300005354 | Ga0070675_100088213 | Ga0070675_1000882132 | 239 |
| 68 | 3300005354 | Ga0070675_100406829 | Ga0070675_1004068292 | 239 |
| 69 | 3300005356 | Ga0070674_100262936 | Ga0070674_1002629362 | 239 |
| 70 | 3300005366 | Ga0070659_100050422 | Ga0070659_1000504223 | 239 |
| 71 | 3300005436 | Ga0070713_100056501 | Ga0070713_1000565012 | 239 |
| 72 | 3300005437 | Ga0070710_10202872 | Ga0070710_102028722 | 239 |
| 73 | 3300005438 | Ga0070701_10131669 | Ga0070701_101316692 | 239 |
| 74 | 3300005439 | Ga0070711_100309894 | Ga0070711_1003098943 | 239 |
| 75 | 3300005440 | Ga0070705_100038896 | Ga0070705_1000388962 | 239 |
| 76 | 3300005441 | Ga0070700_100001566 | Ga0070700_1000015668 | 239 |
| 77 | 3300005441 | Ga0070700_100326976 | Ga0070700_1003269762 | 239 |
| 78 | 3300005441 | Ga0070700_100331292 | Ga0070700_1003312922 | 239 |
| 79 | 3300005444 | Ga0070694_100010450 | Ga0070694_1000104503 | 239 |
| 80 | 3300005444 | Ga0070694_100105544 | Ga0070694_1001055442 | 239 |
| 81 | 3300005444 | Ga0070694_100160746 | Ga0070694_1001607462 | 239 |
| 82 | 3300005444 | Ga0070694_100220713 | Ga0070694_1002207132 | 239 |
| 83 | 3300005456 | Ga0070678_100029867 | Ga0070678_1000298675 | 239 |
| 84 | 3300005456 | Ga0070678_100141254 | Ga0070678_1001412542 | 239 |
| 85 | 3300005457 | Ga0070662_100130383 | Ga0070662_1001303832 | 239 |
| 86 | 3300005458 | Ga0070681_10023435 | Ga0070681_100234355 | 239 |
| 87 | 3300005458 | Ga0070681_10255324 | Ga0070681_102553242 | 239 |
| 88 | 3300005459 | Ga0068867_100007546 | Ga0068867_1000075468 | 239 |
| 89 | 3300005468 | Ga0070707_100120467 | Ga0070707_1001204673 | 239 |
| 90 | 3300005468 | Ga0070707_100647764 | Ga0070707_1006477641 | 239 |
| 91 | 3300005471 | Ga0070698_100017628 | Ga0070698_1000176282 | 239 |
| 92 | 3300005518 | Ga0070699_100204595 | Ga0070699_1002045952 | 239 |
| 93 | 3300005518 | Ga0070699_100259601 | Ga0070699_1002596012 | 239 |
| 94 | 3300005530 | Ga0070679_100045173 | Ga0070679_1000451733 | 239 |
| 95 | 3300005530 | Ga0070679_100181332 | Ga0070679_1001813322 | 239 |
| 96 | 3300005530 | Ga0070679_100214137 | Ga0070679_1002141373 | 239 |
| 97 | 3300005536 | Ga0070697_100303013 | Ga0070697_1003030131 | 239 |
| 98 | 3300005539 | Ga0068853_100003905 | Ga0068853_1000039057 | 239 |
| 99 | 3300005539 | Ga0068853_100413638 | Ga0068853_1004136381 | 239 |
| 100 | 3300005539 | Ga0068853_100624687 | Ga0068853_1006246872 | 239 |
| 101 | 3300005545 | Ga0070695_100009851 | Ga0070695_1000098511 | 239 |
| 102 | 3300005545 | Ga0070695_100250631 | Ga0070695_1002506312 | 239 |
| 103 | 3300005545 | Ga0070695_100251024 | Ga0070695_1002510241 | 239 |
| 104 | 3300005546 | Ga0070696_100204497 | Ga0070696_1002044971 | 239 |
| 105 | 3300005546 | Ga0070696_100483047 | Ga0070696_1004830472 | 239 |
| 106 | 3300005547 | Ga0070693_100234387 | Ga0070693_1002343871 | 239 |
| 107 | 3300005547 | Ga0070693_100371408 | Ga0070693_1003714081 | 239 |
| 108 | 3300005548 | Ga0070665_100478402 | Ga0070665_1004784022 | 239 |
| 109 | 3300005549 | Ga0070704_100012262 | Ga0070704_1000122627 | 239 |
| 110 | 3300005549 | Ga0070704_100143831 | Ga0070704_1001438312 | 239 |
| 111 | 3300005549 | Ga0070704_100179765 | Ga0070704_1001797652 | 239 |
| 112 | 3300005549 | Ga0070704_100274104 | Ga0070704_1002741041 | 239 |
| 113 | 3300005563 | Ga0068855_100053404 | Ga0068855_1000534044 | 239 |
| 114 | 3300005563 | Ga0068855_100148961 | Ga0068855_1001489613 | 239 |
| 115 | 3300005563 | Ga0068855_100252250 | Ga0068855_1002522502 | 239 |
| 116 | 3300005563 | Ga0068855_100261374 | Ga0068855_1002613742 | 239 |
| 117 | 3300005564 | Ga0070664_100235583 | Ga0070664_1002355832 | 239 |
| 118 | 3300005564 | Ga0070664_100558307 | Ga0070664_1005583071 | 239 |
