F445303

General Info

Members Datasets Scaffolds Average Seq Length
444 262 888 87

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10074112|Ga0265316_100741124
Length 88
Sequence VSTETIELLRQRLAVLQPESITIDDESHRHAGHAGAREGGHYQLQIVAQAFAGKSTIARHRMIYDAAGELMRGRIHALSIHAKEPGEV

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
187 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 2.25
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10074112 3300031344 Bacteria 2620
2 Ga0065704_10435002 3300005289 Bacteria 719
3 Ga0065712_10099953 3300005290 Bacteria 2076
4 Ga0070658_10079096 3300005327 Bacteria 2699
5 Ga0070658_11007363 3300005327 Bacteria 724
6 Ga0070676_10092649 3300005328 Bacteria 1854
7 Ga0070683_102121474 3300005329 Bacteria 540
8 Ga0070690_100437088 3300005330 Bacteria 968
9 Ga0070677_10756094 3300005333 Unclassified 552
10 Ga0068869_100022522 3300005334 Bacteria 4342
11 Ga0070680_100100077 3300005336 Bacteria 2406
12 Ga0070680_100360920 3300005336 Bacteria 1236
13 Ga0070680_101535100 3300005336 Bacteria 577
14 Ga0068868_100009652 3300005338 Bacteria 6963
15 Ga0068868_100602276 3300005338 Bacteria 974
16 Ga0068868_100878237 3300005338 Bacteria 814
17 Ga0070660_100098119 3300005339 Bacteria 2319
18 Ga0070660_100187457 3300005339 Bacteria 1675
19 Ga0070660_100474124 3300005339 Bacteria 1040
20 Ga0070689_100039656 3300005340 Bacteria 3607
21 Ga0070689_100687187 3300005340 Bacteria 893
22 Ga0070687_100123260 3300005343 Bacteria 1486
23 Ga0070687_100330176 3300005343 Bacteria 977
24 Ga0070661_100472601 3300005344 Bacteria 1000
25 Ga0070661_100553081 3300005344 Unclassified 926
26 Ga0070661_100970038 3300005344 Bacteria 704
27 Ga0070661_101334440 3300005344 Bacteria 602
28 Ga0070661_101783598 3300005344 Bacteria 522
29 Ga0070692_10186455 3300005345 Bacteria 1206
30 Ga0070692_10383302 3300005345 Bacteria 883
31 Ga0070692_10422416 3300005345 Bacteria 847
32 Ga0070669_100324673 3300005353 Bacteria 1244
33 Ga0070669_100931900 3300005353 Bacteria 743
34 Ga0070675_100090115 3300005354 Bacteria 2568
35 Ga0070675_100184977 3300005354 Bacteria 1803
36 Ga0070675_100434207 3300005354 Bacteria 1176
37 Ga0070675_100636666 3300005354 Bacteria 969
38 Ga0070671_100571365 3300005355 Bacteria 976
39 Ga0070674_100194330 3300005356 Bacteria 1562
40 Ga0070674_100541030 3300005356 Bacteria 976
41 Ga0070673_100322108 3300005364 Bacteria 1366
42 Ga0070673_100531341 3300005364 Bacteria 1067
43 Ga0070688_100144088 3300005365 Bacteria 1622
44 Ga0070688_100343613 3300005365 Bacteria 1090
45 Ga0070688_100827958 3300005365 Bacteria 726
46 Ga0070659_100035952 3300005366 Bacteria 3860
47 Ga0070659_100467280 3300005366 Bacteria 1072
48 Ga0070659_100490141 3300005366 Bacteria 1047
49 Ga0070659_100788365 3300005366 Bacteria 826
50 Ga0070659_101219937 3300005366 Bacteria 666
51 Ga0070714_100060795 3300005435 Bacteria 3243
52 Ga0070714_101092561 3300005435 Bacteria 777
53 Ga0070713_100014170 3300005436 Bacteria 5908
54 Ga0070713_100160413 3300005436 Bacteria 2007
55 Ga0070711_100373110 3300005439 Bacteria 1152
56 Ga0070711_100383056 3300005439 Bacteria 1138
57 Ga0070705_100029443 3300005440 Bacteria 3020
58 Ga0070705_100074935 3300005440 Bacteria 2059
59 Ga0070700_100115744 3300005441 Bacteria 1789
60 Ga0070708_101319996 3300005445 Bacteria 674
61 Ga0070678_100110864 3300005456 Bacteria 2146
62 Ga0070678_100241398 3300005456 Bacteria 1511
63 Ga0070678_100347356 3300005456 Bacteria 1274
64 Ga0070662_101183870 3300005457 Unclassified 657
65 Ga0070662_101835032 3300005457 Bacteria 524
66 Ga0070681_10066155 3300005458 Bacteria 3583
67 Ga0070681_11873748 3300005458 Unclassified 527
68 Ga0068867_100076790 3300005459 Bacteria 2509
69 Ga0068867_100131621 3300005459 Bacteria 1945
70 Ga0070706_102099346 3300005467 Bacteria 511
71 Ga0070707_100325349 3300005468 Bacteria 1494
72 Ga0070699_100505958 3300005518 Bacteria 1097
73 Ga0070699_100609495 3300005518 Bacteria 996
74 Ga0070679_100043168 3300005530 Bacteria 4492
75 Ga0070679_100193960 3300005530 Bacteria 1999
76 Ga0070679_100834255 3300005530 Unclassified 865
77 Ga0070684_100046668 3300005535 Bacteria 3753
78 Ga0070684_101022405 3300005535 Bacteria 776
