F445178

General Info

Members Datasets Scaffolds Average Seq Length
443 279 417 256

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0099651|Ga0500578_0099651_878_1714
Length 278
Sequence MSSPDRPKSDHRRAQHEGTPVISPLIFITGASSGIGQALAARFHRAGYRLALVARRAESVSAWAQAQGFDAASFAVYAADVRDVNAIVGVGRECMARQGLPDVVIANAGISVGMDTAEFDDLEVMRTTFETNNLGMAATFHPFVSAMRDRRSGTLVGIASVAGIRGLPGHGAYCSSKAAVIAYCESLRGELQSSNVRVVTIGPGYIDTPLTRENPYGMPFLMQADDFADRAFSAIVRGVSYRVIPWQMGVVAKLMRLLPNVLFDKAVGGRARKPRQKK

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
6 2643221570 Acidovorax sp. Root568 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2816332133 Acidovorax radicis 2721A Isolate Unclassified
17 2831864461 Roseateles noduli HZ7 Isolate Nodule
18 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
19 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
20 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
21 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
22 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
23 2928058823 Ralstonia sp. 1138 Isolate Unclassified
24 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
25 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
188 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
189 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
190 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
193 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
243 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
265 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
270 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
271 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
272 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
279 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.13
Metatranscriptomes 0
Isolates 5.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.44
Nodule 0.9
Rhizoplane 2.26
Rhizosphere 53.05
Stem 0
Stem Tuber 0
Unclassified 15.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030321 3300001979 Bacteria 1762
2 JGI25152J39213_1001209 3300002773 Bacteria 11840
3 JGI25150J39212_1013781 3300002774 Bacteria 1389
4 JGI25153J46596_10004156 3300003215 Bacteria 7862
5 JGI25153J46596_10019569 3300003215 Bacteria 2588
6 rootH1_10010532 3300003316 Bacteria 4738
7 rootH1_10023689 3300003316 Bacteria 1270
8 rootL2_10003007 3300003322 Bacteria 53160
9 rootL2_10035584 3300003322 Bacteria 4662
10 rootL2_10065163 3300003322 Bacteria 5190
11 rootH1_10003144 3300003323 Bacteria 41895
12 Ga0055539_1000522 3300003752 Bacteria 11764
13 Ga0055533_1000026 3300003756 Bacteria 323407
14 Ga0055533_1000068 3300003756 Bacteria 155215
15 Ga0055525_1000036 3300003759 Bacteria 298878
16 Ga0055525_1003040 3300003759 Bacteria 1553
17 Ga0055526_1015937 3300003771 Bacteria 2982
18 Ga0055526_1028531 3300003771 Bacteria 1686
19 Ga0055524_1003664 3300003775 Bacteria 7366
20 Ga0055530_10021005 3300003791 Bacteria 1935
21 Ga0055540_1025694 3300003792 Bacteria 1437
22 Ga0055531_10000519 3300003794 Bacteria 34728
23 Ga0055531_10005443 3300003794 Bacteria 7453
24 Ga0055543_1008757 3300004625 Bacteria 2219
25 Ga0065165_1000304 3300005262 Bacteria 81791
26 Ga0065165_1000757 3300005262 Bacteria 43947
27 Ga0065165_1002631 3300005262 Bacteria 14600
28 Ga0070676_10018873 3300005328 Bacteria 3829
29 Ga0070690_100055751 3300005330 Bacteria 2532
30 Ga0070690_100074532 3300005330 Bacteria 2211
31 Ga0070670_100034439 3300005331 Bacteria 4358
32 Ga0068869_100029092 3300005334 Bacteria 3868
33 Ga0068869_100206925 3300005334 Bacteria 1550
34 Ga0070666_10002560 3300005335 Bacteria 10993
35 Ga0068868_100110446 3300005338 Bacteria 2233
36 Ga0068868_100227084 3300005338 Bacteria 1565
37 Ga0070668_100195028 3300005347 Bacteria 1660
38 Ga0070675_100003315 3300005354 Bacteria 12210
39 Ga0070671_100008293 3300005355 Bacteria 8313
40 Ga0070671_100612918 3300005355 Bacteria 941
41 Ga0070674_100168434 3300005356 Bacteria 1668
42 Ga0070674_100408915 3300005356 Bacteria 1111
43 Ga0070673_100056564 3300005364 Bacteria 3095
44 Ga0070659_100359036 3300005366 Bacteria 1224
45 Ga0070659_100389430 3300005366 Bacteria 1175
46 Ga0070667_100001374 3300005367 Bacteria 21779
47 Ga0070667_100025564 3300005367 Bacteria 4909
48 Ga0070663_100426948 3300005455 Bacteria 1088
49 Ga0070678_100159121 3300005456 Bacteria 1828
50 Ga0070662_100024822 3300005457 Bacteria 4134
51 Ga0068867_100000004 3300005459 Bacteria 180739
52 Ga0068867_100076981 3300005459 Bacteria 2506
53 Ga0068867_100457597 3300005459 Bacteria 1089
54 Ga0070706_100004299 3300005467 Bacteria 13799
55 Ga0070672_100007483 3300005543 Bacteria 7414
56 Ga0070672_100073928 3300005543 Bacteria 2718
57 Ga0070665_100097268 3300005548 Bacteria 2949
58 Ga0070665_100362243 3300005548 Bacteria 1456
59 Ga0068855_100237051 3300005563 Bacteria 2040
60 Ga0068855_100275725 3300005563 Bacteria 1869
61 Ga0068857_100046187 3300005577 Bacteria 3864
62 Ga0068857_100075322 3300005577 Bacteria 3009
63 Ga0068857_100624214 3300005577 Bacteria 1020
64 Ga0068859_100413501 3300005617 Bacteria 1445
65 Ga0068859_100508285 3300005617 Bacteria 1300
66 Ga0068864_100423752 3300005618 Bacteria 1268
67 Ga0068861_100062863 3300005719 Bacteria 2852
68 Ga0068861_100413703 3300005719 Bacteria 1200
69 Ga0068851_10098223 3300005834 Bacteria 1550
70 Ga0068863_100043338 3300005841 Bacteria 4272
71 Ga0068863_100062304 3300005841 Bacteria 3527
72 Ga0068858_100001797 3300005842 Bacteria 21879
73 Ga0068858_100669567 3300005842 Bacteria 1009
74 Ga0068860_100177320 3300005843 Bacteria 2059
75 Ga0068862_100707988 3300005844 Bacteria 976
76 Ga0075365_10001315 3300006038 Bacteria 11091
77 Ga0075368_10093983 3300006042 Bacteria 1228
78 Ga0075368_10129818 3300006042 Bacteria 1047
79 Ga0075363_100053395 3300006048 Bacteria 2159
80 Ga0075364_10026450 3300006051 Bacteria 3702
81 Ga0075364_10295814 3300006051 Bacteria 1102
82 Ga0075362_10094634 3300006177 Bacteria 1390
83 Ga0075367_10006530 3300006178 Bacteria 5900
84 Ga0075367_10149406 3300006178 Bacteria 1449
85 Ga0075369_10029610 3300006186 Bacteria 2301
86 Ga0075369_10041564 3300006186 Bacteria 1969
87 Ga0075366_10006106 3300006195 Bacteria 6567
88 Ga0075366_10010775 3300006195 Bacteria 5140
89 Ga0075366_10052817 3300006195 Bacteria 2414
90 Ga0075366_10065678 3300006195 Bacteria 2158