| 119 | 3300005577 | Ga0068857_100118893 | Ga0068857_1001188933 | 239 |
| 120 | 3300005577 | Ga0068857_100143991 | Ga0068857_1001439912 | 239 |
| 121 | 3300005614 | Ga0068856_100093284 | Ga0068856_1000932842 | 239 |
| 122 | 3300005614 | Ga0068856_100269613 | Ga0068856_1002696131 | 239 |
| 123 | 3300005614 | Ga0068856_100299792 | Ga0068856_1002997922 | 239 |
| 124 | 3300005614 | Ga0068856_100630284 | Ga0068856_1006302842 | 239 |
| 125 | 3300005615 | Ga0070702_100000237 | Ga0070702_10000023718 | 239 |
| 126 | 3300005615 | Ga0070702_100126981 | Ga0070702_1001269812 | 239 |
| 127 | 3300005615 | Ga0070702_100434719 | Ga0070702_1004347191 | 239 |
| 128 | 3300005616 | Ga0068852_100018400 | Ga0068852_1000184004 | 239 |
| 129 | 3300005616 | Ga0068852_100630562 | Ga0068852_1006305622 | 239 |
| 130 | 3300005617 | Ga0068859_100013168 | Ga0068859_1000131689 | 239 |
| 131 | 3300005617 | Ga0068859_100092838 | Ga0068859_1000928382 | 239 |
| 132 | 3300005617 | Ga0068859_100106055 | Ga0068859_1001060553 | 239 |
| 133 | 3300005718 | Ga0068866_10002731 | Ga0068866_100027317 | 239 |
| 134 | 3300005718 | Ga0068866_10114527 | Ga0068866_101145272 | 239 |
| 135 | 3300005719 | Ga0068861_100729414 | Ga0068861_1007294141 | 239 |
| 136 | 3300005841 | Ga0068863_100159056 | Ga0068863_1001590562 | 239 |
| 137 | 3300005841 | Ga0068863_100518460 | Ga0068863_1005184602 | 239 |
| 138 | 3300005841 | Ga0068863_100655913 | Ga0068863_1006559131 | 239 |
| 139 | 3300005842 | Ga0068858_100039659 | Ga0068858_1000396592 | 239 |
| 140 | 3300005842 | Ga0068858_100369953 | Ga0068858_1003699531 | 239 |
| 141 | 3300005843 | Ga0068860_100317767 | Ga0068860_1003177672 | 239 |
| 142 | 3300005844 | Ga0068862_100007234 | Ga0068862_1000072348 | 239 |
| 143 | 3300005844 | Ga0068862_100118531 | Ga0068862_1001185312 | 239 |
| 144 | 3300005844 | Ga0068862_100213762 | Ga0068862_1002137622 | 239 |
| 145 | 3300005981 | Ga0081538_10050028 | Ga0081538_100500282 | 239 |
| 146 | 3300006028 | Ga0070717_10052286 | Ga0070717_100522862 | 239 |
| 147 | 3300006028 | Ga0070717_10095075 | Ga0070717_100950752 | 239 |
| 148 | 3300006038 | Ga0075365_10070467 | Ga0075365_100704672 | 239 |
| 149 | 3300006038 | Ga0075365_10134770 | Ga0075365_101347702 | 239 |
| 150 | 3300006042 | Ga0075368_10040451 | Ga0075368_100404512 | 239 |
| 151 | 3300006048 | Ga0075363_100028057 | Ga0075363_1000280572 | 239 |
| 152 | 3300006051 | Ga0075364_10000241 | Ga0075364_1000024118 | 239 |
| 153 | 3300006051 | Ga0075364_10026214 | Ga0075364_100262143 | 239 |
| 154 | 3300006175 | Ga0070712_100019293 | Ga0070712_1000192932 | 239 |
| 155 | 3300006178 | Ga0075367_10117475 | Ga0075367_101174752 | 239 |
| 156 | 3300006237 | Ga0097621_100054741 | Ga0097621_1000547414 | 239 |
| 157 | 3300006358 | Ga0068871_100004155 | Ga0068871_1000041557 | 239 |
| 158 | 3300006358 | Ga0068871_100229223 | Ga0068871_1002292232 | 239 |
| 159 | 3300006844 | Ga0075428_100062352 | Ga0075428_1000623523 | 239 |
| 160 | 3300006846 | Ga0075430_100015812 | Ga0075430_1000158122 | 239 |
| 161 | 3300006847 | Ga0075431_100000345 | Ga0075431_10000034531 | 239 |
| 162 | 3300006847 | Ga0075431_100092424 | Ga0075431_1000924243 | 239 |
| 163 | 3300006871 | Ga0075434_100016926 | Ga0075434_1000169262 | 239 |
| 164 | 3300006880 | Ga0075429_100008907 | Ga0075429_1000089077 | 239 |
| 165 | 3300006880 | Ga0075429_100139138 | Ga0075429_1001391382 | 239 |
| 166 | 3300006881 | Ga0068865_100018161 | Ga0068865_1000181614 | 239 |
| 167 | 3300006931 | Ga0097620_100013168 | Ga0097620_1000131682 | 239 |
| 168 | 3300006931 | Ga0097620_100092838 | Ga0097620_1000928382 | 239 |
| 169 | 3300006931 | Ga0097620_100106056 | Ga0097620_1001060563 | 239 |