79 Ga0070684_101085873 3300005535 Unclassified 752
80 Ga0068853_100192518 3300005539 Bacteria 1853
81 Ga0070672_100081965 3300005543 Bacteria 2587
82 Ga0070672_101438524 3300005543 Unclassified 617
83 Ga0070686_100464184 3300005544 Bacteria 976
84 Ga0070686_101768779 3300005544 Bacteria 526
85 Ga0070695_100397438 3300005545 Bacteria 1044
86 Ga0070695_101715319 3300005545 Unclassified 526
87 Ga0070696_100134668 3300005546 Bacteria 1800
88 Ga0070696_100500431 3300005546 Bacteria 967
89 Ga0070693_100002544 3300005547 Bacteria 8408
90 Ga0070693_101319732 3300005547 Unclassified 558
91 Ga0070665_100930083 3300005548 Bacteria 882
92 Ga0070665_101110895 3300005548 Bacteria 802
93 Ga0068855_100005893 3300005563 Bacteria 14940
94 Ga0068855_100021701 3300005563 Bacteria 7701
95 Ga0068855_100096548 3300005563 Bacteria 3405
96 Ga0068855_101584554 3300005563 Bacteria 670
97 Ga0068855_101724501 3300005563 Bacteria 638
98 Ga0068855_102221056 3300005563 Bacteria 551
99 Ga0070664_100554291 3300005564 Bacteria 1063
100 Ga0068857_100071165 3300005577 Bacteria 3099
101 Ga0068857_100839135 3300005577 Bacteria 879
102 Ga0068854_100444434 3300005578 Bacteria 1082
103 Ga0068854_100560110 3300005578 Bacteria 971
104 Ga0068854_100908515 3300005578 Bacteria 774
105 Ga0068854_101673710 3300005578 Bacteria 581
106 Ga0068856_100121765 3300005614 Bacteria 2611
107 Ga0070702_100125375 3300005615 Bacteria 1614
108 Ga0070702_100141772 3300005615 Bacteria 1532
109 Ga0070702_101359620 3300005615 Bacteria 579
110 Ga0068852_100000134 3300005616 Bacteria 49788
111 Ga0068852_100103089 3300005616 Bacteria 2579
112 Ga0068852_100449298 3300005616 Bacteria 1276
113 Ga0068852_101358147 3300005616 Bacteria 732
114 Ga0068859_101321553 3300005617 Bacteria 795
115 Ga0068864_100472258 3300005618 Bacteria 1203
116 Ga0068861_100634835 3300005719 Bacteria 985
117 Ga0068851_10001300 3300005834 Bacteria 10888
118 Ga0068851_10046778 3300005834 Bacteria 2190
119 Ga0068870_10038419 3300005840 Bacteria 2472
120 Ga0068863_101054361 3300005841 Bacteria 817
121 Ga0075364_10610788 3300006051 Bacteria 745
122 Ga0070716_100246247 3300006173 Bacteria 1215
123 Ga0070712_100713791 3300006175 Bacteria 856
124 Ga0075366_10000945 3300006195 Bacteria 14139
125 Ga0097621_100079352 3300006237 Bacteria 2728
126 Ga0097621_100131396 3300006237 Bacteria 2132
127 Ga0097621_100137005 3300006237 Bacteria 2089
128 Ga0075370_10016433 3300006353 Bacteria 3982
129 Ga0068871_100004769 3300006358 Bacteria 9481
130 Ga0075431_100076590 3300006847 Bacteria 3452
131 Ga0075429_100043946 3300006880 Bacteria 3886
132 Ga0068865_100171219 3300006881 Bacteria 1665
133 Ga0075436_100249302 3300006914 Bacteria 1264
134 Ga0097620_101321671 3300006931 Bacteria 795
135 Ga0075435_101084387 3300007076 Bacteria 700
136 Ga0075435_101274447 3300007076 Unclassified 643
137 Ga0105240_10012696 3300009093 Bacteria 11610
138 Ga0105240_10117352 3300009093 Bacteria 3209
139 Ga0105240_10131528 3300009093 Bacteria 3001
140 Ga0105240_10197386 3300009093 Bacteria 2361
141 Ga0105240_10393870 3300009093 Bacteria 1562
142 Ga0105240_11212113 3300009093 Unclassified 799
143 Ga0111539_12537563 3300009094 Bacteria 594
144 Ga0105245_10153090 3300009098 Bacteria 2182
145 Ga0105245_10204956 3300009098 Bacteria 1895
146 Ga0105245_10774530 3300009098 Bacteria 996
147 Ga0105245_11038761 3300009098 Bacteria 865
148 Ga0105245_11617627 3300009098 Unclassified 700
149 Ga0105245_12944158 3300009098 Bacteria 528
150 Ga0105243_10585677 3300009148 Bacteria 1071
151 Ga0105241_10007901 3300009174 Bacteria 7820
152 Ga0105241_10892780 3300009174 Bacteria 825
153 Ga0105241_11601159 3300009174 Bacteria 630
154 Ga0105242_10376774 3300009176 Bacteria 1318
155 Ga0105248_10162992 3300009177 Bacteria 2514
156 Ga0105237_10231575 3300009545 Bacteria 1848
157 Ga0105238_10001871 3300009551 Bacteria 21109
158 Ga0105238_10008062 3300009551 Bacteria 10534
159 Ga0105238_10595737 3300009551 Bacteria 1113
160 Ga0105238_10641141 3300009551 Bacteria 1072
161 Ga0105238_10678123 3300009551 Bacteria 1042
162 Ga0105238_10897450 3300009551 Bacteria 905
163 Ga0105239_10668022 3300010375 Bacteria 1187
164 Ga0105239_10946306 3300010375 Bacteria 989