91 Ga0075366_10083115 3300006195 Bacteria 1914
92 Ga0075366_10251641 3300006195 Bacteria 1077
93 Ga0097621_100340064 3300006237 Bacteria 1333
94 Ga0075370_10002116 3300006353 Bacteria 9060
95 Ga0075370_10003398 3300006353 Bacteria 7569
96 Ga0075370_10011645 3300006353 Bacteria 4627
97 Ga0075370_10021591 3300006353 Bacteria 3527
98 Ga0075370_10184165 3300006353 Bacteria 1230
99 Ga0075370_10223567 3300006353 Bacteria 1113
100 Ga0068871_100334295 3300006358 Bacteria 1336
101 Ga0068871_100337002 3300006358 Bacteria 1331
102 Ga0075430_100350977 3300006846 Bacteria 1218
103 Ga0075429_100003990 3300006880 Bacteria 12633
104 Ga0068865_100437427 3300006881 Bacteria 1079
105 Ga0097620_100413468 3300006931 Bacteria 1445
106 Ga0097620_100508192 3300006931 Bacteria 1300
107 Ga0099823_1000015 3300006944 Bacteria 88096
108 Ga0079104_1018865 3300006946 Bacteria 1943
109 Ga0105240_10154640 3300009093 Bacteria 2729
110 Ga0105240_10197986 3300009093 Bacteria 2356
111 Ga0105245_10084908 3300009098 Bacteria 2901
112 Ga0105245_10095807 3300009098 Bacteria 2738
113 Ga0105243_10028502 3300009148 Bacteria 4287
114 Ga0105243_10199533 3300009148 Bacteria 1753
115 Ga0105242_10249436 3300009176 Bacteria 1599
116 Ga0105248_10233410 3300009177 Bacteria 2071
117 Ga0105237_10426668 3300009545 Bacteria 1331
118 Ga0105239_10014978 3300010375 Bacteria 8595
119 Ga0105246_10094646 3300011119 Bacteria 2161
120 Ga0105246_10134964 3300011119 Bacteria 1848
121 Ga0157319_1000052 3300012497 Bacteria 13081
122 Ga0157327_1006024 3300012512 Bacteria 1006
123 Ga0157378_10264818 3300013297 Bacteria 1651
124 Ga0163162_10044715 3300013306 Bacteria 4436
125 Ga0157375_10081292 3300013308 Bacteria 3280
126 Ga0157375_10151675 3300013308 Bacteria 2454
127 Ga0163163_10030072 3300014325 Bacteria 5229
128 Ga0163163_10605840 3300014325 Bacteria 1158
129 Ga0157377_10000010 3300014745 Bacteria 380929
130 Ga0157379_10028177 3300014968 Bacteria 5000
131 Ga0157379_10194822 3300014968 Bacteria 1831
132 Ga0157379_10928486 3300014968 Bacteria 827
133 Ga0157376_10244463 3300014969 Bacteria 1673
134 Ga0163161_10087786 3300017792 Bacteria 2298
135 Ga0213872_10000266 3300021361 Bacteria 45265
136 Ga0213872_10000942 3300021361 Bacteria 20402
137 Ga0209435_100008 3300025206 Bacteria 503644
138 Ga0209674_100024 3300025226 Bacteria 535481
139 Ga0209563_100014 3300025230 Bacteria 940582
140 Ga0209563_100101 3300025230 Bacteria 152297
141 Ga0209258_100589 3300025242 Bacteria 30120
142 Ga0207425_1000986 3300025245 Bacteria 13369
143 Ga0209646_1000029 3300025246 Bacteria 386414
144 Ga0209026_1000016 3300025250 Bacteria 386457
145 Ga0209677_100048 3300025253 Bacteria 183563
146 Ga0209759_1000016 3300025256 Bacteria 386414
147 Ga0209129_1000038 3300025258 Bacteria 322778
148 Ga0209565_1018598 3300025263 Bacteria 1500
149 Ga0209673_1019320 3300025273 Bacteria 2450
150 Ga0209564_1000030 3300025295 Bacteria 503296
151 Ga0209564_1000129 3300025295 Bacteria 195163
152 Ga0209758_1000197 3300025297 Bacteria 133706
153 Ga0209758_1000213 3300025297 Bacteria 126745
154 Ga0209758_1033034 3300025297 Bacteria 2087
155 Ga0209050_1000720 3300025298 Bacteria 48448
156 Ga0209256_1004520 3300025299 Bacteria 8681
157 Ga0209256_1005321 3300025299 Bacteria 7485
158 Ga0209256_1019788 3300025299 Bacteria 2127
159 Ga0209051_1000241 3300025303 Bacteria 91816
160 Ga0209051_1002996 3300025303 Bacteria 11480
161 Ga0209051_1039662 3300025303 Bacteria 1698
162 Ga0209257_1000015 3300025304 Bacteria 908141
163 Ga0209257_1005729 3300025304 Bacteria 8511
164 Ga0207680_10001011 3300025903 Bacteria 13260
165 Ga0207645_10025254 3300025907 Bacteria 3845
166 Ga0207643_10073969 3300025908 Bacteria 1964
167 Ga0207684_10247745 3300025910 Bacteria 1537
168 Ga0207671_10146671 3300025914 Bacteria 1821
169 Ga0207650_10017518 3300025925 Bacteria 5018
170 Ga0207650_10512854 3300025925 Bacteria 1003
171 Ga0207659_10004962 3300025926 Bacteria 8066
172 Ga0207659_10556265 3300025926 Bacteria 975
173 Ga0207644_10017016 3300025931 Bacteria 4901
174 Ga0207644_10377280 3300025931 Bacteria 1156
175 Ga0207690_10542589 3300025932 Bacteria 945
176 Ga0207706_10143379 3300025933 Bacteria 2102
177 Ga0207706_10302469 3300025933 Bacteria 1393
178 Ga0207686_10300075 3300025934 Bacteria 1193
179 Ga0207709_10015440 3300025935 Bacteria 4234
180 Ga0207709_10123327 3300025935 Bacteria 1753
181 Ga0207669_10143501 3300025937 Bacteria 1661
182 Ga0207704_10394165 3300025938 Bacteria 1091
183 Ga0207691_10006020 3300025940 Bacteria 11710
184 Ga0207691_10041229 3300025940 Bacteria 4264
185 Ga0207691_10140770 3300025940 Bacteria 2126
186 Ga0207691_10516036 3300025940 Bacteria 1014
187 Ga0207711_10064571 3300025941 Bacteria 3163
188 Ga0207689_10029983 3300025942 Bacteria 4535
189 Ga0207689_10222978 3300025942 Bacteria 1558
190 Ga0207667_10060449 3300025949 Bacteria 3966
191 Ga0207651_10000886 3300025960 Bacteria 13121
192 Ga0207668_10126181 3300025972 Bacteria 1946
193 Ga0207640_10025482 3300025981 Bacteria 3581
194 Ga0207658_10001308 3300025986 Bacteria 19644
195 Ga0207658_10161775 3300025986 Bacteria 1835
196 Ga0207677_10014128 3300026023 Bacteria 4652
197 Ga0207677_10102863 3300026023 Bacteria 2107
198 Ga0207703_10006896 3300026035 Bacteria 9042
199 Ga0207703_10834416 3300026035 Bacteria 881
200 Ga0207678_10161106 3300026067 Bacteria 1916
201 Ga0207641_10024820 3300026088 Bacteria 4941
202 Ga0207641_10162832 3300026088 Bacteria 2029
203 Ga0207648_10000002 3300026089 Bacteria 307909
204 Ga0207648_10039639 3300026089 Bacteria 4142
205 Ga0207648_10384243 3300026089 Bacteria 1270
206 Ga0207676_10000221 3300026095 Bacteria 49106
207 Ga0207676_10502523 3300026095 Bacteria 1151
208 Ga0207674_10024109 3300026116 Bacteria 6506
209 Ga0207674_10038521 3300026116 Bacteria 4959
210 Ga0207674_10207238 3300026116 Bacteria 1910
211 Ga0207674_10235098 3300026116 Bacteria 1780
212 Ga0207675_100075719 3300026118 Bacteria 3150
213 Ga0207675_100175851 3300026118 Bacteria 2048
214 Ga0207675_100280753 3300026118 Bacteria 1618
215 Ga0207675_100475999 3300026118 Bacteria 1240
216 Ga0207683_10028484 3300026121 Bacteria 4829
217 Ga0207683_10242217 3300026121 Bacteria 1645
218 Ga0207698_10017801 3300026142 Bacteria 4829
219 Ga0209389_1000831 3300027296 Bacteria 19759
220 Ga0209371_1010405 3300027312 Bacteria 2863
221 Ga0209974_10052263 3300027876 Unclassified 1375
222 Ga0209974_10096261 3300027876 Bacteria 1031
223 Ga0268266_10400578 3300028379 Bacteria 1297
224 Ga0268265_10016860 3300028380 Bacteria 5029
225 Ga0268264_10501029 3300028381 Bacteria 1184
226 Ga0307517_10015465 3300028786 Bacteria 10139
227 Ga0307517_10163980 3300028786 Bacteria 1482
228 Ga0307517_10272580 3300028786 Bacteria 972
229 Ga0307515_10000239 3300028794 Bacteria 135971
230 Ga0307515_10000567 3300028794 Bacteria 87086
231 Ga0307515_10007744 3300028794 Bacteria 21142
232 Ga0307515_10087552 3300028794 Bacteria 3950
233 Ga0307515_10094254 3300028794 Bacteria 3700
234 Ga0307515_10143219 3300028794 Bacteria 2549
235 Ga0268256_1011161 3300030500 Bacteria 2863
236 Ga0307512_10085667 3300030522 Bacteria 2231
237 Ga0307512_10136407 3300030522 Bacteria 1518
238 Ga0307512_10139352 3300030522 Bacteria 1490
239 Ga0307513_10011623 3300031456 Bacteria 10928
240 Ga0307513_10095004 3300031456 Bacteria 3024
241 Ga0307513_10274310 3300031456 Bacteria 1468
242 Ga0307509_10015099 3300031507 Bacteria 9039
243 Ga0307509_10024044 3300031507 Bacteria 6830
244 Ga0307509_10072789 3300031507 Bacteria 3579
245 Ga0307509_10109176 3300031507 Bacteria 2777
246 Ga0307509_10223700 3300031507 Bacteria 1692
247 Ga0307408_100013417 3300031548 Bacteria 5437
248 Ga0307508_10000133 3300031616 Bacteria 87867
249 Ga0307508_10002482 3300031616 Bacteria 19455
250 Ga0307508_10052645 3300031616 Bacteria 3614
251 Ga0307514_10001199 3300031649 Bacteria 34587
252 Ga0307514_10025372 3300031649 Bacteria 4795
253 Ga0307514_10060728 3300031649 Bacteria 2882
254 Ga0307516_10000677 3300031730 Bacteria 46191
255 Ga0307516_10004964 3300031730 Bacteria 16154
256 Ga0307516_10107458 3300031730 Bacteria 2599
257 Ga0307516_10162045 3300031730 Bacteria 1986
258 Ga0307516_10237028 3300031730 Bacteria 1525
259 Ga0307412_10200311 3300031911 Bacteria 1516
260 Ga0307412_10627432 3300031911 Bacteria 914
261 Ga0307409_100232374 3300031995 Bacteria 1673
262 Ga0307507_10042842 3300033179 Bacteria 4501
263 Ga0307507_10069728 3300033179 Bacteria 3196
264 Ga0307507_10126470 3300033179 Bacteria 2020
265 Ga0307507_10254381 3300033179 Bacteria 1130
266 Ga0307510_10004514 3300033180 Bacteria 16378
267 Ga0307510_10150481 3300033180 Bacteria 1948
268 Ga0373938_0006084 3300034957 Bacteria 2072
269 Ga0373962_0043529 3300035242 Bacteria 1273
270 Ga0373925_0096937 3300037068 Bacteria 2261
271 Ga0395899_0149909 3300037312 Bacteria 1653
272 Ga0395898_0028939 3300037466 Bacteria 5552
273 Ga0395905_0000047 3300037471 Bacteria 237582
274 Ga0395905_0000181 3300037471 Bacteria 100569
275 Ga0395905_0000574 3300037471 Bacteria 49809
276 Ga0395905_0003555 3300037471 Bacteria 16602
277 Ga0395905_0017174 3300037471 Bacteria 6873
278 Ga0395901_0009002 3300038443 Bacteria 10109
279 Ga0436361_0147437 3300039447 Bacteria 84337
280 Ga0436361_0518335 3300039447 Bacteria 20591
281 Ga0451800_0503480 3300041459 Bacteria 1367
282 Ga0439457_012108 3300042014 Bacteria 1949
283 Ga0450890_025106 3300042127 Bacteria 825
284 Ga0450891_005307 3300042129 Bacteria 1192
285 Ga0439459_0000109 3300042438 Bacteria 7715
286 Ga0450916_008606 3300042530 Bacteria 1245
287 Ga0450893_0009023 3300042532 Bacteria 1628
288 Ga0451577_0666856 3300042876 Bacteria 943
289 Ga0466986_0097561 3300044650 Bacteria 2028
290 Ga0466972_0001282 3300044658 Bacteria 12137
291 Ga0466965_0017227 3300044683 Bacteria 3451
292 Ga0466963_0453022 3300044694 Bacteria 905
293 Ga0453684_0008823 3300044712 Bacteria 17877
294 Ga0453684_0117774 3300044712 Bacteria 3214
295 Ga0466957_0127332 3300044842 Bacteria 1628
296 Ga0495590_0006351 3300046457 Bacteria 4619
297 Ga0495629_0515977 3300046459 Bacteria 805
298 Ga0495650_0012760 3300046471 Bacteria 4498
299 Ga0495582_0116995 3300046473 Bacteria 1500
300 Ga0495583_0000022 3300046506 Bacteria 282544
301 Ga0495583_0045630 3300046506 Bacteria 2026
302 Ga0495606_0001282 3300046507 Bacteria 34808
303 Ga0495620_0144026 3300046515 Bacteria 931
304 Ga0495620_0146875 3300046515 Bacteria 920
305 Ga0495632_0002762 3300046519 Bacteria 13037
306 Ga0495632_0011887 3300046519 Bacteria 5057
307 Ga0495632_0111720 3300046519 Bacteria 1283
308 Ga0495632_0113662 3300046519 Bacteria 1270
309 Ga0495632_0130813 3300046519 Bacteria 1168
310 Ga0495643_0146447 3300046522 Bacteria 1173
311 Ga0495648_0160462 3300046524 Bacteria 1163
312 Ga0495663_0063308 3300046525 Bacteria 1166
313 Ga0495654_0001471 3300046530 Bacteria 16109
314 Ga0495621_0000488 3300046539 Bacteria 9769
315 Ga0495597_0000325 3300046542 Bacteria 43126
316 Ga0495597_0073269 3300046542 Bacteria 1472
317 Ga0495656_0007829 3300046615 Bacteria 3795
318 Ga0495668_0006957 3300046616 Bacteria 7318
319 Ga0495668_0056561 3300046616 Bacteria 2165
320 Ga0495625_0007448 3300046660 Bacteria 9518
321 Ga0495625_0045959 3300046660 Bacteria 3153
322 Ga0495658_0150765 3300046683 Bacteria 1428
323 Ga0495669_0015910 3300046684 Bacteria 3221
324 Ga0495669_0045914 3300046684 Bacteria 1949
325 Ga0495624_0208671 3300046690 Bacteria 1185
326 Ga0495670_0068092 3300046691 Bacteria 1798
327 Ga0495671_0108910 3300046692 Bacteria 1353
328 Ga0495649_0002139 3300046694 Bacteria 14132
329 Ga0495660_0125174 3300046810 Bacteria 1295
330 Ga0495636_0032347 3300047318 Bacteria 2146
331 Ga0495676_0163275 3300047321 Bacteria 1574
332 Ga0495687_000128 3300047443 Bacteria 116626
333 Ga0495687_003495 3300047443 Bacteria 11338
334 Ga0495685_018816 3300047447 Bacteria 2371
335 Ga0495686_0113695 3300047472 Bacteria 1621
336 Ga0495593_0020951 3300047673 Bacteria 3655
337 Ga0495614_0052273 3300048089 Bacteria 1751
338 Ga0496102_0001753 3300048905 Bacteria 18929
339 Ga0496102_0013316 3300048905 Bacteria 7125
340 Ga0496104_0049188 3300048907 Bacteria 3976
341 Ga0496104_0642776 3300048907 Bacteria 970
342 Ga0496106_0010243 3300048909 Bacteria 6930
343 Ga0496106_0303675 3300048909 Bacteria 1280
344 Ga0496109_0436671 3300048912 Bacteria 1237
345 Ga0496113_0091744 3300048916 Bacteria 2342
346 Ga0496114_0160514 3300048917 Bacteria 1954
347 Ga0496124_0098191 3300048927 Bacteria 2377
348 Ga0496126_0019016 3300048929 Bacteria 6783
349 Ga0496126_0020164 3300048929 Bacteria 6543
350 Ga0501037_0039005 3300049573 Bacteria 3498
351 Ga0501047_0081191 3300049581 Bacteria 3117
352 Ga0501222_000001 3300049662 Bacteria 307689
353 Ga0501266_000542 3300049763 Bacteria 5024
354 Ga0501035_0079596 3300049822 Bacteria 2895
355 Ga0501044_0461466 3300049823 Bacteria 1176
356 nmdc:mga03683_122402_c1 3300050489 Bacteria 1158
357 nmdc:mga03683_85484_c1 3300050489 Bacteria 1368
358 nmdc:mga03683_87315_c1 3300050489 Bacteria 1355
359 nmdc:mga03n38_85298_c1 3300050490 Bacteria 1493
360 nmdc:mga00v17_65228_c1 3300050491 Bacteria 2246
361 nmdc:mga0k408_109487_c1 3300050493 Bacteria 1632
362 nmdc:mga0k408_141776_c1 3300050493 Bacteria 1430
363 nmdc:mga0k408_2194_c1 3300050493 Bacteria 10472
364 nmdc:mga0k408_233828_c1 3300050493 Bacteria 1097
365 nmdc:mga0k408_245320_c1 3300050493 Bacteria 1070
366 nmdc:mga0k408_36296_c1 3300050493 Bacteria 2829
367 nmdc:mga0k408_6285_c1 3300050493 Bacteria 6337
368 nmdc:mga0k408_6522_c1 3300050493 Bacteria 6218
369 nmdc:mga0k408_6611_c1 3300050493 Bacteria 6178
370 nmdc:mga0k408_7647_c1 3300050493 Bacteria 5774
371 nmdc:mga0k408_81683_c1 3300050493 Bacteria 1893
372 nmdc:mga06z11_230202_c1 3300050494 Bacteria 1086
373 nmdc:mga06z11_6369_c1 3300050494 Bacteria 4796
374 nmdc:mga04h51_106120_c1 3300050495 Bacteria 1030
375 nmdc:mga07m45_101551_c1 3300050496 Bacteria 1652
376 nmdc:mga07m45_121481_c1 3300050496 Bacteria 1509
377 nmdc:mga07m45_165107_c1 3300050496 Bacteria 1286
378 nmdc:mga07m45_2131_c1 3300050496 Bacteria 9210
379 nmdc:mga07m45_40073_c1 3300050496 Bacteria 2621
380 nmdc:mga07m45_496_c1 3300050496 Bacteria 16651
381 nmdc:mga09592_98893_c1 3300050508 Bacteria 2498
382 nmdc:mga0qj67_338215_c1 3300050509 Bacteria 1218
383 Ga0500578_0000393 3300053086 Bacteria 53719
384 Ga0500578_0099651 3300053086 Bacteria 1839
385 Ga0500644_0006682 3300053088 Bacteria 2966
386 Ga0500644_0022913 3300053088 Bacteria 1890
387 Ga0500646_0003415 3300053090 Bacteria 4075
388 Ga0500647_0113324 3300053091 Bacteria 1288
389 Ga0500583_0086995 3300053092 Bacteria 1517
390 Ga0500650_0060506 3300053098 Bacteria 1768
391 Ga0500562_055898 3300053108 Bacteria 1058
392 Ga0500593_000561 3300053117 Bacteria 14408
393 Ga0500593_001398 3300053117 Bacteria 8684
394 Ga0500594_0011768 3300053118 Bacteria 2047
395 Ga0500607_063175 3300053121 Bacteria 1933
396 Ga0500652_003564 3300053131 Bacteria 4723
397 Ga0500658_0015687 3300053134 Bacteria 2815
398 Ga0500559_0000388 3300053136 Bacteria 32263
399 Ga0500568_0007967 3300053139 Bacteria 5147
400 Ga0500568_0052633 3300053139 Bacteria 1597
401 Ga0500568_0057528 3300053139 Bacteria 1513
402 Ga0500568_0147320 3300053139 Bacteria 872
403 Ga0500577_0044901 3300053142 Bacteria 1631
404 Ga0500589_086883 3300053147 Bacteria 1386
405 Ga0500590_000586 3300053148 Bacteria 12847
406 Ga0500619_040539 3300053154 Bacteria 1469
407 Ga0500622_0009156 3300053156 Bacteria 5496
408 Ga0500622_0033728 3300053156 Bacteria 2683
409 Ga0500622_0070704 3300053156 Bacteria 1765
410 Ga0500633_0028431 3300053160 Bacteria 1779
411 Ga0500636_0017211 3300053177 Bacteria 4265
412 Ga0500636_0021910 3300053177 Bacteria 3783
413 Ga0500570_129300 3300053724 Bacteria 964
414 Ga0500645_010354 3300053730 Bacteria 3089
415 Ga0500645_021730 3300053730 Bacteria 1978
416 Ga0500645_053573 3300053730 Bacteria 1174
417 Ga0500661_003583 3300055283 Bacteria 2918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0515977 Ga0495629_0515977_10_693 226
2 3300026121 Ga0207683_10242217 Ga0207683_102422172 234
3 3300048929 Ga0496126_0020164 Ga0496126_0020164_150_926 234
4 3300025940 Ga0207691_10516036 Ga0207691_105160362 237
5 3300028786 Ga0307517_10272580 Ga0307517_102725801 238
6 3300053730 Ga0500645_053573 Ga0500645_053573_418_1137 238
7 3300053139 Ga0500568_0147320 Ga0500568_0147320_10_738 240
8 3300006353 Ga0075370_10223567 Ga0075370_102235671 241
9 3300044650 Ga0466986_0097561 Ga0466986_0097561_86_886 241
10 3300050496 nmdc:mga07m45_101551_c1 nmdc:mga07m45_101551_c1_81_860 241
11 3300006177 Ga0075362_10094634 Ga0075362_100946342 242
12 3300013308 Ga0157375_10151675 Ga0157375_101516754 242
13 3300025297 Ga0209758_1033034 Ga0209758_10330342 242
14 3300046506 Ga0495583_0045630 Ga0495583_0045630_629_1408 242
15 3300003316 rootH1_10010532 rootH1_100105325 243
16 3300003322 rootL2_10035584 rootL2_100355844 243
17 3300005577 Ga0068857_100624214 Ga0068857_1006242141 243
18 3300006042 Ga0075368_10129818 Ga0075368_101298182 243
19 3300006048 Ga0075363_100053395 Ga0075363_1000533952 243
20 3300006051 Ga0075364_10295814 Ga0075364_102958142 243
21 3300006178 Ga0075367_10006530 Ga0075367_100065306 243
22 3300006186 Ga0075369_10029610 Ga0075369_100296103 243
23 3300006195 Ga0075366_10065678 Ga0075366_100656782 243
24 3300006195 Ga0075366_10251641 Ga0075366_102516412 243
25 3300006353 Ga0075370_10002116 Ga0075370_100021169 243
26 3300006353 Ga0075370_10011645 Ga0075370_100116455 243
27 3300009148 Ga0105243_10199533 Ga0105243_101995332 243
28 3300025933 Ga0207706_10302469 Ga0207706_103024692 243
29 3300026116 Ga0207674_10207238 Ga0207674_102072382 243
30 3300031730 Ga0307516_10107458 Ga0307516_101074582 243
31 3300046457 Ga0495590_0006351 Ga0495590_0006351_2607_3386 243
32 3300046515 Ga0495620_0146875 Ga0495620_0146875_45_824 243
33 3300046519 Ga0495632_0002762 Ga0495632_0002762_4974_5753 243
34 3300046522 Ga0495643_0146447 Ga0495643_0146447_99_878 243
35 3300046542 Ga0495597_0073269 Ga0495597_0073269_110_889 243
36 3300046660 Ga0495625_0045959 Ga0495625_0045959_2204_2983 243
37 3300046684 Ga0495669_0045914 Ga0495669_0045914_784_1563 243
38 3300046694 Ga0495649_0002139 Ga0495649_0002139_7837_8616 243
39 3300047443 Ga0495687_000128 Ga0495687_000128_41767_42546 243
40 3300047443 Ga0495687_003495 Ga0495687_003495_5788_6567 243
41 3300050489 nmdc:mga03683_122402_c1 nmdc:mga03683_122402_c1_145_924 243
42 3300050490 nmdc:mga03n38_85298_c1 nmdc:mga03n38_85298_c1_161_940 243
43 3300050493 nmdc:mga0k408_6285_c1 nmdc:mga0k408_6285_c1_4909_5688 243
44 3300050493 nmdc:mga0k408_6522_c1 nmdc:mga0k408_6522_c1_5370_6149 243
45 3300050493 nmdc:mga0k408_6611_c1 nmdc:mga0k408_6611_c1_186_965 243
46 3300050494 nmdc:mga06z11_6369_c1 nmdc:mga06z11_6369_c1_167_946 243
47 3300050495 nmdc:mga04h51_106120_c1 nmdc:mga04h51_106120_c1_133_912 243
48 3300050496 nmdc:mga07m45_496_c1 nmdc:mga07m45_496_c1_135_914 243
49 3300053134 Ga0500658_0015687 Ga0500658_0015687_726_1505 243
50 3300053139 Ga0500568_0007967 Ga0500568_0007967_1377_2156 243
51 3300053160 Ga0500633_0028431 Ga0500633_0028431_697_1476 243
52 3300005338 Ga0068868_100110446 Ga0068868_1001104462 244
53 3300005355 Ga0070671_100612918 Ga0070671_1006129181 244
54 3300005618 Ga0068864_100423752 Ga0068864_1004237521 244
55 3300005841 Ga0068863_100062304 Ga0068863_1000623045 244
56 3300005843 Ga0068860_100177320 Ga0068860_1001773201 244
57 3300006846 Ga0075430_100350977 Ga0075430_1003509772 244
58 3300006880 Ga0075429_100003990 Ga0075429_1000039902 244
59 3300009098 Ga0105245_10084908 Ga0105245_100849084 244
60 3300025925 Ga0207650_10512854 Ga0207650_105128542 244
61 3300025981 Ga0207640_10025482 Ga0207640_100254823 244
62 3300026023 Ga0207677_10102863 Ga0207677_101028633 244
63 3300026035 Ga0207703_10834416 Ga0207703_108344162 244
64 3300026088 Ga0207641_10162832 Ga0207641_101628321 244
65 3300026095 Ga0207676_10502523 Ga0207676_105025232 244
66 3300028381 Ga0268264_10501029 Ga0268264_105010291 244
67 3300033180 Ga0307510_10150481 Ga0307510_101504811 244
68 3300046616 Ga0495668_0056561 Ga0495668_0056561_70_846 244
69 3300050508 nmdc:mga09592_98893_c1 nmdc:mga09592_98893_c1_1397_2170 244
70 3300050509 nmdc:mga0qj67_338215_c1 nmdc:mga0qj67_338215_c1_183_956 244
71 3300005366 Ga0070659_100389430 Ga0070659_1003894302 245
72 3300005455 Ga0070663_100426948 Ga0070663_1004269482 245
73 3300005457 Ga0070662_100024822 Ga0070662_1000248225 245
74 3300005563 Ga0068855_100275725 Ga0068855_1002757251 245
75 3300005577 Ga0068857_100075322 Ga0068857_1000753222 245
76 3300006051 Ga0075364_10026450 Ga0075364_100264501 245
77 3300006178 Ga0075367_10149406 Ga0075367_101494062 245
78 3300006186 Ga0075369_10041564 Ga0075369_100415643 245
79 3300006195 Ga0075366_10083115 Ga0075366_100831153 245
80 3300009093 Ga0105240_10154640 Ga0105240_101546402 245
81 3300009545 Ga0105237_10426668 Ga0105237_104266682 245
82 3300010375 Ga0105239_10014978 Ga0105239_100149785 245
83 3300014968 Ga0157379_10928486 Ga0157379_109284861 245
84 3300025242 Ga0209258_100589 Ga0209258_1005893 245
85 3300025914 Ga0207671_10146671 Ga0207671_101466712 245
86 3300025932 Ga0207690_10542589 Ga0207690_105425891 245
87 3300025933 Ga0207706_10143379 Ga0207706_101433792 245
88 3300026067 Ga0207678_10161106 Ga0207678_101611062 245
89 3300026116 Ga0207674_10038521 Ga0207674_100385212 245
90 3300050491 nmdc:mga00v17_65228_c1 nmdc:mga00v17_65228_c1_105_890 245
91 3300050493 nmdc:mga0k408_7647_c1 nmdc:mga0k408_7647_c1_246_1031 245
92 3300050494 nmdc:mga06z11_230202_c1 nmdc:mga06z11_230202_c1_82_867 245
93 3300005459 Ga0068867_100457597 Ga0068867_1004575971 247
94 3300026118 Ga0207675_100475999 Ga0207675_1004759992 247
95 3300027876 Ga0209974_10096261 Ga0209974_100962611 247
96 3300005719 Ga0068861_100413703 Ga0068861_1004137032 249
97 3300046525 Ga0495663_0063308 Ga0495663_0063308_364_1137 250
98 3300049822 Ga0501035_0079596 Ga0501035_0079596_1017_1796 251
99 3300027876 Ga0209974_10052263 Ga0209974_100522632 252
100 3300028380 Ga0268265_10016860 Ga0268265_100168603 252
101 iso_pu_bacteria 2643221654 2644305438 252
102 iso_pu_bacteria 2834641062 2834644125 252
103 iso_pu_bacteria 8003400568 8003403955 252
104 3300005356 Ga0070674_100168434 Ga0070674_1001684342 253
105 3300025937 Ga0207669_10143501 Ga0207669_101435012 253
106 iso_pu_bacteria 2585428057 2587729034 253
107 iso_pu_bacteria 2596583598 2597031373 253
108 iso_pu_bacteria 2831864461 2831864897 253
109 iso_pu_bacteria 2881101125 2881104463 253
110 iso_pu_bacteria 2900577576 2900577771 253
111 iso_pu_bacteria 2928058823 2928061039 253
112 3300005842 Ga0068858_100669567 Ga0068858_1006695672 254
113 iso_pu_bacteria 2547132374 2548500612 254
114 iso_pu_bacteria 2643221570 2643864388 254
115 iso_pu_bacteria 2643221592 2643967105 254
116 iso_pu_bacteria 2643221596 2643991979 254
117 iso_pu_bacteria 2643221625 2644139935 254
118 iso_pu_bacteria 2643221648 2644271175 254
119 iso_pu_bacteria 2643221652 2644291910 254
120 iso_pu_bacteria 2643221717 2644646838 254
121 iso_pu_bacteria 2990710928 2990714987 254
122 iso_pu_bacteria 2585428058 2587733601 255
123 iso_pu_bacteria 2588253510 2588294000 255
124 iso_pu_bacteria 2919704043 2919708336 255
125 3300003316 rootH1_10023689 rootH1_100236892 257
126 3300003322 rootL2_10003007 rootL2_100030074 257
127 3300003323 rootH1_10003144 rootH1_100031444 257
128 3300003759 Ga0055525_1000036 Ga0055525_10000361 257
129 3300003771 Ga0055526_1028531 Ga0055526_10285311 257
130 3300003775 Ga0055524_1003664 Ga0055524_10036641 257
131 3300003792 Ga0055540_1025694 Ga0055540_10256942 257
132 3300003794 Ga0055531_10000519 Ga0055531_1000051930 257
133 3300003794 Ga0055531_10005443 Ga0055531_100054439 257
134 3300004625 Ga0055543_1008757 Ga0055543_10087571 257
135 3300005262 Ga0065165_1000304 Ga0065165_100030418 257
136 3300005262 Ga0065165_1002631 Ga0065165_100263112 257
137 3300006038 Ga0075365_10001315 Ga0075365_100013152 257
138 3300006944 Ga0099823_1000015 Ga0099823_100001521 257
139 3300006946 Ga0079104_1018865 Ga0079104_10188653 257
140 3300009093 Ga0105240_10197986 Ga0105240_101979864 257
141 3300012497 Ga0157319_1000052 Ga0157319_100005211 257
142 3300012512 Ga0157327_1006024 Ga0157327_10060242 257
143 3300021361 Ga0213872_10000266 Ga0213872_1000026618 257
144 3300025206 Ga0209435_100008 Ga0209435_100008161 257
145 3300025230 Ga0209563_100014 Ga0209563_100014384 257
146 3300025246 Ga0209646_1000029 Ga0209646_1000029118 257
147 3300025250 Ga0209026_1000016 Ga0209026_1000016118 257
148 3300025256 Ga0209759_1000016 Ga0209759_1000016118 257
149 3300025295 Ga0209564_1000030 Ga0209564_1000030308 257
150 3300025299 Ga0209256_1004520 Ga0209256_10045202 257
151 3300025299 Ga0209256_1005321 Ga0209256_10053219 257
152 3300025303 Ga0209051_1000241 Ga0209051_100024189 257
153 3300025303 Ga0209051_1002996 Ga0209051_10029961 257
154 3300025304 Ga0209257_1000015 Ga0209257_1000015229 257
155 3300025304 Ga0209257_1005729 Ga0209257_10057299 257
156 3300027296 Ga0209389_1000831 Ga0209389_100083118 257
157 3300027312 Ga0209371_1010405 Ga0209371_10104051 257
158 3300030500 Ga0268256_1011161 Ga0268256_10111611 257
159 3300031548 Ga0307408_100013417 Ga0307408_1000134176 257
160 3300031911 Ga0307412_10200311 Ga0307412_102003111 257
161 3300031911 Ga0307412_10627432 Ga0307412_106274321 257
162 3300035242 Ga0373962_0043529 Ga0373962_0043529_174_947 257
163 3300037312 Ga0395899_0149909 Ga0395899_0149909_541_1323 257
164 3300037466 Ga0395898_0028939 Ga0395898_0028939_370_1152 257
165 3300037471 Ga0395905_0000047 Ga0395905_0000047_52356_53129 257
166 3300037471 Ga0395905_0000574 Ga0395905_0000574_8922_9707 257
167 3300037471 Ga0395905_0017174 Ga0395905_0017174_5158_5931 257
168 3300038443 Ga0395901_0009002 Ga0395901_0009002_8066_8848 257
169 3300039447 Ga0436361_0147437 Ga0436361_0147437_22119_22892 257
170 3300042127 Ga0450890_025106 Ga0450890_025106_21_797 257
171 3300042129 Ga0450891_005307 Ga0450891_005307_214_987 257
172 3300042438 Ga0439459_0000109 Ga0439459_0000109_1513_2289 257
173 3300042530 Ga0450916_008606 Ga0450916_008606_262_1035 257
174 3300042532 Ga0450893_0009023 Ga0450893_0009023_142_915 257
175 3300042876 Ga0451577_0666856 Ga0451577_0666856_139_912 257
176 3300044694 Ga0466963_0453022 Ga0466963_0453022_13_789 257
177 3300046473 Ga0495582_0116995 Ga0495582_0116995_495_1268 257
178 3300046530 Ga0495654_0001471 Ga0495654_0001471_4755_5531 257
179 3300046539 Ga0495621_0000488 Ga0495621_0000488_4491_5264 257
180 3300046683 Ga0495658_0150765 Ga0495658_0150765_504_1277 257
181 3300046690 Ga0495624_0208671 Ga0495624_0208671_164_937 257
182 3300046691 Ga0495670_0068092 Ga0495670_0068092_885_1661 257
183 3300046810 Ga0495660_0125174 Ga0495660_0125174_411_1184 257
184 3300047321 Ga0495676_0163275 Ga0495676_0163275_196_969 257
185 3300047673 Ga0495593_0020951 Ga0495593_0020951_1987_2760 257
186 3300050493 nmdc:mga0k408_109487_c1 nmdc:mga0k408_109487_c1_206_982 257
187 3300053088 Ga0500644_0006682 Ga0500644_0006682_1899_2675 257
188 3300053117 Ga0500593_001398 Ga0500593_001398_5378_6154 257
189 3300053139 Ga0500568_0057528 Ga0500568_0057528_103_879 257
190 3300053156 Ga0500622_0033728 Ga0500622_0033728_289_1065 257
191 3300053730 Ga0500645_021730 Ga0500645_021730_593_1369 257
192 iso_pu_bacteria 2974320154 2974321506 257
193 3300003752 Ga0055539_1000522 Ga0055539_10005223 258
194 3300003756 Ga0055533_1000026 Ga0055533_100002660 258
195 3300003756 Ga0055533_1000068 Ga0055533_1000068142 258
196 3300003759 Ga0055525_1003040 Ga0055525_10030402 258
197 3300005328 Ga0070676_10018873 Ga0070676_100188732 258
198 3300005330 Ga0070690_100074532 Ga0070690_1000745321 258
199 3300005331 Ga0070670_100034439 Ga0070670_1000344392 258
200 3300005334 Ga0068869_100029092 Ga0068869_1000290925 258
201 3300005334 Ga0068869_100206925 Ga0068869_1002069251 258
202 3300005366 Ga0070659_100359036 Ga0070659_1003590362 258
203 3300005367 Ga0070667_100001374 Ga0070667_1000013749 258
204 3300005543 Ga0070672_100007483 Ga0070672_1000074835 258
205 3300005548 Ga0070665_100097268 Ga0070665_1000972684 258
206 3300005548 Ga0070665_100362243 Ga0070665_1003622432 258
207 3300005577 Ga0068857_100046187 Ga0068857_1000461874 258
208 3300005617 Ga0068859_100508285 Ga0068859_1005082852 258
209 3300005719 Ga0068861_100062863 Ga0068861_1000628632 258
210 3300006195 Ga0075366_10006106 Ga0075366_100061061 258
211 3300006353 Ga0075370_10184165 Ga0075370_101841652 258
212 3300006358 Ga0068871_100337002 Ga0068871_1003370022 258
213 3300006931 Ga0097620_100508192 Ga0097620_1005081921 258
214 3300009098 Ga0105245_10095807 Ga0105245_100958074 258
215 3300009176 Ga0105242_10249436 Ga0105242_102494362 258
216 3300011119 Ga0105246_10094646 Ga0105246_100946463 258
217 3300011119 Ga0105246_10134964 Ga0105246_101349641 258
218 3300014325 Ga0163163_10605840 Ga0163163_106058402 258
219 3300021361 Ga0213872_10000942 Ga0213872_1000094211 258
220 3300025226 Ga0209674_100024 Ga0209674_100024237 258
221 3300025230 Ga0209563_100101 Ga0209563_100101143 258
222 3300025253 Ga0209677_100048 Ga0209677_100048126 258
223 3300025907 Ga0207645_10025254 Ga0207645_100252545 258
224 3300025908 Ga0207643_10073969 Ga0207643_100739693 258
225 3300025925 Ga0207650_10017518 Ga0207650_100175181 258
226 3300025926 Ga0207659_10556265 Ga0207659_105562651 258
227 3300025931 Ga0207644_10377280 Ga0207644_103772802 258
228 3300025934 Ga0207686_10300075 Ga0207686_103000752 258
229 3300025938 Ga0207704_10394165 Ga0207704_103941651 258
230 3300025940 Ga0207691_10006020 Ga0207691_100060205 258
231 3300025942 Ga0207689_10222978 Ga0207689_102229781 258
232 3300025986 Ga0207658_10001308 Ga0207658_1000130812 258
233 3300026089 Ga0207648_10039639 Ga0207648_100396392 258
234 3300026116 Ga0207674_10024109 Ga0207674_100241095 258
235 3300026116 Ga0207674_10235098 Ga0207674_102350982 258
236 3300026118 Ga0207675_100075719 Ga0207675_1000757191 258
237 3300028379 Ga0268266_10400578 Ga0268266_104005782 258
238 3300028786 Ga0307517_10163980 Ga0307517_101639801 258
239 3300028794 Ga0307515_10087552 Ga0307515_100875524 258
240 3300028794 Ga0307515_10094254 Ga0307515_100942542 258
241 3300030522 Ga0307512_10136407 Ga0307512_101364071 258
242 3300031456 Ga0307513_10095004 Ga0307513_100950043 258
243 3300031507 Ga0307509_10015099 Ga0307509_100150994 258
244 3300031507 Ga0307509_10072789 Ga0307509_100727894 258
245 3300031507 Ga0307509_10109176 Ga0307509_101091762 258
246 3300031616 Ga0307508_10052645 Ga0307508_100526452 258
247 3300031649 Ga0307514_10025372 Ga0307514_100253725 258
248 3300031730 Ga0307516_10000677 Ga0307516_1000067719 258
249 3300031730 Ga0307516_10162045 Ga0307516_101620453 258
250 3300031995 Ga0307409_100232374 Ga0307409_1002323742 258
251 3300033179 Ga0307507_10042842 Ga0307507_100428421 258
252 3300033179 Ga0307507_10069728 Ga0307507_100697282 258
253 3300033179 Ga0307507_10126470 Ga0307507_101264702 258
254 3300037068 Ga0373925_0096937 Ga0373925_0096937_1005_1781 258
255 3300039447 Ga0436361_0518335 Ga0436361_0518335_8395_9171 258
256 3300044842 Ga0466957_0127332 Ga0466957_0127332_700_1476 258
257 3300046506 Ga0495583_0000022 Ga0495583_0000022_138585_139361 258
258 3300046507 Ga0495606_0001282 Ga0495606_0001282_25001_25777 258
259 3300046519 Ga0495632_0113662 Ga0495632_0113662_87_869 258
260 3300046519 Ga0495632_0130813 Ga0495632_0130813_159_935 258
261 3300046616 Ga0495668_0006957 Ga0495668_0006957_2736_3512 258
262 3300047472 Ga0495686_0113695 Ga0495686_0113695_767_1543 258
263 3300048089 Ga0495614_0052273 Ga0495614_0052273_496_1275 258
264 3300048909 Ga0496106_0010243 Ga0496106_0010243_961_1737 258
265 3300048916 Ga0496113_0091744 Ga0496113_0091744_513_1295 258
266 3300048929 Ga0496126_0019016 Ga0496126_0019016_2131_2907 258
267 3300049573 Ga0501037_0039005 Ga0501037_0039005_1207_1983 258
268 3300049581 Ga0501047_0081191 Ga0501047_0081191_874_1650 258
269 3300049763 Ga0501266_000542 Ga0501266_000542_1694_2479 258
270 3300049823 Ga0501044_0461466 Ga0501044_0461466_250_1026 258
271 3300050489 nmdc:mga03683_85484_c1 nmdc:mga03683_85484_c1_474_1250 258
272 3300050493 nmdc:mga0k408_2194_c1 nmdc:mga0k408_2194_c1_9572_10348 258
273 3300050493 nmdc:mga0k408_233828_c1 nmdc:mga0k408_233828_c1_181_960 258
274 3300050496 nmdc:mga07m45_165107_c1 nmdc:mga07m45_165107_c1_408_1184 258
275 3300053088 Ga0500644_0022913 Ga0500644_0022913_1030_1812 258
276 3300053091 Ga0500647_0113324 Ga0500647_0113324_265_1044 258
277 3300053118 Ga0500594_0011768 Ga0500594_0011768_1148_1930 258
278 3300053136 Ga0500559_0000388 Ga0500559_0000388_31303_32085 258
279 3300053147 Ga0500589_086883 Ga0500589_086883_149_925 258
280 3300053154 Ga0500619_040539 Ga0500619_040539_136_915 258
281 3300053156 Ga0500622_0070704 Ga0500622_0070704_236_1018 258
282 3300053177 Ga0500636_0017211 Ga0500636_0017211_2811_3587 258
283 3300053177 Ga0500636_0021910 Ga0500636_0021910_2846_3628 258
284 3300055283 Ga0500661_003583 Ga0500661_003583_1770_2546 258
285 iso_pu_bacteria 2643221609 2644058121 258
286 iso_pu_bacteria 2643221611 2644073157 258
287 iso_pu_bacteria 2816332133 2816469973 258
288 3300003215 JGI25153J46596_10004156 JGI25153J46596_100041562 259
289 3300005330 Ga0070690_100055751 Ga0070690_1000557514 259
290 3300005335 Ga0070666_10002560 Ga0070666_1000256012 259
291 3300005338 Ga0068868_100227084 Ga0068868_1002270841 259
292 3300005347 Ga0070668_100195028 Ga0070668_1001950282 259
293 3300005354 Ga0070675_100003315 Ga0070675_1000033158 259
294 3300005355 Ga0070671_100008293 Ga0070671_1000082932 259
295 3300005356 Ga0070674_100408915 Ga0070674_1004089151 259
296 3300005364 Ga0070673_100056564 Ga0070673_1000565642 259
297 3300005367 Ga0070667_100025564 Ga0070667_1000255641 259
298 3300005456 Ga0070678_100159121 Ga0070678_1001591212 259
299 3300005459 Ga0068867_100076981 Ga0068867_1000769814 259
300 3300005543 Ga0070672_100073928 Ga0070672_1000739282 259
301 3300005617 Ga0068859_100413501 Ga0068859_1004135012 259
302 3300005834 Ga0068851_10098223 Ga0068851_100982232 259
303 3300005841 Ga0068863_100043338 Ga0068863_1000433382 259
304 3300005842 Ga0068858_100001797 Ga0068858_1000017972 259
305 3300005844 Ga0068862_100707988 Ga0068862_1007079881 259
306 3300006195 Ga0075366_10052817 Ga0075366_100528172 259
307 3300006237 Ga0097621_100340064 Ga0097621_1003400641 259
308 3300006353 Ga0075370_10003398 Ga0075370_100033988 259
309 3300006358 Ga0068871_100334295 Ga0068871_1003342952 259
310 3300006881 Ga0068865_100437427 Ga0068865_1004374272 259
311 3300006931 Ga0097620_100413468 Ga0097620_1004134682 259
312 3300009177 Ga0105248_10233410 Ga0105248_102334103 259
313 3300013297 Ga0157378_10264818 Ga0157378_102648182 259
314 3300013306 Ga0163162_10044715 Ga0163162_100447152 259
315 3300013308 Ga0157375_10081292 Ga0157375_100812921 259
316 3300014325 Ga0163163_10030072 Ga0163163_100300725 259
317 3300014968 Ga0157379_10028177 Ga0157379_100281772 259
318 3300014969 Ga0157376_10244463 Ga0157376_102444633 259
319 3300017792 Ga0163161_10087786 Ga0163161_100877861 259
320 3300025297 Ga0209758_1000213 Ga0209758_100021310 259
321 3300025903 Ga0207680_10001011 Ga0207680_100010112 259
322 3300025926 Ga0207659_10004962 Ga0207659_100049628 259
323 3300025931 Ga0207644_10017016 Ga0207644_100170162 259
324 3300025935 Ga0207709_10123327 Ga0207709_101233273 259
325 3300025940 Ga0207691_10041229 Ga0207691_100412294 259
326 3300025940 Ga0207691_10140770 Ga0207691_101407702 259
327 3300025941 Ga0207711_10064571 Ga0207711_100645714 259
328 3300025942 Ga0207689_10029983 Ga0207689_100299831 259
329 3300025960 Ga0207651_10000886 Ga0207651_1000088613 259
330 3300025972 Ga0207668_10126181 Ga0207668_101261812 259
331 3300025986 Ga0207658_10161775 Ga0207658_101617752 259
332 3300026023 Ga0207677_10014128 Ga0207677_100141285 259
333 3300026035 Ga0207703_10006896 Ga0207703_100068961 259
334 3300026088 Ga0207641_10024820 Ga0207641_100248205 259
335 3300026089 Ga0207648_10384243 Ga0207648_103842432 259
336 3300026095 Ga0207676_10000221 Ga0207676_1000022113 259
337 3300026118 Ga0207675_100175851 Ga0207675_1001758511 259
338 3300026118 Ga0207675_100280753 Ga0207675_1002807533 259
339 3300026121 Ga0207683_10028484 Ga0207683_100284845 259
340 3300026142 Ga0207698_10017801 Ga0207698_100178015 259
341 3300028786 Ga0307517_10015465 Ga0307517_100154657 259
342 3300028794 Ga0307515_10000567 Ga0307515_1000056772 259
343 3300028794 Ga0307515_10007744 Ga0307515_1000774414 259
344 3300028794 Ga0307515_10143219 Ga0307515_101432192 259
345 3300030522 Ga0307512_10085667 Ga0307512_100856673 259
346 3300030522 Ga0307512_10139352 Ga0307512_101393521 259
347 3300031456 Ga0307513_10011623 Ga0307513_100116235 259
348 3300031507 Ga0307509_10223700 Ga0307509_102237001 259
349 3300031616 Ga0307508_10000133 Ga0307508_1000013366 259
350 3300031616 Ga0307508_10002482 Ga0307508_1000248215 259
351 3300031649 Ga0307514_10001199 Ga0307514_1000119925 259
352 3300031649 Ga0307514_10060728 Ga0307514_100607283 259
353 3300031730 Ga0307516_10004964 Ga0307516_100049642 259
354 3300033179 Ga0307507_10254381 Ga0307507_102543811 259
355 3300041459 Ga0451800_0503480 Ga0451800_0503480_175_954 259
356 3300042014 Ga0439457_012108 Ga0439457_012108_353_1165 259
357 3300044712 Ga0453684_0117774 Ga0453684_0117774_418_1197 259
358 3300046471 Ga0495650_0012760 Ga0495650_0012760_2440_3225 259
359 3300046515 Ga0495620_0144026 Ga0495620_0144026_126_905 259
360 3300046519 Ga0495632_0011887 Ga0495632_0011887_3661_4440 259
361 3300046519 Ga0495632_0111720 Ga0495632_0111720_213_992 259
362 3300046524 Ga0495648_0160462 Ga0495648_0160462_301_1080 259
363 3300046660 Ga0495625_0007448 Ga0495625_0007448_5565_6344 259
364 3300046692 Ga0495671_0108910 Ga0495671_0108910_83_862 259
365 3300048905 Ga0496102_0001753 Ga0496102_0001753_3762_4541 259
366 3300048905 Ga0496102_0013316 Ga0496102_0013316_5582_6361 259
367 3300048907 Ga0496104_0049188 Ga0496104_0049188_989_1774 259
368 3300048909 Ga0496106_0303675 Ga0496106_0303675_116_901 259
369 3300048912 Ga0496109_0436671 Ga0496109_0436671_141_926 259
370 3300048917 Ga0496114_0160514 Ga0496114_0160514_986_1771 259
371 3300050489 nmdc:mga03683_87315_c1 nmdc:mga03683_87315_c1_398_1177 259
372 3300050493 nmdc:mga0k408_36296_c1 nmdc:mga0k408_36296_c1_1569_2348 259
373 3300050496 nmdc:mga07m45_121481_c1 nmdc:mga07m45_121481_c1_117_896 259
374 3300050496 nmdc:mga07m45_2131_c1 nmdc:mga07m45_2131_c1_2311_3090 259
375 3300053090 Ga0500646_0003415 Ga0500646_0003415_783_1562 259
376 3300053092 Ga0500583_0086995 Ga0500583_0086995_370_1149 259
377 3300053098 Ga0500650_0060506 Ga0500650_0060506_922_1701 259
378 3300053131 Ga0500652_003564 Ga0500652_003564_641_1420 259
379 3300053139 Ga0500568_0052633 Ga0500568_0052633_636_1415 259
380 3300053142 Ga0500577_0044901 Ga0500577_0044901_793_1572 259
381 3300053156 Ga0500622_0009156 Ga0500622_0009156_649_1428 259
382 3300053724 Ga0500570_129300 Ga0500570_129300_34_813 259
383 iso_pu_bacteria 2891633521 2891633610 259
384 3300003322 rootL2_10065163 rootL2_100651635 260
385 3300031730 Ga0307516_10237028 Ga0307516_102370281 260
386 3300033180 Ga0307510_10004514 Ga0307510_100045142 260
387 3300044658 Ga0466972_0001282 Ga0466972_0001282_3303_4094 260
388 3300044683 Ga0466965_0017227 Ga0466965_0017227_2356_3147 260
389 3300048907 Ga0496104_0642776 Ga0496104_0642776_176_958 260
390 3300053117 Ga0500593_000561 Ga0500593_000561_971_1753 260
391 3300053121 Ga0500607_063175 Ga0500607_063175_77_871 260
392 3300002773 JGI25152J39213_1001209 JGI25152J39213_10012097 261
393 3300002774 JGI25150J39212_1013781 JGI25150J39212_10137812 261
394 3300003215 JGI25153J46596_10019569 JGI25153J46596_100195692 261
395 3300003771 Ga0055526_1015937 Ga0055526_10159373 261
396 3300025245 Ga0207425_1000986 Ga0207425_10009865 261
397 3300025258 Ga0209129_1000038 Ga0209129_1000038153 261
398 3300025263 Ga0209565_1018598 Ga0209565_10185982 261
399 3300025295 Ga0209564_1000129 Ga0209564_100012934 261
400 3300025297 Ga0209758_1000197 Ga0209758_100019734 261
401 3300025299 Ga0209256_1019788 Ga0209256_10197882 261
402 3300046542 Ga0495597_0000325 Ga0495597_0000325_23858_24649 261
403 3300005467 Ga0070706_100004299 Ga0070706_1000042996 262
404 3300005563 Ga0068855_100237051 Ga0068855_1002370512 262
405 3300006042 Ga0075368_10093983 Ga0075368_100939832 262
406 3300006195 Ga0075366_10010775 Ga0075366_100107755 262
407 3300006353 Ga0075370_10021591 Ga0075370_100215912 262
408 3300014968 Ga0157379_10194822 Ga0157379_101948222 262
409 3300025910 Ga0207684_10247745 Ga0207684_102477452 262
410 3300025949 Ga0207667_10060449 Ga0207667_100604493 262
411 3300028794 Ga0307515_10000239 Ga0307515_1000023937 262
412 3300031507 Ga0307509_10024044 Ga0307509_100240442 262
413 3300037471 Ga0395905_0000181 Ga0395905_0000181_9264_10052 262
414 3300050493 nmdc:mga0k408_141776_c1 nmdc:mga0k408_141776_c1_397_1185 262
415 3300050496 nmdc:mga07m45_40073_c1 nmdc:mga07m45_40073_c1_1701_2489 262
416 3300053148 Ga0500590_000586 Ga0500590_000586_3685_4473 262
417 3300003791 Ga0055530_10021005 Ga0055530_100210052 263
418 3300005262 Ga0065165_1000757 Ga0065165_100075730 263
419 3300025273 Ga0209673_1019320 Ga0209673_10193202 263
420 3300025298 Ga0209050_1000720 Ga0209050_10007203 263
421 3300025303 Ga0209051_1039662 Ga0209051_10396623 263
422 3300031456 Ga0307513_10274310 Ga0307513_102743102 263
423 3300034957 Ga0373938_0006084 Ga0373938_0006084_1199_1993 263
424 3300049662 Ga0501222_000001 Ga0501222_000001_243807_244598 263
425 3300053086 Ga0500578_0000393 Ga0500578_0000393_39701_40495 263
426 3300053108 Ga0500562_055898 Ga0500562_055898_135_929 263
427 3300001979 JGI24740J21852_10030321 JGI24740J21852_100303211 265
428 3300005459 Ga0068867_100000004 Ga0068867_10000000417 265
429 3300009148 Ga0105243_10028502 Ga0105243_100285025 265
430 3300014745 Ga0157377_10000010 Ga0157377_1000001081 265
431 3300025935 Ga0207709_10015440 Ga0207709_100154405 265
432 3300026089 Ga0207648_10000002 Ga0207648_1000000217 265
433 3300037471 Ga0395905_0003555 Ga0395905_0003555_12745_13557 265
434 3300044712 Ga0453684_0008823 Ga0453684_0008823_7055_7864 265
435 3300046615 Ga0495656_0007829 Ga0495656_0007829_116_913 265
436 3300046684 Ga0495669_0015910 Ga0495669_0015910_2146_2943 265
437 3300047318 Ga0495636_0032347 Ga0495636_0032347_352_1149 265
438 3300047447 Ga0495685_018816 Ga0495685_018816_1267_2064 265
439 3300048927 Ga0496124_0098191 Ga0496124_0098191_745_1551 265
440 3300050493 nmdc:mga0k408_245320_c1 nmdc:mga0k408_245320_c1_107_910 265
441 3300050493 nmdc:mga0k408_81683_c1 nmdc:mga0k408_81683_c1_1028_1843 265
442 3300053086 Ga0500578_0099651 Ga0500578_0099651_878_1714 265
443 3300053730 Ga0500645_010354 Ga0500645_010354_2052_2888 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

24

217

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

228

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

203

0.8

PF08659

KR

KR domain

25

207

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9192 10 230
6zzo-assembly1.cif.gz_B crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9187 11 230
3csd-assembly1.cif.gz_B actinorhodin polyketide ketoreductase mutant p94l bound to nadph and the inhibitor emodin 0.9166 8 231
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9161 11 231
1w4z-assembly1.cif.gz_B-2 structure of actinorhodin polyketide (actiii) reductase 0.9151 8 231
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.944 10 187 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9267 11 231 3.40.50.720
af_P9WGR7_3_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9202 11 250 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9192 10 230 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9159 11 230 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5DRR8-F1-model_v4 Short-chain dehydrogenase 0.9911 10 263 GO:0016020
GO:0016491
AF-A0A109D0Z5-F1-model_v4 deleted 0.9879 70 265
AF-A0A1T4RR99-F1-model_v4 Short-chain dehydrogenase 0.9803 9 263 GO:0016020
GO:0016491
AF-A0A2W5DRR8-F1-model_v4 Short-chain dehydrogenase 0.9758 10 263 GO:0016020
GO:0016491
AF-A0A109D0Z5-F1-model_v4 deleted 0.9731 70 265

Feature Viewer

pLDDT pTM Quality
92.73 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map