| 170 | 3300007076 | Ga0075435_100066028 | Ga0075435_1000660282 | 239 |
| 171 | 3300007076 | Ga0075435_100150535 | Ga0075435_1001505352 | 239 |
| 172 | 3300009094 | Ga0111539_10037614 | Ga0111539_100376143 | 239 |
| 173 | 3300009094 | Ga0111539_10122500 | Ga0111539_101225002 | 239 |
| 174 | 3300009098 | Ga0105245_10001256 | Ga0105245_100012563 | 239 |
| 175 | 3300009098 | Ga0105245_10150347 | Ga0105245_101503472 | 239 |
| 176 | 3300009101 | Ga0105247_10145517 | Ga0105247_101455172 | 239 |
| 177 | 3300009101 | Ga0105247_10188450 | Ga0105247_101884502 | 239 |
| 178 | 3300009147 | Ga0114129_10016707 | Ga0114129_100167071 | 239 |
| 179 | 3300009147 | Ga0114129_10025697 | Ga0114129_100256975 | 239 |
| 180 | 3300009147 | Ga0114129_10315265 | Ga0114129_103152652 | 239 |
| 181 | 3300009147 | Ga0114129_10357984 | Ga0114129_103579843 | 239 |
| 182 | 3300009148 | Ga0105243_10002945 | Ga0105243_100029453 | 239 |
| 183 | 3300009148 | Ga0105243_10070629 | Ga0105243_100706293 | 239 |
| 184 | 3300009148 | Ga0105243_10096667 | Ga0105243_100966673 | 239 |
| 185 | 3300009174 | Ga0105241_10024794 | Ga0105241_100247942 | 239 |
| 186 | 3300009174 | Ga0105241_10165119 | Ga0105241_101651193 | 239 |
| 187 | 3300009176 | Ga0105242_10005883 | Ga0105242_100058838 | 239 |
| 188 | 3300009176 | Ga0105242_10129260 | Ga0105242_101292603 | 239 |
| 189 | 3300009177 | Ga0105248_10125263 | Ga0105248_101252632 | 239 |
| 190 | 3300009177 | Ga0105248_10126240 | Ga0105248_101262404 | 239 |
| 191 | 3300009545 | Ga0105237_10052902 | Ga0105237_100529023 | 239 |
| 192 | 3300009545 | Ga0105237_10450660 | Ga0105237_104506601 | 239 |
| 193 | 3300010375 | Ga0105239_10084845 | Ga0105239_100848453 | 239 |
| 194 | 3300010375 | Ga0105239_10119348 | Ga0105239_101193483 | 239 |
| 195 | 3300011119 | Ga0105246_10228760 | Ga0105246_102287602 | 239 |
| 196 | 3300013102 | Ga0157371_10034562 | Ga0157371_100345622 | 239 |
| 197 | 3300013105 | Ga0157369_10127325 | Ga0157369_101273252 | 239 |
| 198 | 3300013105 | Ga0157369_10153003 | Ga0157369_101530033 | 239 |
| 199 | 3300013296 | Ga0157374_10412702 | Ga0157374_104127021 | 239 |
| 200 | 3300013297 | Ga0157378_10010883 | Ga0157378_100108837 | 239 |
| 201 | 3300013297 | Ga0157378_10163178 | Ga0157378_101631782 | 239 |
| 202 | 3300013297 | Ga0157378_10222064 | Ga0157378_102220642 | 239 |
| 203 | 3300013306 | Ga0163162_10203572 | Ga0163162_102035722 | 239 |
| 204 | 3300013306 | Ga0163162_10305949 | Ga0163162_103059492 | 239 |
| 205 | 3300013306 | Ga0163162_10504341 | Ga0163162_105043412 | 239 |
| 206 | 3300013307 | Ga0157372_10420866 | Ga0157372_104208662 | 239 |
| 207 | 3300013308 | Ga0157375_10053895 | Ga0157375_100538952 | 239 |
| 208 | 3300013308 | Ga0157375_10379800 | Ga0157375_103798002 | 239 |
| 209 | 3300014325 | Ga0163163_10459131 | Ga0163163_104591312 | 239 |
| 210 | 3300014326 | Ga0157380_10027371 | Ga0157380_100273713 | 239 |
| 211 | 3300014497 | Ga0182008_10010870 | Ga0182008_100108707 | 239 |
| 212 | 3300014968 | Ga0157379_10025335 | Ga0157379_100253354 | 239 |
| 213 | 3300014968 | Ga0157379_10314638 | Ga0157379_103146381 | 239 |
| 214 | 3300014968 | Ga0157379_10580009 | Ga0157379_105800091 | 239 |
| 215 | 3300014969 | Ga0157376_10021851 | Ga0157376_100218515 | 239 |
| 216 | 3300014969 | Ga0157376_10120371 | Ga0157376_101203711 | 239 |
| 217 | 3300014969 | Ga0157376_10558426 | Ga0157376_105584262 | 239 |
| 218 | 3300021361 | Ga0213872_10045318 | Ga0213872_100453182 | 239 |
| 219 | 3300021388 | Ga0213875_10019036 | Ga0213875_100190361 | 239 |
| 220 | 3300025294 | Ga0209025_1043690 | Ga0209025_10436902 | 239 |
| 221 | 3300025899 | Ga0207642_10037565 | Ga0207642_100375653 | 239 |