165 Ga0105246_10230424 3300011119 Bacteria 1458
166 Ga0105246_10792933 3300011119 Unclassified 840
167 Ga0105246_10806125 3300011119 Bacteria 834
168 Ga0157371_10397078 3300013102 Bacteria 1009
169 Ga0157371_10956668 3300013102 Bacteria 652
170 Ga0157370_10096239 3300013104 Bacteria 2778
171 Ga0157370_10294655 3300013104 Bacteria 1498
172 Ga0157370_10407688 3300013104 Bacteria 1251
173 Ga0157370_10725149 3300013104 Bacteria 906
174 Ga0157369_10024477 3300013105 Bacteria 6716
175 Ga0157369_10127739 3300013105 Bacteria 2694
176 Ga0157374_10064524 3300013296 Bacteria 3436
177 Ga0157374_11745077 3300013296 Bacteria 647
178 Ga0157378_10172732 3300013297 Bacteria 2028
179 Ga0157378_10506073 3300013297 Bacteria 1207
180 Ga0163162_12907810 3300013306 Bacteria 551
181 Ga0157372_10020619 3300013307 Bacteria 7113
182 Ga0157372_10087739 3300013307 Bacteria 3530
183 Ga0157372_10104220 3300013307 Bacteria 3242
184 Ga0157372_10791567 3300013307 Bacteria 1102
185 Ga0157372_12216922 3300013307 Bacteria 631
186 Ga0157372_13439895 3300013307 Bacteria 503
187 Ga0157375_10726934 3300013308 Bacteria 1145
188 Ga0157375_13703387 3300013308 Bacteria 508
189 Ga0163163_11654562 3300014325 Bacteria 701
190 Ga0157380_10695458 3300014326 Bacteria 1021
191 Ga0157377_10123615 3300014745 Bacteria 1572
192 Ga0157376_10227651 3300014969 Bacteria 1730
193 Ga0206356_10764669 3300020070 Bacteria 806
194 Ga0206356_10815016 3300020070 Bacteria 1148
195 Ga0206354_10390052 3300020081 Bacteria 1038
196 Ga0206353_10954363 3300020082 Bacteria 787
197 Ga0206353_11374805 3300020082 Bacteria 792
198 Ga0207656_10000379 3300025321 Bacteria 14916
199 Ga0207656_10265193 3300025321 Bacteria 844
200 Ga0207682_10238830 3300025893 Bacteria 844
201 Ga0207699_10049656 3300025906 Bacteria 2471
202 Ga0207645_10063929 3300025907 Bacteria 2351
203 Ga0207645_10100294 3300025907 Bacteria 1867
204 Ga0207643_10072922 3300025908 Bacteria 1978
205 Ga0207705_10011580 3300025909 Bacteria 6376
206 Ga0207705_10041342 3300025909 Bacteria 3308
207 Ga0207705_10063915 3300025909 Bacteria 2659
208 Ga0207705_10721793 3300025909 Bacteria 774
209 Ga0207654_10370438 3300025911 Bacteria 990
210 Ga0207707_10111912 3300025912 Bacteria 2387
211 Ga0207707_11143852 3300025912 Unclassified 632
212 Ga0207707_11184412 3300025912 Bacteria 619
213 Ga0207707_11669068 3300025912 Unclassified 500
214 Ga0207695_10010495 3300025913 Bacteria 11330
215 Ga0207695_10126057 3300025913 Bacteria 2522
216 Ga0207695_10199384 3300025913 Bacteria 1916
217 Ga0207695_10254178 3300025913 Bacteria 1656
218 Ga0207695_10261345 3300025913 Bacteria 1629
219 Ga0207695_10374381 3300025913 Bacteria 1310
220 Ga0207695_11035293 3300025913 Bacteria 700
221 Ga0207671_10752662 3300025914 Bacteria 774
222 Ga0207671_11063425 3300025914 Unclassified 636
223 Ga0207663_10121881 3300025916 Bacteria 1787
224 Ga0207663_10189784 3300025916 Bacteria 1475
225 Ga0207660_10099958 3300025917 Bacteria 2165
226 Ga0207660_10256292 3300025917 Bacteria 1382
227 Ga0207662_10354313 3300025918 Bacteria 986
228 Ga0207657_10061027 3300025919 Bacteria 3235
229 Ga0207657_10552932 3300025919 Bacteria 900
230 Ga0207649_10737234 3300025920 Bacteria 766
231 Ga0207649_10870596 3300025920 Unclassified 705
232 Ga0207649_11154076 3300025920 Bacteria 612
233 Ga0207652_10057115 3300025921 Bacteria 3361
234 Ga0207652_10151763 3300025921 Bacteria 2075
235 Ga0207646_10747623 3300025922 Bacteria 873
236 Ga0207681_10202128 3300025923 Bacteria 1526
237 Ga0207694_10124935 3300025924 Bacteria 2057
238 Ga0207694_10316243 3300025924 Bacteria 1288
239 Ga0207694_10416437 3300025924 Bacteria 1119
240 Ga0207694_10551606 3300025924 Bacteria 967
241 Ga0207659_10055689 3300025926 Bacteria 2830
242 Ga0207659_10079564 3300025926 Bacteria 2418
243 Ga0207687_10134432 3300025927 Bacteria 1869
244 Ga0207687_10349241 3300025927 Bacteria 1205
245 Ga0207687_11118322 3300025927 Bacteria 677
246 Ga0207700_10127745 3300025928 Bacteria 2071
247 Ga0207700_10351670 3300025928 Bacteria 1283
248 Ga0207664_11688094 3300025929 Bacteria 556
249 Ga0207644_10698586 3300025931 Bacteria 846
250 Ga0207644_11461899 3300025931 Bacteria 574
251 Ga0207690_10064053 3300025932 Bacteria 2509
252 Ga0207690_10667998 3300025932 Bacteria 852
253 Ga0207706_10341303 3300025933 Bacteria 1303
254 Ga0207686_10200570 3300025934 Bacteria 1429
255 Ga0207709_10159721 3300025935 Bacteria 1570
256 Ga0207670_10020514 3300025936 Bacteria 4062
257 Ga0207670_10070895 3300025936 Bacteria 2408
258 Ga0207670_10228926 3300025936 Bacteria 1426
259 Ga0207669_10084583 3300025937 Bacteria 2045
260 Ga0207669_10225795 3300025937 Bacteria 1378
261 Ga0207704_10042755 3300025938 Bacteria 2670
262 Ga0207665_10233267 3300025939 Bacteria 1353
263 Ga0207691_10010895 3300025940 Bacteria 8725
264 Ga0207691_10631546 3300025940 Unclassified 906
265 Ga0207691_11499293 3300025940 Bacteria 551
266 Ga0207689_10040515 3300025942 Bacteria 3855
267 Ga0207689_10062584 3300025942 Bacteria 3060
268 Ga0207661_10368635 3300025944 Unclassified 1298
269 Ga0207661_12185304 3300025944 Bacteria 500
270 Ga0207667_10002442 3300025949 Bacteria 23238
271 Ga0207667_10018357 3300025949 Bacteria 7847
272 Ga0207667_10030329 3300025949 Bacteria 5852
273 Ga0207667_10097850 3300025949 Bacteria 3028
274 Ga0207667_10139314 3300025949 Bacteria 2498
275 Ga0207651_10447271 3300025960 Bacteria 1108
276 Ga0207651_10618326 3300025960 Bacteria 949
277 Ga0207668_11446226 3300025972 Bacteria 620
278 Ga0207640_10268580 3300025981 Bacteria 1333
279 Ga0207640_10358035 3300025981 Bacteria 1175
280 Ga0207640_11081359 3300025981 Bacteria 709
281 Ga0207640_11742994 3300025981 Bacteria 562
282 Ga0207677_10150531 3300026023 Bacteria 1795
283 Ga0207677_10265010 3300026023 Bacteria 1402
284 Ga0207677_11196682 3300026023 Bacteria 695
285 Ga0207639_10011177 3300026041 Bacteria 6228
286 Ga0207639_10112634 3300026041 Bacteria 2220
287 Ga0207639_11296027 3300026041 Bacteria 684
288 Ga0207639_11713961 3300026041 Bacteria 589
289 Ga0207708_10211170 3300026075 Bacteria 1552
290 Ga0207708_10454329 3300026075 Bacteria 1067
291 Ga0207702_10176610 3300026078 Bacteria 1963
292 Ga0207641_10421788 3300026088 Bacteria 1285
293 Ga0207641_11975221 3300026088 Bacteria 585
294 Ga0207648_10072939 3300026089 Bacteria 2992
295 Ga0207648_10076090 3300026089 Bacteria 2926
296 Ga0207648_10711040 3300026089 Bacteria 931
297 Ga0207676_10096183 3300026095 Bacteria 2444
298 Ga0207674_10027001 3300026116 Bacteria 6086
299 Ga0207675_101273266 3300026118 Bacteria 756
300 Ga0207683_10028095 3300026121 Bacteria 4864
301 Ga0207683_10053727 3300026121 Bacteria 3532
302 Ga0207683_10403067 3300026121 Bacteria 1258
303 Ga0207698_10001358 3300026142 Bacteria 14256
304 Ga0207698_10079881 3300026142 Bacteria 2632
305 Ga0207698_10624888 3300026142 Bacteria 1064
306 Ga0207698_11628650 3300026142 Bacteria 661
307 Ga0268266_10550282 3300028379 Bacteria 1106
308 Ga0268265_10403925 3300028380 Bacteria 1264
309 Ga0265330_10129166 3300031235 Bacteria 1076
310 Ga0265325_10284833 3300031241 Bacteria 740
311 Ga0265340_10110980 3300031247 Bacteria 1268
312 Ga0265339_10559668 3300031249 Bacteria 525
313 Ga0265316_11007236 3300031344 Bacteria 579
314 Ga0307408_100133576 3300031548 Bacteria 1939
315 Ga0307408_100185891 3300031548 Bacteria 1670
316 Ga0307408_100348239 3300031548 Bacteria 1256
317 Ga0307408_100668223 3300031548 Unclassified 931
318 Ga0307408_101449341 3300031548 Bacteria 648
319 Ga0307405_10321564 3300031731 Bacteria 1182
320 Ga0307405_10867859 3300031731 Bacteria 761
321 Ga0307412_10462264 3300031911 Bacteria 1048
322 Ga0307409_102144810 3300031995 Unclassified 588
323 Ga0307416_100497929 3300032002 Bacteria 1282
324 Ga0307416_101417762 3300032002 Bacteria 800
325 Ga0307414_11428872 3300032004 Bacteria 643
326 Ga0307415_102511056 3300032126 Bacteria 508
327 Ga0373948_0167464 3300034817 Bacteria 558
328 Ga0373928_0113791 3300035084 Bacteria 718
329 Ga0373952_0087115 3300035092 Bacteria 806
330 Ga0373932_0151929 3300035112 Bacteria 795
331 Ga0373956_0441218 3300035119 Archaea 621
332 Ga0373957_0066571 3300035120 Bacteria 1403
333 Ga0373946_0675502 3300035171 Bacteria 539
334 Ga0373955_0023703 3300035172 Bacteria 3130
335 Ga0373961_0109519 3300035241 Bacteria 903
336 Ga0373924_0081909 3300035410 Bacteria 1373
337 Ga0373935_0288007 3300035692 Bacteria 1158
338 Ga0373933_0131147 3300035724 Bacteria 1576