| 222 | 3300025899 | Ga0207642_10123692 | Ga0207642_101236922 | 239 |
| 223 | 3300025900 | Ga0207710_10161695 | Ga0207710_101616952 | 239 |
| 224 | 3300025905 | Ga0207685_10174906 | Ga0207685_101749062 | 239 |
| 225 | 3300025906 | Ga0207699_10327010 | Ga0207699_103270102 | 239 |
| 226 | 3300025907 | Ga0207645_10185288 | Ga0207645_101852882 | 239 |
| 227 | 3300025908 | Ga0207643_10008619 | Ga0207643_100086196 | 239 |
| 228 | 3300025909 | Ga0207705_10003527 | Ga0207705_100035274 | 239 |
| 229 | 3300025910 | Ga0207684_10150418 | Ga0207684_101504182 | 239 |
| 230 | 3300025911 | Ga0207654_10104047 | Ga0207654_101040473 | 239 |
| 231 | 3300025912 | Ga0207707_10027093 | Ga0207707_100270934 | 239 |
| 232 | 3300025912 | Ga0207707_10037546 | Ga0207707_100375461 | 239 |
| 233 | 3300025912 | Ga0207707_10357101 | Ga0207707_103571012 | 239 |
| 234 | 3300025915 | Ga0207693_10058627 | Ga0207693_100586273 | 239 |
| 235 | 3300025916 | Ga0207663_10029222 | Ga0207663_100292224 | 239 |
| 236 | 3300025916 | Ga0207663_10359291 | Ga0207663_103592911 | 239 |
| 237 | 3300025918 | Ga0207662_10496419 | Ga0207662_104964191 | 239 |
| 238 | 3300025921 | Ga0207652_10337141 | Ga0207652_103371411 | 239 |
| 239 | 3300025921 | Ga0207652_10342131 | Ga0207652_103421312 | 239 |
| 240 | 3300025921 | Ga0207652_10400188 | Ga0207652_104001881 | 239 |
| 241 | 3300025923 | Ga0207681_10668839 | Ga0207681_106688391 | 239 |
| 242 | 3300025924 | Ga0207694_10091126 | Ga0207694_100911262 | 239 |
| 243 | 3300025926 | Ga0207659_10313731 | Ga0207659_103137312 | 239 |
| 244 | 3300025927 | Ga0207687_10349989 | Ga0207687_103499891 | 239 |
| 245 | 3300025928 | Ga0207700_10409350 | Ga0207700_104093502 | 239 |
| 246 | 3300025933 | Ga0207706_10180899 | Ga0207706_101808991 | 239 |
| 247 | 3300025933 | Ga0207706_10417738 | Ga0207706_104177382 | 239 |
| 248 | 3300025934 | Ga0207686_10075836 | Ga0207686_100758362 | 239 |
| 249 | 3300025934 | Ga0207686_10133399 | Ga0207686_101333992 | 239 |
| 250 | 3300025935 | Ga0207709_10039940 | Ga0207709_100399402 | 239 |
| 251 | 3300025936 | Ga0207670_10025421 | Ga0207670_100254213 | 239 |
| 252 | 3300025936 | Ga0207670_10043420 | Ga0207670_100434202 | 239 |
| 253 | 3300025936 | Ga0207670_10137729 | Ga0207670_101377293 | 239 |
| 254 | 3300025936 | Ga0207670_10464318 | Ga0207670_104643182 | 239 |
| 255 | 3300025937 | Ga0207669_10033605 | Ga0207669_100336051 | 239 |
| 256 | 3300025942 | Ga0207689_10000519 | Ga0207689_1000051918 | 239 |
| 257 | 3300025942 | Ga0207689_10021940 | Ga0207689_100219403 | 239 |
| 258 | 3300025949 | Ga0207667_10096026 | Ga0207667_100960262 | 239 |
| 259 | 3300025949 | Ga0207667_10178598 | Ga0207667_101785982 | 239 |
| 260 | 3300025949 | Ga0207667_10222543 | Ga0207667_102225432 | 239 |
| 261 | 3300025960 | Ga0207651_10434638 | Ga0207651_104346381 | 239 |
| 262 | 3300025961 | Ga0207712_10074792 | Ga0207712_100747923 | 239 |
| 263 | 3300026023 | Ga0207677_10127689 | Ga0207677_101276891 | 239 |
| 264 | 3300026023 | Ga0207677_10376906 | Ga0207677_103769061 | 239 |
| 265 | 3300026035 | Ga0207703_10276705 | Ga0207703_102767051 | 239 |
| 266 | 3300026035 | Ga0207703_10405804 | Ga0207703_104058041 | 239 |
| 267 | 3300026041 | Ga0207639_10003694 | Ga0207639_100036945 | 239 |
| 268 | 3300026041 | Ga0207639_10564687 | Ga0207639_105646872 | 239 |
| 269 | 3300026075 | Ga0207708_10001346 | Ga0207708_100013469 | 239 |
| 270 | 3300026075 | Ga0207708_10140751 | Ga0207708_101407511 | 239 |
| 271 | 3300026078 | Ga0207702_10036799 | Ga0207702_100367995 | 239 |
| 272 | 3300026088 | Ga0207641_10506765 | Ga0207641_105067652 | 239 |
| 273 | 3300026088 | Ga0207641_10612487 | Ga0207641_106124872 | 239 |
| 274 | 3300026089 | Ga0207648_10000461 | Ga0207648_1000046121 | 239 |