339 Ga0373933_0264742 3300035724 Bacteria 1109
340 Ga0373947_0197005 3300035725 Bacteria 1317
341 Ga0373937_0019621 3300036401 Bacteria 6052
342 Ga0373925_0050372 3300037068 Bacteria 3106
343 Ga0373925_0461664 3300037068 Bacteria 1041
344 Ga0395899_0046474 3300037312 Bacteria 3234
345 Ga0395900_0032139 3300037418 Bacteria 5395
346 Ga0395898_0677768 3300037466 Bacteria 973
347 Ga0395905_0004219 3300037471 Bacteria 15026
348 Ga0395901_0022523 3300038443 Bacteria 6458
349 Ga0395901_1492267 3300038443 Bacteria 632
350 Ga0436365_1868437 3300039437 Bacteria 7789
351 Ga0436360_1323432 3300039438 Bacteria 707
352 Ga0436363_1175021 3300039450 Unclassified 518
353 Ga0451802_0648806 3300041460 Bacteria 502
354 Ga0451807_0833148 3300041486 Bacteria 707
355 Ga0451839_0298637 3300041496 Unclassified 658
356 Ga0451843_0530087 3300041509 Bacteria 592
357 Ga0451843_1186840 3300041509 Bacteria 955
358 Ga0451853_0186944 3300041512 Bacteria 684
359 Ga0451853_4026943 3300041512 Bacteria 635
360 Ga0450898_155733 3300042134 Unclassified 502
361 Ga0451577_0673324 3300042876 Bacteria 938
362 Ga0466966_0072189 3300044684 Bacteria 2162
363 Ga0466966_0409570 3300044684 Bacteria 815
364 Ga0466961_0112135 3300044693 Bacteria 1715
365 Ga0466963_1229940 3300044694 Bacteria 526
366 Ga0453684_0373152 3300044712 Bacteria 1603
367 Ga0466971_0153752 3300044719 Bacteria 1075
368 Ga0466957_0023594 3300044842 Bacteria 3637
369 Ga0466959_0101701 3300045049 Bacteria 2057
370 Ga0451576_0373822 3300045051 Bacteria 1493
371 Ga0466958_0032850 3300045836 Bacteria 3089
372 Ga0466967_0145912 3300045976 Bacteria 2208
373 Ga0495592_0044964 3300046454 Bacteria 3296
374 Ga0495629_0439679 3300046459 Bacteria 884
375 Ga0495638_0009171 3300046460 Bacteria 6959
376 Ga0495651_0194613 3300046462 Bacteria 1424
377 Ga0495653_0068009 3300046463 Bacteria 2673
378 Ga0495608_0033461 3300046511 Bacteria 3473
379 Ga0495628_0037292 3300046516 Bacteria 3898
380 Ga0495644_0297023 3300046523 Bacteria 632
381 Ga0495652_0030832 3300046529 Bacteria 4699
382 Ga0495587_0020153 3300046536 Bacteria 4119
383 Ga0495621_0029299 3300046539 Bacteria 1876
384 Ga0495621_0245278 3300046539 Bacteria 730
385 Ga0495667_0019582 3300046559 Bacteria 4565
386 Ga0495625_0031743 3300046660 Bacteria 3926
387 Ga0495659_0286676 3300046664 Bacteria 693
388 Ga0495659_0555211 3300046664 Bacteria 507
389 Ga0495657_0207510 3300046675 Bacteria 1192
390 Ga0495599_0025710 3300046678 Bacteria 3687
391 Ga0495623_0055044 3300046679 Bacteria 2509
392 Ga0495646_0433571 3300046680 Bacteria 680
393 Ga0495647_0429308 3300046681 Bacteria 610
394 Ga0495624_0795831 3300046690 Unclassified 559
395 Ga0495600_0394923 3300046809 Bacteria 861
396 Ga0495604_0151074 3300047317 Bacteria 1650
397 Ga0495636_0555078 3300047318 Bacteria 559
398 Ga0495675_0193784 3300047444 Bacteria 1239
399 Ga0495684_0297681 3300047471 Bacteria 1159
400 Ga0495602_0203353 3300048088 Bacteria 1509
401 Ga0496100_1580129 3300048903 Bacteria 518
402 Ga0496101_1339496 3300048904 Bacteria 559
403 Ga0496104_0033429 3300048907 Bacteria 4790
404 Ga0496105_0073443 3300048908 Bacteria 2826
405 Ga0496108_1143145 3300048911 Bacteria 660
406 Ga0496109_0674610 3300048912 Bacteria 971
407 Ga0496110_0007375 3300048913 Bacteria 8778
408 Ga0496111_0031393 3300048914 Bacteria 3784
409 Ga0496118_0165092 3300048921 Unclassified 1362
410 Ga0501299_156505 3300049522 Bacteria 579
411 Ga0501034_0431212 3300049571 Bacteria 1238
412 Ga0501042_0802227 3300049578 Bacteria 685
413 Ga0501046_0507741 3300049580 Bacteria 863
414 Ga0501047_0003515 3300049581 Bacteria 14801
415 Ga0501067_0372198 3300049583 Bacteria 797
416 Ga0501067_0432674 3300049583 Bacteria 734
417 Ga0501068_0044737 3300049584 Bacteria 2666
418 Ga0501069_0004431 3300049585 Bacteria 7253
419 Ga0501070_0002632 3300049586 Bacteria 15676
420 Ga0501070_0770101 3300049586 Bacteria 757
421 Ga0501070_1311289 3300049586 Bacteria 552
422 Ga0501072_0222930 3300049588 Bacteria 1503
423 Ga0501073_0000065 3300049589 Bacteria 65736
424 Ga0501074_0000486 3300049590 Bacteria 24192
425 Ga0501074_0617878 3300049590 Bacteria 766
426 Ga0501079_0011752 3300049741 Bacteria 6688
427 Ga0501079_1254611 3300049741 Bacteria 584
428 Ga0501080_0028350 3300049742 Bacteria 5208
429 Ga0501083_0000604 3300049744 Bacteria 23119
430 Ga0501083_0432176 3300049744 Unclassified 857
431 nmdc:mga0k408_1775_c1 3300050493 Bacteria 11575
432 nmdc:mga07m45_24202_c1 3300050496 Bacteria 3324
433 nmdc:mga05p37_74156_c1 3300050507 Bacteria 4188
434 nmdc:mga09592_37742_c1 3300050508 Bacteria 4053
435 nmdc:mga06r32_121515_c1 3300050510 Bacteria 2577
436 nmdc:mga0n895_1058525_c1 3300050512 Unclassified 790
437 nmdc:mga0rr50_1727030_c1 3300050513 Unclassified 527
438 nmdc:mga0rr50_825025_c1 3300050513 Bacteria 791
439 Ga0495601_0027785 3300053077 Bacteria 3500
440 Ga0495595_0110525 3300053084 Bacteria 1332
441 Ga0495619_0020422 3300053085 Bacteria 4218
442 Ga0501084_0222567 3300054114 Bacteria 1592
443 Ga0501084_0317182 3300054114 Bacteria 1317
444 Ga0466962_0076001 3300061719 Bacteria 1605
445 Ga0265316_10074112
446 Ga0065704_10435002
447 Ga0065712_10099953
448 Ga0070658_10079096
449 Ga0070658_11007363
450 Ga0070676_10092649
451 Ga0070683_102121474
452 Ga0070690_100437088
453 Ga0070677_10756094
454 Ga0068869_100022522
455 Ga0070680_100100077
456 Ga0070680_100360920
457 Ga0070680_101535100
458 Ga0068868_100009652
459 Ga0068868_100602276
460 Ga0068868_100878237
461 Ga0070660_100098119
462 Ga0070660_100187457
463 Ga0070660_100474124
464 Ga0070689_100039656
465 Ga0070689_100687187
466 Ga0070687_100123260
467 Ga0070687_100330176
468 Ga0070661_100472601
469 Ga0070661_100553081
470 Ga0070661_100970038
471 Ga0070661_101334440
472 Ga0070661_101783598
473 Ga0070692_10186455
474 Ga0070692_10383302
475 Ga0070692_10422416
476 Ga0070669_100324673
477 Ga0070669_100931900
478 Ga0070675_100090115
479 Ga0070675_100184977
480 Ga0070675_100434207
481 Ga0070675_100636666
482 Ga0070671_100571365
483 Ga0070674_100194330
484 Ga0070674_100541030
485 Ga0070673_100322108
486 Ga0070673_100531341
487 Ga0070688_100144088
488 Ga0070688_100343613
489 Ga0070688_100827958
490 Ga0070659_100035952
491 Ga0070659_100467280
492 Ga0070659_100490141
493 Ga0070659_100788365
494 Ga0070659_101219937
495 Ga0070714_100060795
496 Ga0070714_101092561
497 Ga0070713_100014170
498 Ga0070713_100160413
499 Ga0070711_100373110
500 Ga0070711_100383056
501 Ga0070705_100029443
502 Ga0070705_100074935
503 Ga0070700_100115744
504 Ga0070708_101319996
505 Ga0070678_100110864
506 Ga0070678_100241398
507 Ga0070678_100347356
508 Ga0070662_101183870
509 Ga0070662_101835032
510 Ga0070681_10066155
511 Ga0070681_11873748
512 Ga0068867_100076790
513 Ga0068867_100131621
514 Ga0070706_102099346
515 Ga0070707_100325349
516 Ga0070699_100505958
517 Ga0070699_100609495
518 Ga0070679_100043168
519 Ga0070679_100193960
520 Ga0070679_100834255
521 Ga0070684_100046668
522 Ga0070684_101022405
523 Ga0070684_101085873
524 Ga0068853_100192518
525 Ga0070672_100081965
526 Ga0070672_101438524
527 Ga0070686_100464184
528 Ga0070686_101768779
529 Ga0070695_100397438
530 Ga0070695_101715319
531 Ga0070696_100134668
532 Ga0070696_100500431
533 Ga0070693_100002544
534 Ga0070693_101319732
535 Ga0070665_100930083
536 Ga0070665_101110895
537 Ga0068855_100005893
538 Ga0068855_100021701
539 Ga0068855_100096548
540 Ga0068855_101584554
541 Ga0068855_101724501
542 Ga0068855_102221056
543 Ga0070664_100554291
544 Ga0068857_100071165
545 Ga0068857_100839135
546 Ga0068854_100444434
547 Ga0068854_100560110
548 Ga0068854_100908515
549 Ga0068854_101673710
550 Ga0068856_100121765
551 Ga0070702_100125375
552 Ga0070702_100141772
553 Ga0070702_101359620
554 Ga0068852_100000134
555 Ga0068852_100103089
556 Ga0068852_100449298
557 Ga0068852_101358147
558 Ga0068859_101321553
559 Ga0068864_100472258
560 Ga0068861_100634835
561 Ga0068851_10001300
562 Ga0068851_10046778
563 Ga0068870_10038419
564 Ga0068863_101054361
565 Ga0075364_10610788
566 Ga0070716_100246247
567 Ga0070712_100713791
568 Ga0075366_10000945
569 Ga0097621_100079352
570 Ga0097621_100131396
571 Ga0097621_100137005
572 Ga0075370_10016433
573 Ga0068871_100004769
574 Ga0075431_100076590
575 Ga0075429_100043946
576 Ga0068865_100171219
577 Ga0075436_100249302
578 Ga0097620_101321671
579 Ga0075435_101084387
580 Ga0075435_101274447
581 Ga0105240_10012696
582 Ga0105240_10117352