| 275 | 3300026116 | Ga0207674_10032514 | Ga0207674_100325143 | 239 |
| 276 | 3300026116 | Ga0207674_10479848 | Ga0207674_104798481 | 239 |
| 277 | 3300026118 | Ga0207675_100001140 | Ga0207675_10000114025 | 239 |
| 278 | 3300026118 | Ga0207675_100044721 | Ga0207675_1000447215 | 239 |
| 279 | 3300026121 | Ga0207683_10213032 | Ga0207683_102130322 | 239 |
| 280 | 3300026142 | Ga0207698_10025235 | Ga0207698_100252353 | 239 |
| 281 | 3300026142 | Ga0207698_10266466 | Ga0207698_102664661 | 239 |
| 282 | 3300026142 | Ga0207698_10594017 | Ga0207698_105940172 | 239 |
| 283 | 3300027907 | Ga0207428_10094110 | Ga0207428_100941103 | 239 |
| 284 | 3300028379 | Ga0268266_10318517 | Ga0268266_103185172 | 239 |
| 285 | 3300028379 | Ga0268266_10555677 | Ga0268266_105556771 | 239 |
| 286 | 3300028381 | Ga0268264_10161183 | Ga0268264_101611832 | 239 |
| 287 | 3300028381 | Ga0268264_10229342 | Ga0268264_102293421 | 239 |
| 288 | 3300028381 | Ga0268264_10492329 | Ga0268264_104923291 | 239 |
| 289 | 3300028577 | Ga0265318_10023172 | Ga0265318_100231721 | 239 |
| 290 | 3300028800 | Ga0265338_10025620 | Ga0265338_100256202 | 239 |
| 291 | 3300031240 | Ga0265320_10138470 | Ga0265320_101384701 | 239 |
| 292 | 3300031247 | Ga0265340_10036728 | Ga0265340_100367282 | 239 |
| 293 | 3300031548 | Ga0307408_100354090 | Ga0307408_1003540901 | 239 |
| 294 | 3300031548 | Ga0307408_100796244 | Ga0307408_1007962441 | 239 |
| 295 | 3300031665 | Ga0316575_10002967 | Ga0316575_100029674 | 239 |
| 296 | 3300031711 | Ga0265314_10227927 | Ga0265314_102279271 | 239 |
| 297 | 3300031727 | Ga0316576_10120792 | Ga0316576_101207923 | 239 |
| 298 | 3300031728 | Ga0316578_10002596 | Ga0316578_100025964 | 239 |
| 299 | 3300031824 | Ga0307413_10266874 | Ga0307413_102668742 | 239 |
| 300 | 3300031911 | Ga0307412_10445078 | Ga0307412_104450782 | 239 |
| 301 | 3300035111 | Ga0373923_0222566 | Ga0373923_0222566_89_820 | 239 |
| 302 | 3300035113 | Ga0373936_0097233 | Ga0373936_0097233_307_1038 | 239 |
| 303 | 3300035113 | Ga0373936_0105099 | Ga0373936_0105099_31_813 | 239 |
| 304 | 3300035119 | Ga0373956_0018596 | Ga0373956_0018596_613_1395 | 239 |
| 305 | 3300035207 | Ga0373942_0005350 | Ga0373942_0005350_1877_2617 | 239 |
| 306 | 3300035241 | Ga0373961_0019652 | Ga0373961_0019652_827_1609 | 239 |
| 307 | 3300035410 | Ga0373924_0027155 | Ga0373924_0027155_881_1663 | 239 |
| 308 | 3300035691 | Ga0373931_0275758 | Ga0373931_0275758_56_787 | 239 |
| 309 | 3300035692 | Ga0373935_0015849 | Ga0373935_0015849_1326_2057 | 239 |
| 310 | 3300035692 | Ga0373935_0054720 | Ga0373935_0054720_401_1183 | 239 |
| 311 | 3300035692 | Ga0373935_0183844 | Ga0373935_0183844_516_1298 | 239 |
| 312 | 3300035692 | Ga0373935_0448006 | Ga0373935_0448006_28_810 | 239 |
| 313 | 3300035695 | Ga0373927_0147416 | Ga0373927_0147416_266_1048 | 239 |
| 314 | 3300035695 | Ga0373927_0253312 | Ga0373927_0253312_264_1046 | 239 |
| 315 | 3300035724 | Ga0373933_0054448 | Ga0373933_0054448_1503_2276 | 239 |
| 316 | 3300035724 | Ga0373933_0162209 | Ga0373933_0162209_160_891 | 239 |
| 317 | 3300035724 | Ga0373933_0216323 | Ga0373933_0216323_211_951 | 239 |
| 318 | 3300035724 | Ga0373933_0265997 | Ga0373933_0265997_54_836 | 239 |
| 319 | 3300035725 | Ga0373947_0012320 | Ga0373947_0012320_2768_3550 | 239 |
| 320 | 3300036401 | Ga0373937_0001833 | Ga0373937_0001833_11442_12224 | 239 |
| 321 | 3300036401 | Ga0373937_0004886 | Ga0373937_0004886_6878_7660 | 239 |
| 322 | 3300036401 | Ga0373937_0016991 | Ga0373937_0016991_5494_6276 | 239 |
| 323 | 3300036401 | Ga0373937_0061173 | Ga0373937_0061173_200_931 | 239 |
| 324 | 3300036401 | Ga0373937_0077515 | Ga0373937_0077515_1165_1947 | 239 |