583 Ga0105240_10131528
584 Ga0105240_10197386
585 Ga0105240_10393870
586 Ga0105240_11212113
587 Ga0111539_12537563
588 Ga0105245_10153090
589 Ga0105245_10204956
590 Ga0105245_10774530
591 Ga0105245_11038761
592 Ga0105245_11617627
593 Ga0105245_12944158
594 Ga0105243_10585677
595 Ga0105241_10007901
596 Ga0105241_10892780
597 Ga0105241_11601159
598 Ga0105242_10376774
599 Ga0105248_10162992
600 Ga0105237_10231575
601 Ga0105238_10001871
602 Ga0105238_10008062
603 Ga0105238_10595737
604 Ga0105238_10641141
605 Ga0105238_10678123
606 Ga0105238_10897450
607 Ga0105239_10668022
608 Ga0105239_10946306
609 Ga0105246_10230424
610 Ga0105246_10792933
611 Ga0105246_10806125
612 Ga0157371_10397078
613 Ga0157371_10956668
614 Ga0157370_10096239
615 Ga0157370_10294655
616 Ga0157370_10407688
617 Ga0157370_10725149
618 Ga0157369_10024477
619 Ga0157369_10127739
620 Ga0157374_10064524
621 Ga0157374_11745077
622 Ga0157378_10172732
623 Ga0157378_10506073
624 Ga0163162_12907810
625 Ga0157372_10020619
626 Ga0157372_10087739
627 Ga0157372_10104220
628 Ga0157372_10791567
629 Ga0157372_12216922
630 Ga0157372_13439895
631 Ga0157375_10726934
632 Ga0157375_13703387
633 Ga0163163_11654562
634 Ga0157380_10695458
635 Ga0157377_10123615
636 Ga0157376_10227651
637 Ga0206356_10764669
638 Ga0206356_10815016
639 Ga0206354_10390052
640 Ga0206353_10954363
641 Ga0206353_11374805
642 Ga0207656_10000379
643 Ga0207656_10265193
644 Ga0207682_10238830
645 Ga0207699_10049656
646 Ga0207645_10063929
647 Ga0207645_10100294
648 Ga0207643_10072922
649 Ga0207705_10011580
650 Ga0207705_10041342
651 Ga0207705_10063915
652 Ga0207705_10721793
653 Ga0207654_10370438
654 Ga0207707_10111912
655 Ga0207707_11143852
656 Ga0207707_11184412
657 Ga0207707_11669068
658 Ga0207695_10010495
659 Ga0207695_10126057
660 Ga0207695_10199384
661 Ga0207695_10254178
662 Ga0207695_10261345
663 Ga0207695_10374381
664 Ga0207695_11035293
665 Ga0207671_10752662
666 Ga0207671_11063425
667 Ga0207663_10121881
668 Ga0207663_10189784
669 Ga0207660_10099958
670 Ga0207660_10256292
671 Ga0207662_10354313
672 Ga0207657_10061027
673 Ga0207657_10552932
674 Ga0207649_10737234
675 Ga0207649_10870596
676 Ga0207649_11154076
677 Ga0207652_10057115
678 Ga0207652_10151763
679 Ga0207646_10747623
680 Ga0207681_10202128
681 Ga0207694_10124935
682 Ga0207694_10316243
683 Ga0207694_10416437
684 Ga0207694_10551606
685 Ga0207659_10055689
686 Ga0207659_10079564
687 Ga0207687_10134432
688 Ga0207687_10349241
689 Ga0207687_11118322
690 Ga0207700_10127745
691 Ga0207700_10351670
692 Ga0207664_11688094
693 Ga0207644_10698586
694 Ga0207644_11461899
695 Ga0207690_10064053
696 Ga0207690_10667998
697 Ga0207706_10341303
698 Ga0207686_10200570
699 Ga0207709_10159721
700 Ga0207670_10020514
701 Ga0207670_10070895
702 Ga0207670_10228926
703 Ga0207669_10084583
704 Ga0207669_10225795
705 Ga0207704_10042755
706 Ga0207665_10233267
707 Ga0207691_10010895
708 Ga0207691_10631546
709 Ga0207691_11499293
710 Ga0207689_10040515
711 Ga0207689_10062584
712 Ga0207661_10368635
713 Ga0207661_12185304
714 Ga0207667_10002442
715 Ga0207667_10018357
716 Ga0207667_10030329
717 Ga0207667_10097850
718 Ga0207667_10139314
719 Ga0207651_10447271
720 Ga0207651_10618326
721 Ga0207668_11446226
722 Ga0207640_10268580
723 Ga0207640_10358035
724 Ga0207640_11081359
725 Ga0207640_11742994
726 Ga0207677_10150531
727 Ga0207677_10265010
728 Ga0207677_11196682
729 Ga0207639_10011177
730 Ga0207639_10112634
731 Ga0207639_11296027
732 Ga0207639_11713961
733 Ga0207708_10211170
734 Ga0207708_10454329
735 Ga0207702_10176610
736 Ga0207641_10421788
737 Ga0207641_11975221
738 Ga0207648_10072939
739 Ga0207648_10076090
740 Ga0207648_10711040
741 Ga0207676_10096183
742 Ga0207674_10027001
743 Ga0207675_101273266
744 Ga0207683_10028095
745 Ga0207683_10053727
746 Ga0207683_10403067
747 Ga0207698_10001358
748 Ga0207698_10079881
749 Ga0207698_10624888
750 Ga0207698_11628650
751 Ga0268266_10550282
752 Ga0268265_10403925
753 Ga0265330_10129166
754 Ga0265325_10284833
755 Ga0265340_10110980
756 Ga0265339_10559668
757 Ga0265316_11007236
758 Ga0307408_100133576
759 Ga0307408_100185891
760 Ga0307408_100348239
761 Ga0307408_100668223
762 Ga0307408_101449341
763 Ga0307405_10321564
764 Ga0307405_10867859
765 Ga0307412_10462264
766 Ga0307409_102144810
767 Ga0307416_100497929
768 Ga0307416_101417762
769 Ga0307414_11428872
770 Ga0307415_102511056
771 Ga0373948_0167464
772 Ga0373928_0113791
773 Ga0373952_0087115
774 Ga0373932_0151929
775 Ga0373956_0441218
776 Ga0373957_0066571
777 Ga0373946_0675502
778 Ga0373955_0023703
779 Ga0373961_0109519
780 Ga0373924_0081909
781 Ga0373935_0288007
782 Ga0373933_0131147
783 Ga0373933_0264742
784 Ga0373947_0197005
785 Ga0373937_0019621
786 Ga0373925_0050372
787 Ga0373925_0461664
788 Ga0395899_0046474
789 Ga0395900_0032139
790 Ga0395898_0677768
791 Ga0395905_0004219
792 Ga0395901_0022523
793 Ga0395901_1492267
794 Ga0436365_1868437
795 Ga0436360_1323432
796 Ga0436363_1175021
797 Ga0451802_0648806
798 Ga0451807_0833148
799 Ga0451839_0298637
800 Ga0451843_0530087
801 Ga0451843_1186840
802 Ga0451853_0186944
803 Ga0451853_4026943
804 Ga0450898_155733
805 Ga0451577_0673324
806 Ga0466966_0072189
807 Ga0466966_0409570
808 Ga0466961_0112135
809 Ga0466963_1229940
810 Ga0453684_0373152
811 Ga0466971_0153752
812 Ga0466957_0023594
813 Ga0466959_0101701
814 Ga0451576_0373822
815 Ga0466958_0032850
816 Ga0466967_0145912
817 Ga0495592_0044964
818 Ga0495629_0439679
819 Ga0495638_0009171
820 Ga0495651_0194613
821 Ga0495653_0068009
822 Ga0495608_0033461
823 Ga0495628_0037292
824 Ga0495644_0297023
825 Ga0495652_0030832
826 Ga0495587_0020153
827 Ga0495621_0029299
828 Ga0495621_0245278
829 Ga0495667_0019582
830 Ga0495625_0031743
831 Ga0495659_0286676
832 Ga0495659_0555211
833 Ga0495657_0207510
834 Ga0495599_0025710
835 Ga0495623_0055044
836 Ga0495646_0433571
837 Ga0495647_0429308
838 Ga0495624_0795831
839 Ga0495600_0394923
840 Ga0495604_0151074
841 Ga0495636_0555078
842 Ga0495675_0193784
843 Ga0495684_0297681
844 Ga0495602_0203353
845 Ga0496100_1580129
846 Ga0496101_1339496
847 Ga0496104_0033429
848 Ga0496105_0073443
849 Ga0496108_1143145
850 Ga0496109_0674610
851 Ga0496110_0007375
852 Ga0496111_0031393
853 Ga0496118_0165092
854 Ga0501299_156505
855 Ga0501034_0431212
856 Ga0501042_0802227
857 Ga0501046_0507741
858 Ga0501047_0003515
859 Ga0501067_0372198
860 Ga0501067_0432674
861 Ga0501068_0044737
862 Ga0501069_0004431
863 Ga0501070_0002632
864 Ga0501070_0770101
865 Ga0501070_1311289
866 Ga0501072_0222930
867 Ga0501073_0000065
868 Ga0501074_0000486
869 Ga0501074_0617878
870 Ga0501079_0011752
871 Ga0501079_1254611
872 Ga0501080_0028350
873 Ga0501083_0000604
874 Ga0501083_0432176
875 nmdc:mga0k408_1775_c1
876 nmdc:mga07m45_24202_c1
877 nmdc:mga05p37_74156_c1
878 nmdc:mga09592_37742_c1
879 nmdc:mga06r32_121515_c1
880 nmdc:mga0n895_1058525_c1
881 nmdc:mga0rr50_1727030_c1
882 nmdc:mga0rr50_825025_c1
883 Ga0495601_0027785
884 Ga0495595_0110525
885 Ga0495619_0020422
886 Ga0501084_0222567
887 Ga0501084_0317182
888 Ga0466962_0076001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

13

87

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9304 13 97
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.9256 14 101
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9127 9 97
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8928 9 97
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8781 14 98
ID Description Score Start End Superfamily
3o2eA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9256 14 101 3.30.300.90
af_Q682I1_66_160_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9194 13 97 3.30.300.90
af_Q9H3K6_1_86_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9127 14 101 3.10.20.90
af_Q69ZI6_1_85_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9086 14 102 3.10.20.90
af_Q54G84_40_127_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9027 14 97 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A3N8P9R4-F1-model_v4 BolA family transcriptional regulator 0.9711 8 101 GO:0016226
AF-A0A1M4STV9-F1-model_v4 Transcriptional regulator, BolA protein family 0.9706 10 97 GO:0016226
AF-A0A0U3EYB3-F1-model_v4 BolA family transcriptional regulator 0.9692 14 97 GO:0016226
AF-A0A849X2E8-F1-model_v4 BolA family transcriptional regulator 0.9689 8 95 GO:0016226
AF-A0A0D0FY26-F1-model_v4 BolA-like family protein 0.9676 8 101 GO:0016226

Map