| 325 | 3300036401 | Ga0373937_0134153 | Ga0373937_0134153_794_1525 | 239 |
| 326 | 3300036401 | Ga0373937_0354152 | Ga0373937_0354152_590_1321 | 239 |
| 327 | 3300036712 | Ga0316584_0008110 | Ga0316584_0008110_1498_2295 | 239 |
| 328 | 3300037068 | Ga0373925_0066811 | Ga0373925_0066811_947_1729 | 239 |
| 329 | 3300037068 | Ga0373925_0068203 | Ga0373925_0068203_1013_1744 | 239 |
| 330 | 3300037068 | Ga0373925_0093927 | Ga0373925_0093927_354_1136 | 239 |
| 331 | 3300037466 | Ga0395898_0336745 | Ga0395898_0336745_138_923 | 239 |
| 332 | 3300037588 | Ga0316581_0013720 | Ga0316581_0013720_1320_2054 | 239 |
| 333 | 3300037853 | Ga0436364_0791244 | Ga0436364_0791244_5540_6424 | 239 |
| 334 | 3300038443 | Ga0395901_0015644 | Ga0395901_0015644_4017_4799 | 239 |
| 335 | 3300038443 | Ga0395901_0018973 | Ga0395901_0018973_5518_6303 | 239 |
| 336 | 3300039437 | Ga0436365_0939926 | Ga0436365_0939926_649_1428 | 239 |
| 337 | 3300039447 | Ga0436361_0529066 | Ga0436361_0529066_2388_3170 | 239 |
| 338 | 3300042001 | Ga0439441_001040 | Ga0439441_001040_1727_2461 | 239 |
| 339 | 3300042001 | Ga0439441_017846 | Ga0439441_017846_118_852 | 239 |
| 340 | 3300046454 | Ga0495592_0006664 | Ga0495592_0006664_191_922 | 239 |
| 341 | 3300046459 | Ga0495629_0431999 | Ga0495629_0431999_136_867 | 239 |
| 342 | 3300046462 | Ga0495651_0007983 | Ga0495651_0007983_3668_4450 | 239 |
| 343 | 3300046462 | Ga0495651_0224182 | Ga0495651_0224182_373_1104 | 239 |
| 344 | 3300046463 | Ga0495653_0113420 | Ga0495653_0113420_170_901 | 239 |
| 345 | 3300046463 | Ga0495653_0174070 | Ga0495653_0174070_642_1424 | 239 |
| 346 | 3300046473 | Ga0495582_0257296 | Ga0495582_0257296_187_918 | 239 |
| 347 | 3300046473 | Ga0495582_0314455 | Ga0495582_0314455_100_831 | 239 |
| 348 | 3300046475 | Ga0495639_0057187 | Ga0495639_0057187_863_1645 | 239 |
| 349 | 3300046476 | Ga0495662_0007371 | Ga0495662_0007371_59_790 | 239 |
| 350 | 3300046477 | Ga0495664_0010758 | Ga0495664_0010758_192_974 | 239 |
| 351 | 3300046499 | Ga0495594_0303793 | Ga0495594_0303793_83_814 | 239 |
| 352 | 3300046511 | Ga0495608_0004164 | Ga0495608_0004164_9448_10179 | 239 |
| 353 | 3300046511 | Ga0495608_0038620 | Ga0495608_0038620_1720_2502 | 239 |
| 354 | 3300046514 | Ga0495618_0002241 | Ga0495618_0002241_9653_10384 | 239 |
| 355 | 3300046516 | Ga0495628_0004512 | Ga0495628_0004512_5745_6476 | 239 |
| 356 | 3300046516 | Ga0495628_0035410 | Ga0495628_0035410_2233_2964 | 239 |
| 357 | 3300046516 | Ga0495628_0085334 | Ga0495628_0085334_1472_2254 | 239 |
| 358 | 3300046517 | Ga0495630_0003325 | Ga0495630_0003325_880_1611 | 239 |
| 359 | 3300046517 | Ga0495630_0389866 | Ga0495630_0389866_270_1010 | 239 |
| 360 | 3300046529 | Ga0495652_0038487 | Ga0495652_0038487_1590_2321 | 239 |
| 361 | 3300046533 | Ga0495640_0019946 | Ga0495640_0019946_1315_2046 | 239 |
| 362 | 3300046533 | Ga0495640_0034762 | Ga0495640_0034762_191_922 | 239 |
| 363 | 3300046535 | Ga0495586_0000357 | Ga0495586_0000357_15176_15907 | 239 |
| 364 | 3300046535 | Ga0495586_0056110 | Ga0495586_0056110_220_951 | 239 |
| 365 | 3300046539 | Ga0495621_0013302 | Ga0495621_0013302_238_972 | 239 |
| 366 | 3300046543 | Ga0495645_0004710 | Ga0495645_0004710_2446_3228 | 239 |
| 367 | 3300046543 | Ga0495645_0026596 | Ga0495645_0026596_2743_3474 | 239 |
| 368 | 3300046559 | Ga0495667_0003174 | Ga0495667_0003174_3734_4516 | 239 |
| 369 | 3300046559 | Ga0495667_0016308 | Ga0495667_0016308_1758_2540 | 239 |
| 370 | 3300046559 | Ga0495667_0028696 | Ga0495667_0028696_2813_3544 | 239 |
| 371 | 3300046642 | Ga0495634_0009887 | Ga0495634_0009887_2868_3599 | 239 |
| 372 | 3300046663 | Ga0495635_0015581 | Ga0495635_0015581_2046_2777 | 239 |
| 373 | 3300046664 | Ga0495659_0145172 | Ga0495659_0145172_25_759 | 239 |
| 374 | 3300046675 | Ga0495657_0108505 | Ga0495657_0108505_74_856 | 239 |
| 375 | 3300046678 | Ga0495599_0003567 | Ga0495599_0003567_900_1682 | 239 |
| 376 | 3300046678 | Ga0495599_0006228 | Ga0495599_0006228_2625_3356 | 239 |
| 377 | 3300046680 | Ga0495646_0176689 | Ga0495646_0176689_30_812 | 239 |
| 378 | 3300046683 | Ga0495658_0000597 | Ga0495658_0000597_7589_8320 | 239 |
| 379 | 3300046689 | Ga0495613_0003374 | Ga0495613_0003374_7854_8585 | 239 |
| 380 | 3300046690 | Ga0495624_0035269 | Ga0495624_0035269_206_937 | 239 |
| 381 | 3300046809 | Ga0495600_0008355 | Ga0495600_0008355_4002_4733 | 239 |
| 382 | 3300046809 | Ga0495600_0066393 | Ga0495600_0066393_1121_1903 | 239 |
| 383 | 3300047317 | Ga0495604_0005484 | Ga0495604_0005484_3582_4313 | 239 |
| 384 | 3300047317 | Ga0495604_0007829 | Ga0495604_0007829_3285_4067 | 239 |
| 385 | 3300047319 | Ga0495674_0097461 | Ga0495674_0097461_1630_2412 | 239 |
| 386 | 3300047319 | Ga0495674_0299821 | Ga0495674_0299821_165_896 | 239 |
| 387 | 3300047322 | Ga0495680_0045703 | Ga0495680_0045703_1692_2474 | 239 |
| 388 | 3300047322 | Ga0495680_0074066 | Ga0495680_0074066_1537_2268 | 239 |
| 389 | 3300047322 | Ga0495680_0187059 | Ga0495680_0187059_84_866 | 239 |
| 390 | 3300047444 | Ga0495675_0005689 | Ga0495675_0005689_6058_6840 | 239 |
| 391 | 3300047444 | Ga0495675_0189240 | Ga0495675_0189240_54_785 | 239 |
| 392 | 3300047471 | Ga0495684_0038559 | Ga0495684_0038559_1332_2063 | 239 |
| 393 | 3300047673 | Ga0495593_0174966 | Ga0495593_0174966_21_752 | 239 |
| 394 | 3300048088 | Ga0495602_0015039 | Ga0495602_0015039_2197_2979 | 239 |
| 395 | 3300048088 | Ga0495602_0044926 | Ga0495602_0044926_1252_2034 | 239 |
| 396 | 3300048088 | Ga0495602_0476347 | Ga0495602_0476347_69_809 | 239 |
| 397 | 3300048905 | Ga0496102_0088234 | Ga0496102_0088234_118_903 | 239 |
| 398 | 3300048913 | Ga0496110_0275855 | Ga0496110_0275855_558_1343 | 239 |
| 399 | 3300048915 | Ga0496112_0464017 | Ga0496112_0464017_140_922 | 239 |
| 400 | 3300048922 | Ga0496119_0021389 | Ga0496119_0021389_1623_2507 | 239 |
| 401 | 3300048925 | Ga0496122_0065319 | Ga0496122_0065319_1380_2162 | 239 |
| 402 | 3300049574 | Ga0501038_0159835 | Ga0501038_0159835_734_1468 | 239 |
| 403 | 3300049575 | Ga0501039_0056841 | Ga0501039_0056841_1621_2355 | 239 |
| 404 | 3300049575 | Ga0501039_0232265 | Ga0501039_0232265_129_899 | 239 |
| 405 | 3300049577 | Ga0501041_0078474 | Ga0501041_0078474_1215_1949 | 239 |
| 406 | 3300049587 | Ga0501071_0011462 | Ga0501071_0011462_4480_5214 | 239 |
| 407 | 3300049588 | Ga0501072_0008383 | Ga0501072_0008383_257_991 | 239 |
| 408 | 3300049589 | Ga0501073_0155127 | Ga0501073_0155127_665_1399 | 239 |
| 409 | 3300049590 | Ga0501074_0163891 | Ga0501074_0163891_460_1194 | 239 |
| 410 | 3300049591 | Ga0501075_0062647 | Ga0501075_0062647_1074_1808 | 239 |
| 411 | 3300049592 | Ga0501076_0061554 | Ga0501076_0061554_1838_2572 | 239 |
| 412 | 3300049741 | Ga0501079_0015839 | Ga0501079_0015839_3871_4605 | 239 |
| 413 | 3300049741 | Ga0501079_0483149 | Ga0501079_0483149_182_964 | 239 |
| 414 | 3300049742 | Ga0501080_0004531 | Ga0501080_0004531_5187_5921 | 239 |
| 415 | 3300049742 | Ga0501080_0231344 | Ga0501080_0231344_468_1253 | 239 |
| 416 | 3300049743 | Ga0501081_0112537 | Ga0501081_0112537_106_840 | 239 |
| 417 | 3300049744 | Ga0501083_0108377 | Ga0501083_0108377_922_1704 | 239 |
| 418 | 3300050489 | nmdc:mga03683_19664_c1 | nmdc:mga03683_19664_c1_1040_1825 | 239 |
| 419 | 3300050490 | nmdc:mga03n38_13513_c1 | nmdc:mga03n38_13513_c1_346_1131 | 239 |
| 420 | 3300050491 | nmdc:mga00v17_11498_c1 | nmdc:mga00v17_11498_c1_3839_4624 | 239 |
| 421 | 3300050491 | nmdc:mga00v17_141_c1 | nmdc:mga00v17_141_c1_6634_7416 | 239 |
| 422 | 3300050492 | nmdc:mga0yw44_164435_c1 | nmdc:mga0yw44_164435_c1_560_1345 | 239 |
| 423 | 3300050492 | nmdc:mga0yw44_45121_c1 | nmdc:mga0yw44_45121_c1_261_1046 | 239 |
| 424 | 3300050494 | nmdc:mga06z11_104995_c1 | nmdc:mga06z11_104995_c1_669_1454 | 239 |
| 425 | 3300050507 | nmdc:mga05p37_1971_c1 | nmdc:mga05p37_1971_c1_15401_16135 | 239 |
| 426 | 3300050507 | nmdc:mga05p37_42418_c1 | nmdc:mga05p37_42418_c1_2713_3450 | 239 |
| 427 | 3300050507 | nmdc:mga05p37_752152_c1 | nmdc:mga05p37_752152_c1_222_953 | 239 |
| 428 | 3300050508 | nmdc:mga09592_1325_c1 | nmdc:mga09592_1325_c1_15185_15919 | 239 |
| 429 | 3300050508 | nmdc:mga09592_46867_c1 | nmdc:mga09592_46867_c1_1404_2135 | 239 |
| 430 | 3300050508 | nmdc:mga09592_87527_c1 | nmdc:mga09592_87527_c1_1674_2411 | 239 |
| 431 | 3300050509 | nmdc:mga0qj67_189408_c1 | nmdc:mga0qj67_189408_c1_184_918 | 239 |
| 432 | 3300050510 | nmdc:mga06r32_106425_c1 | nmdc:mga06r32_106425_c1_747_1484 | 239 |
| 433 | 3300050510 | nmdc:mga06r32_26639_c1 | nmdc:mga06r32_26639_c1_4461_5276 | 239 |
| 434 | 3300050510 | nmdc:mga06r32_39520_c1 | nmdc:mga06r32_39520_c1_2048_2782 | 239 |
| 435 | 3300050510 | nmdc:mga06r32_74966_c1 | nmdc:mga06r32_74966_c1_1050_1784 | 239 |
| 436 | 3300050511 | nmdc:mga08y16_26724_c1 | nmdc:mga08y16_26724_c1_1575_2306 | 239 |
| 437 | 3300050511 | nmdc:mga08y16_551536_c1 | nmdc:mga08y16_551536_c1_152_886 | 239 |
| 438 | 3300050513 | nmdc:mga0rr50_4776_c1 | nmdc:mga0rr50_4776_c1_6488_7231 | 239 |
| 439 | 3300053077 | Ga0495601_0006347 | Ga0495601_0006347_4207_4938 | 239 |
| 440 | 3300053077 | Ga0495601_0015635 | Ga0495601_0015635_3735_4517 | 239 |
| 441 | 3300053084 | Ga0495595_0013421 | Ga0495595_0013421_1347_2129 | 239 |
| 442 | 3300053084 | Ga0495595_0033483 | Ga0495595_0033483_1135_1917 | 239 |
| 443 | 3300054114 | Ga0501084_0127818 | Ga0501084_0127818_1303_2037 | 239 |
| 444 | 3300060353 | Ga0501082_0000202 | Ga0501082_0000202_44205_44987 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y98-assembly1.cif.gz_A | crystal structure of ligd-apo form from sphingobium sp. strain syk-6 | 0.9484 | 4 | 166 |
| 5vps-assembly1.cif.gz_A | crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct | 0.9402 | 1 | 239 |
| 5vps-assembly1.cif.gz_A | crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct | 0.9365 | 1 | 239 |
| 5va8-assembly1.cif.gz_D | crystal structure of short-chain dehydrogenase/reductase sdr from burkholderia phymatum in complex with nadp | 0.9305 | 1 | 239 |
| 6jhb-assembly1.cif.gz_B-2 | crystal structure of nadph and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa | 0.9294 | 1 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4y98A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9484 | 4 | 166 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9482 | 71 | 171 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9418 | 5 | 176 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9378 | 65 | 234 | 3.40.50.720 |
| af_Q53GQ0_49_275_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9308 | 7 | 174 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1IQH4-F1-model_v4 | deleted | 0.9714 | 1 | 238 |
|
| AF-A0A1H1KN24-F1-model_v4 | NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family | 0.9701 | 1 | 239 |
GO:0016491
|
| AF-A0A7Z0FCU5-F1-model_v4 | deleted | 0.9693 | 96 | 238 |
|
| AF-A0A1H1KN24-F1-model_v4 | NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family | 0.9662 | 1 | 239 |
GO:0016491
|
| AF-A0A6F8NHQ1-F1-model_v4 | deleted | 0.9647 | 1 | 238 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar