F445090

General Info

Members Datasets Scaffolds Average Seq Length
443 273 886 141

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10274956|Ga0207645_102749562
Length 174
Sequence MPAKGTAEWKGDLPSGSGTFTAGDSISGGYTFKSRFEDGPGSNPEQLIAAAHAACFSMALSSILAKAGTPPESVRTDASVTLRMVDGSPTITKIDLVTVGRVPGLDAAAFAEHAAAAKAGCPVSKALASKDMTDNFAKTFAQPQPGTPADLEAFLRKEIAKWGKAVAASGAQVD

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
163 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 3.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 8.35
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10274956 3300025907 Bacteria 1117
2 Ga0070658_10579398 3300005327 Bacteria 972
3 Ga0070683_100060318 3300005329 Bacteria 3525
4 Ga0070683_100061424 3300005329 Bacteria 3494
5 Ga0070683_100805448 3300005329 Bacteria 900
6 Ga0070683_100938820 3300005329 Bacteria 830
7 Ga0070690_100184410 3300005330 Bacteria 1443
8 Ga0070677_10401649 3300005333 Bacteria 722
9 Ga0068869_101487849 3300005334 Bacteria 601
10 Ga0070680_100871663 3300005336 Unclassified 776
11 Ga0070682_100271224 3300005337 Bacteria 1233
12 Ga0068868_100736449 3300005338 Bacteria 885
13 Ga0068868_101389657 3300005338 Unclassified 654
14 Ga0068868_101471782 3300005338 Unclassified 637
15 Ga0070660_100259788 3300005339 Bacteria 1418
16 Ga0070689_100114904 3300005340 Bacteria 2145
17 Ga0070691_10249035 3300005341 Bacteria 952
18 Ga0070687_100064672 3300005343 Bacteria 1944
19 Ga0070668_100137822 3300005347 Bacteria 1964
20 Ga0070674_100046050 3300005356 Bacteria 2982
21 Ga0070673_100406545 3300005364 Bacteria 1218
22 Ga0070673_100984287 3300005364 Bacteria 785
23 Ga0070688_100138093 3300005365 Bacteria 1653
24 Ga0070667_100265796 3300005367 Bacteria 1537
25 Ga0070703_10315418 3300005406 Bacteria 656
26 Ga0070709_10059739 3300005434 Bacteria 2421
27 Ga0070709_10816677 3300005434 Bacteria 733
28 Ga0070714_100052840 3300005435 Bacteria 3466
29 Ga0070714_100055942 3300005435 Bacteria 3373
30 Ga0070714_100412329 3300005435 Bacteria 1279
31 Ga0070714_100862460 3300005435 Bacteria 878
32 Ga0070714_100965417 3300005435 Bacteria 829
33 Ga0070714_102477997 3300005435 Bacteria 504
34 Ga0070713_100030095 3300005436 Bacteria 4308
35 Ga0070713_100131593 3300005436 Bacteria 2207
36 Ga0070713_100345945 3300005436 Bacteria 1379
37 Ga0070713_100377214 3300005436 Bacteria 1320
38 Ga0070713_100438195 3300005436 Bacteria 1225
39 Ga0070713_101014873 3300005436 Bacteria 801
40 Ga0070713_101634129 3300005436 Bacteria 625
41 Ga0070710_10030568 3300005437 Bacteria 2899
42 Ga0070710_10433741 3300005437 Bacteria 887
43 Ga0070711_100077207 3300005439 Bacteria 2363
44 Ga0070711_100600530 3300005439 Bacteria 918
45 Ga0070711_101198326 3300005439 Unclassified 657
46 Ga0070700_100323571 3300005441 Bacteria 1134
47 Ga0070708_100190295 3300005445 Bacteria 1919
48 Ga0070708_100359885 3300005445 Unclassified 1371
49 Ga0070708_100603862 3300005445 Bacteria 1034
50 Ga0070663_100185923 3300005455 Bacteria 1614
51 Ga0070678_100375997 3300005456 Bacteria 1228
52 Ga0070681_10237380 3300005458 Bacteria 1737
53 Ga0070681_10319834 3300005458 Bacteria 1461
54 Ga0070681_11210238 3300005458 Unclassified 677
55 Ga0068867_100017064 3300005459 Bacteria 5158
56 Ga0068867_100497774 3300005459 Bacteria 1047
57 Ga0070685_10451796 3300005466 Bacteria 900
58 Ga0070706_100109458 3300005467 Bacteria 2571
59 Ga0070706_100125980 3300005467 Bacteria 2388
60 Ga0070707_100211073 3300005468 Bacteria 1892
61 Ga0070698_100011598 3300005471 Bacteria 9353
62 Ga0070698_100032587 3300005471 Bacteria 5397
63 Ga0070699_100026267 3300005518 Bacteria 5022
64 Ga0070699_100047444 3300005518 Bacteria 3717
65 Ga0070679_100039937 3300005530 Bacteria 4665
66 Ga0070684_100108176 3300005535 Bacteria 2491
67 Ga0070684_100137678 3300005535 Bacteria 2206
68 Ga0070684_101749646 3300005535 Bacteria 587
69 Ga0068853_100409521 3300005539 Bacteria 1270
70 Ga0068853_101215486 3300005539 Bacteria 728
71 Ga0070672_100152405 3300005543 Bacteria 1913
72 Ga0070686_100966452 3300005544 Bacteria 697
73 Ga0070665_100718468 3300005548 Bacteria 1012
74 Ga0070665_101748045 3300005548 Bacteria 629
75 Ga0068855_102392989 3300005563 Bacteria 527
76 Ga0068857_100097731 3300005577 Bacteria 2633
77 Ga0068857_100190924 3300005577 Bacteria 1866
78 Ga0068854_100119063 3300005578 Bacteria 2002
79 Ga0068854_101428731 3300005578 Bacteria 626
80 Ga0068856_100144190 3300005614 Bacteria 2389
81 Ga0068856_101012509 3300005614 Bacteria 849
82 Ga0070702_100158411 3300005615 Bacteria 1461
83 Ga0068852_101434430 3300005616 Bacteria 712
84 Ga0068859_100214446 3300005617 Bacteria 2012
85 Ga0068859_100581389 3300005617 Bacteria 1214
86 Ga0068859_101593614 3300005617 Bacteria 721
87 Ga0068859_101967311 3300005617 Bacteria 645
88 Ga0068864_101537896 3300005618 Bacteria 669
89 Ga0068866_10021062 3300005718 Bacteria 2997
90 Ga0068861_100307544 3300005719 Bacteria 1375
91 Ga0068863_100531294 3300005841 Bacteria 1160
92 Ga0068862_100822174 3300005844 Bacteria 909
93 Ga0068862_102119955 3300005844 Bacteria 573
94 Ga0070717_10112182 3300006028 Bacteria 2327
95 Ga0070717_10269242 3300006028 Bacteria 1509
96 Ga0070717_11058142 3300006028 Bacteria 739
97 Ga0070717_11186174 3300006028 Bacteria 695
98 Ga0070717_11275835 3300006028 Bacteria 668
99 Ga0070717_11984701 3300006028 Bacteria 524
100 Ga0075363_100109843 3300006048 Bacteria 1532
101 Ga0070716_100244684 3300006173 Bacteria 1218
102 Ga0070716_100494827 3300006173 Bacteria 901
103 Ga0070716_100496616 3300006173 Bacteria 899
104 Ga0070712_100174421 3300006175 Bacteria 1671
105 Ga0070712_100258433 3300006175 Bacteria 1395
106 Ga0070712_100671737 3300006175 Bacteria 881
107 Ga0070712_101569076 3300006175 Unclassified 576
108 Ga0097621_100078342 3300006237 Bacteria 2746
109 Ga0075428_100385945 3300006844 Bacteria 1501
110 Ga0075430_100400795 3300006846 Bacteria 1132
111 Ga0075431_100045982 3300006847 Bacteria 4500
112 Ga0075433_11458497 3300006852 Bacteria 591
113 Ga0075434_101289779 3300006871 Bacteria 741
114 Ga0075434_101817369 3300006871 Bacteria 616
115 Ga0075429_100016345 3300006880 Bacteria 6432
116 Ga0068865_100055791 3300006881 Bacteria 2750
117 Ga0068865_101294571 3300006881 Bacteria 648
118 Ga0097620_100214455 3300006931 Bacteria 2012
119 Ga0097620_100581316 3300006931 Bacteria 1214
120 Ga0097620_101594275 3300006931 Bacteria 721
121 Ga0097620_101968582 3300006931 Bacteria 645
122 Ga0105240_10714220 3300009093 Bacteria 1093
123 Ga0111539_10297415 3300009094 Bacteria 1879
124 Ga0105245_10207615 3300009098 Bacteria 1884
125 Ga0105245_10277035 3300009098 Bacteria 1638
126 Ga0105245_10368736 3300009098 Bacteria 1427
127 Ga0105245_10864368 3300009098 Bacteria 945
128 Ga0105245_12146298 3300009098 Bacteria 612
129 Ga0105247_10560929 3300009101 Bacteria 841
130 Ga0105247_11210863 3300009101 Bacteria 602
131 Ga0114129_10455827 3300009147 Bacteria 1676
132 Ga0114129_11417783 3300009147 Bacteria 857
133 Ga0114129_11764726 3300009147 Bacteria 753
134 Ga0105243_10008093 3300009148 Bacteria 8070
135 Ga0105243_10441681 3300009148 Bacteria 1218
136 Ga0105243_11668520 3300009148 Unclassified 665
137 Ga0105242_10012179 3300009176 Bacteria 6616
138 Ga0105242_10255186 3300009176 Bacteria 1582
139 Ga0105242_11375158 3300009176 Bacteria 732
140 Ga0105242_12883525 3300009176 Bacteria 531
141 Ga0105249_10440521 3300009553 Bacteria 1340
142 Ga0105249_11541808 3300009553 Bacteria 737
143 Ga0105246_10678419 3300011119 Bacteria 900
144 Ga0157371_11262923 3300013102 Bacteria 570
145 Ga0157369_10097453 3300013105 Bacteria 3137
146 Ga0157369_11229958 3300013105 Bacteria 764
147 Ga0157374_11578528 3300013296 Bacteria 680
148 Ga0157378_10004334 3300013297 Bacteria 12483
149 Ga0157378_10137758 3300013297 Bacteria 2264
150 Ga0157375_10980524 3300013308 Bacteria 986
151 Ga0163163_10182435 3300014325 Bacteria 2146
152 Ga0157379_10180453 3300014968 Bacteria 1907
153 Ga0197907_11297966 3300020069 Bacteria 519
154 Ga0206356_10517617 3300020070 Bacteria 861
155 Ga0206349_1184708 3300020075 Bacteria 548
156 Ga0206351_10653226 3300020077 Bacteria 1002
157 Ga0206350_11190453 3300020080 Bacteria 525
158 Ga0206354_11450649 3300020081 Bacteria 3272
159 Ga0206354_11585591 3300020081 Bacteria 967
160 Ga0206353_10849918 3300020082 Bacteria 3099
161 Ga0154015_1421395 3300020610 Bacteria 722
162 Ga0224712_10006615 3300022467 Bacteria 3320
163 Ga0224712_10030361 3300022467 Bacteria 1950
164 Ga0224712_10215203 3300022467 Bacteria 878
165 Ga0224712_10359351 3300022467 Bacteria 689
166 Ga0224712_10543740 3300022467 Bacteria 564
167 Ga0224712_10610531 3300022467 Bacteria 533
168 Ga0228598_1045753 3300024227 Bacteria 866
169 Ga0207692_10032479 3300025898 Bacteria 2509
170 Ga0207692_10587711 3300025898 Bacteria 715
171 Ga0207642_10109607 3300025899 Bacteria 1403
172 Ga0207680_10482315 3300025903 Bacteria 882
173 Ga0207647_10151930 3300025904 Bacteria 1353
174 Ga0207647_10236424 3300025904 Bacteria 1050
175 Ga0207699_10037455 3300025906 Bacteria 2773
176 Ga0207699_10125632 3300025906 Bacteria 1665
177 Ga0207705_10223481 3300025909 Bacteria 1431
178 Ga0207684_10121391 3300025910 Bacteria 2240
179 Ga0207684_10165763 3300025910 Bacteria 1904
180 Ga0207684_10348042 3300025910 Bacteria 1276
181 Ga0207707_10042275 3300025912 Bacteria 3978
182 Ga0207707_10191215 3300025912 Bacteria 1786
183 Ga0207707_10754237 3300025912 Bacteria 814
184 Ga0207693_10180287 3300025915 Bacteria 1662
185 Ga0207693_10283696 3300025915 Bacteria 1298
186 Ga0207693_10386331 3300025915 Bacteria 1095
187 Ga0207693_10531403 3300025915 Bacteria 917
188 Ga0207663_10096912 3300025916 Bacteria 1971
189 Ga0207663_10530999 3300025916 Bacteria 918
190 Ga0207660_10407765 3300025917 Bacteria 1095
191 Ga0207662_10022063 3300025918 Bacteria 3644
192 Ga0207657_10233948 3300025919 Bacteria 1469
193 Ga0207652_10122696 3300025921 Bacteria 2312
194 Ga0207652_10820116 3300025921 Bacteria 825
195 Ga0207646_10072279 3300025922 Bacteria 3081
196 Ga0207681_10266951 3300025923 Bacteria 1342
197 Ga0207687_10056290 3300025927 Bacteria 2758
198 Ga0207687_10087554 3300025927 Bacteria 2264
199 Ga0207700_10020607 3300025928 Bacteria 4482
200 Ga0207700_10069513 3300025928 Bacteria 2703
201 Ga0207700_10159509 3300025928 Bacteria 1872
202 Ga0207700_10275852 3300025928 Bacteria 1445
203 Ga0207700_10352146 3300025928 Bacteria 1282
204 Ga0207664_10018365 3300025929 Bacteria 5146
205 Ga0207664_10041741 3300025929 Bacteria 3575
206 Ga0207664_10300198 3300025929 Bacteria 1413
207 Ga0207664_10327202 3300025929 Bacteria 1353
208 Ga0207664_10354392 3300025929 Bacteria 1299
209 Ga0207664_10649192 3300025929 Bacteria 948
210 Ga0207664_11344702 3300025929 Bacteria 634
211 Ga0207690_10261895 3300025932 Bacteria 1340
212 Ga0207686_10049598 3300025934 Bacteria 2606
213 Ga0207709_10077513 3300025935 Bacteria 2131
214 Ga0207709_10448557 3300025935 Bacteria 997
215 Ga0207670_10108386 3300025936 Bacteria 1996
216 Ga0207670_11009020 3300025936 Unclassified 700
217 Ga0207669_10136041 3300025937 Bacteria 1697
218 Ga0207704_10086081 3300025938 Bacteria 2048
219 Ga0207665_10241667 3300025939 Bacteria 1330
220 Ga0207665_10344508 3300025939 Bacteria 1124
221 Ga0207665_10549828 3300025939 Bacteria 897
222 Ga0207691_10295855 3300025940 Bacteria 1391
223 Ga0207691_10580649 3300025940 Bacteria 949
224 Ga0207661_10053719 3300025944 Bacteria 3225
225 Ga0207661_10901507 3300025944 Bacteria 814
226 Ga0207661_11206477 3300025944 Bacteria 696
227 Ga0207651_10172153 3300025960 Bacteria 1709
228 Ga0207712_10148499 3300025961 Bacteria 1808
229 Ga0207640_10302050 3300025981 Bacteria 1267
230 Ga0207640_11334167 3300025981 Bacteria 641
231 Ga0207658_10398698 3300025986 Bacteria 1209
232 Ga0207658_10525795 3300025986 Unclassified 1056
233 Ga0207658_11292665 3300025986 Bacteria 667
234 Ga0207677_10234539 3300026023 Bacteria 1480
235 Ga0207639_11378528 3300026041 Bacteria 662
236 Ga0207678_10005632 3300026067 Bacteria 11200
237 Ga0207678_10733446 3300026067 Bacteria 870
238 Ga0207708_10389338 3300026075 Bacteria 1150
239 Ga0207702_10023810 3300026078 Bacteria 5080
240 Ga0207702_10220616 3300026078 Bacteria 1767
241 Ga0207702_10721783 3300026078 Bacteria 983
242 Ga0207641_10391600 3300026088 Bacteria 1333
243 Ga0207648_10001906 3300026089 Bacteria 22796
244 Ga0207648_11334294 3300026089 Unclassified 674
245 Ga0207676_10916589 3300026095 Bacteria 860
246 Ga0207674_10216259 3300026116 Bacteria 1865
247 Ga0207675_100697362 3300026118 Bacteria 1024
248 Ga0207683_10348534 3300026121 Bacteria 1359
249 Ga0207698_10816765 3300026142 Bacteria 935
250 Ga0265357_1016941 3300028023 Bacteria 778
251 Ga0268266_10080354 3300028379 Bacteria 2841
252 Ga0268266_10513322 3300028379 Bacteria 1145
253 Ga0268265_10348839 3300028380 Bacteria 1351
254 Ga0268265_10359544 3300028380 Bacteria 1332
255 Ga0265337_1006931 3300028556 Bacteria 4299
256 Ga0265326_10003835 3300028558 Bacteria 4894
257 Ga0265326_10076296 3300028558 Unclassified 948
258 Ga0265319_1003472 3300028563 Bacteria 8202
259 Ga0265334_10001673 3300028573 Bacteria 10600
260 Ga0265318_10034628 3300028577 Bacteria 1946
261 Ga0265323_10007860 3300028653 Bacteria 4411
262 Ga0265322_10029653 3300028654 Bacteria 1563
263 Ga0265336_10009655 3300028666 Bacteria 3329
264 Ga0265336_10012357 3300028666 Bacteria 2874
265 Ga0307515_10295537 3300028794 Bacteria 1310
266 Ga0265338_10000791 3300028800 Bacteria 53584
267 Ga0265338_10039572 3300028800 Bacteria 4445
268 Ga0265338_10098117 3300028800 Bacteria 2398
269 Ga0265324_10009261 3300029957 Bacteria 3853
270 Ga0265763_1009560 3300030763 Bacteria 883
271 Ga0265332_10010283 3300031238 Bacteria 4165
272 Ga0265320_10124625 3300031240 Bacteria 1172
273 Ga0265325_10151894 3300031241 Bacteria 1094
274 Ga0265340_10014602 3300031247 Bacteria 4096
275 Ga0265339_10073105 3300031249 Bacteria 1823
276 Ga0265327_10010757 3300031251 Bacteria 6384
277 Ga0307513_10381758 3300031456 Bacteria 1148
278 Ga0307514_10406955 3300031649 Bacteria 691
279 Ga0265314_10085784 3300031711 Bacteria 2063
280 Ga0265342_10268529 3300031712 Bacteria 906
281 Ga0316214_1006514 3300033545 Bacteria 1544
282 Ga0316212_1000422 3300033547 Bacteria 5135
283 Ga0373934_0006193 3300035086 Bacteria 4433
284 Ga0373934_0201791 3300035086 Bacteria 819
285 Ga0373923_0027163 3300035111 Bacteria 2281
286 Ga0373936_0023589 3300035113 Bacteria 2398
287 Ga0373953_0020510 3300035117 Bacteria 2470
288 Ga0373954_0087368 3300035118 Bacteria 1494
289 Ga0373956_0030772 3300035119 Bacteria 2348
290 Ga0373957_0010836 3300035120 Bacteria 3025
291 Ga0373946_0536463 3300035171 Bacteria 603
292 Ga0373955_0133531 3300035172 Bacteria 1450
293 Ga0373955_0481242 3300035172 Unclassified 758
294 Ga0373961_0024024 3300035241 Bacteria 1645
295 Ga0373924_0023416 3300035410 Bacteria 2422
296 Ga0373931_0077898 3300035691 Bacteria 1823
297 Ga0373935_0351354 3300035692 Unclassified 1051
298 Ga0373935_0407264 3300035692 Bacteria 977
299 Ga0373927_0153709 3300035695 Bacteria 1507
300 Ga0373933_0069511 3300035724 Bacteria 2140
301 Ga0373947_0460249 3300035725 Unclassified 862
302 Ga0373937_0515154 3300036401 Bacteria 1136
303 Ga0372808_001697 3300036459 Bacteria 2364
304 Ga0373925_0000348 3300037068 Bacteria 48026
305 Ga0373925_0665599 3300037068 Bacteria 858
306 Ga0395900_0251337 3300037418 Bacteria 1769
307 Ga0395900_0523739 3300037418 Bacteria 1133
308 Ga0395898_0166596 3300037466 Bacteria 2107
309 Ga0395898_0348427 3300037466 Bacteria 1412
310 Ga0436364_1492750 3300037853 Bacteria 2656
311 Ga0436360_0342892 3300039438 Bacteria 1615
312 Ga0451847_0539739 3300041503 Bacteria 587
313 Ga0466967_0691773 3300045976 Bacteria 1010
314 Ga0495592_0087407 3300046454 Bacteria 2242
315 Ga0495651_0125566 3300046462 Bacteria 1879
316 Ga0495653_0245879 3300046463 Bacteria 1189
317 Ga0495653_0320269 3300046463 Unclassified 1005
318 Ga0495653_0537397 3300046463 Bacteria 725
319 Ga0495608_0095055 3300046511 Bacteria 1925
320 Ga0495618_0227315 3300046514 Bacteria 1175
321 Ga0495628_0209787 3300046516 Bacteria 1465
322 Ga0495628_0627749 3300046516 Bacteria 765
323 Ga0495630_0074771 3300046517 Bacteria 2552
324 Ga0495630_0075437 3300046517 Bacteria 2541
325 Ga0495630_0105365 3300046517 Bacteria 2135
326 Ga0495652_0197134 3300046529 Bacteria 1531
327 Ga0495652_0437075 3300046529 Bacteria 919
328 Ga0495640_0124154 3300046533 Bacteria 1675
329 Ga0495640_0174945 3300046533 Bacteria 1370
330 Ga0495586_0290276 3300046535 Bacteria 936
331 Ga0495587_0244012 3300046536 Bacteria 1010
332 Ga0495645_0188064 3300046543 Bacteria 1409
333 Ga0495645_0493177 3300046543 Bacteria 767
334 Ga0495667_0073426 3300046559 Bacteria 2228
335 Ga0495667_0490428 3300046559 Bacteria 770
336 Ga0495634_0107040 3300046642 Bacteria 1801
337 Ga0495635_0174485 3300046663 Bacteria 1461
338 Ga0495635_0180965 3300046663 Bacteria 1433
339 Ga0495588_0449604 3300046674 Unclassified 676
340 Ga0495657_0119110 3300046675 Bacteria 1664
341 Ga0495657_0453410 3300046675 Bacteria 751
342 Ga0495623_0023565 3300046679 Bacteria 3972
343 Ga0495646_0073023 3300046680 Bacteria 2016
344 Ga0495658_0593181 3300046683 Bacteria 710
345 Ga0495658_0623539 3300046683 Unclassified 691
346 Ga0495613_0000649 3300046689 Bacteria 27637
347 Ga0495613_0288807 3300046689 Bacteria 1137
348 Ga0495613_1096440 3300046689 Bacteria 508
349 Ga0495624_0351565 3300046690 Unclassified 886
350 Ga0495624_0514670 3300046690 Bacteria 715
351 Ga0495600_0286540 3300046809 Bacteria 1041
352 Ga0495604_0119925 3300047317 Bacteria 1905
353 Ga0495674_0050136 3300047319 Bacteria 3684
354 Ga0495680_0016493 3300047322 Bacteria 6342
355 Ga0495680_0178777 3300047322 Bacteria 1532
356 Ga0495680_0195750 3300047322 Bacteria 1452
357 Ga0495675_0161298 3300047444 Bacteria 1380
358 Ga0495684_0006975 3300047471 Bacteria 8775
359 Ga0495684_0063118 3300047471 Unclassified 2817
360 Ga0495593_0313806 3300047673 Bacteria 784
361 Ga0495602_0047319 3300048088 Bacteria 3876
362 Ga0495614_0117678 3300048089 Bacteria 1170
363 Ga0496100_0051956 3300048903 Bacteria 2663
364 Ga0496100_0108322 3300048903 Bacteria 1926
365 Ga0496101_0044229 3300048904 Bacteria 3186
366 Ga0496101_0407172 3300048904 Bacteria 1071
367 Ga0496102_0050276 3300048905 Bacteria 3795
368 Ga0496102_0106798 3300048905 Bacteria 2606
369 Ga0496102_0294286 3300048905 Bacteria 1530
370 Ga0496102_1330792 3300048905 Bacteria 637
371 Ga0496103_0102540 3300048906 Bacteria 1812
372 Ga0496103_0380319 3300048906 Bacteria 907
373 Ga0496103_0925340 3300048906 Bacteria 545
374 Ga0496104_0021367 3300048907 Bacteria 5942
375 Ga0496104_0184649 3300048907 Bacteria 1996
376 Ga0496105_0007415 3300048908 Bacteria 8489
377 Ga0496105_0279337 3300048908 Bacteria 1347
378 Ga0496105_0996968 3300048908 Bacteria 627
379 Ga0496106_0020913 3300048909 Bacteria 4856
380 Ga0496107_0149515 3300048910 Bacteria 1727
381 Ga0496107_0219932 3300048910 Bacteria 1413
382 Ga0496108_0202077 3300048911 Bacteria 1725
383 Ga0496108_0250818 3300048911 Bacteria 1540
384 Ga0496109_0711346 3300048912 Bacteria 942
385 Ga0496109_1223370 3300048912 Bacteria 687
386 Ga0496110_0016829 3300048913 Bacteria 6110
387 Ga0496110_0151332 3300048913 Bacteria 2101
388 Ga0496110_1438394 3300048913 Bacteria 599
389 Ga0496111_0228306 3300048914 Bacteria 1383
390 Ga0496111_0417272 3300048914 Bacteria 991
391 Ga0496112_0019626 3300048915 Bacteria 6384
392 Ga0496112_0512949 3300048915 Bacteria 1134
393 Ga0496112_0813145 3300048915 Bacteria 859
394 Ga0496112_0920440 3300048915 Bacteria 796
395 Ga0496113_0835952 3300048916 Bacteria 730
396 Ga0496114_0016738 3300048917 Bacteria 5913
397 Ga0496114_0179051 3300048917 Bacteria 1851
398 Ga0496114_0245182 3300048917 Bacteria 1576
399 Ga0496115_0050020 3300048918 Bacteria 3347
400 Ga0496118_0128614 3300048921 Bacteria 1632
401 Ga0496119_0000253 3300048922 Bacteria 75779
402 Ga0496120_0015806 3300048923 Bacteria 4960
403 Ga0496126_0035786 3300048929 Bacteria 4648
404 Ga0496126_0037276 3300048929 Bacteria 4539
405 Ga0496126_0086524 3300048929 Bacteria 2762
406 Ga0501031_0236468 3300049568 Bacteria 1188
407 Ga0501036_0113508 3300049572 Bacteria 2290
408 Ga0501038_0482150 3300049574 Bacteria 950
409 Ga0501039_0046768 3300049575 Bacteria 3344
410 Ga0501040_0166648 3300049576 Bacteria 1559
411 Ga0501041_0053571 3300049577 Bacteria 2461
412 Ga0501047_0761000 3300049581 Bacteria 784
413 Ga0501068_0053016 3300049584 Bacteria 2454
414 Ga0501069_0000305 3300049585 Bacteria 22379
415 Ga0501070_0005032 3300049586 Bacteria 11277
416 Ga0501071_0053261 3300049587 Bacteria 2918
417 Ga0501072_0351452 3300049588 Bacteria 1170
418 Ga0501073_0008736 3300049589 Bacteria 7500
419 Ga0501074_0008702 3300049590 Bacteria 7355
420 Ga0501076_0223045 3300049592 Bacteria 1540
421 Ga0501077_0307056 3300049593 Bacteria 1011
422 Ga0501079_0067684 3300049741 Bacteria 2756
423 Ga0501079_0237120 3300049741 Bacteria 1425
424 Ga0501080_0003484 3300049742 Bacteria 13864
425 Ga0501080_1271276 3300049742 Bacteria 631
426 Ga0501083_0000167 3300049744 Bacteria 43126
427 Ga0501035_0921841 3300049822 Bacteria 691
428 Ga0501045_0254470 3300049824 Bacteria 1307
429 nmdc:mga03n38_144257_c1 3300050490 Bacteria 1192
430 nmdc:mga00v17_384776_c1 3300050491 Bacteria 912
431 nmdc:mga05p37_302849_c1 3300050507 Bacteria 1898
432 nmdc:mga09592_59626_c1 3300050508 Bacteria 3226
433 nmdc:mga0qj67_860066_c1 3300050509 Bacteria 716
434 nmdc:mga06r32_125207_c1 3300050510 Bacteria 2538
435 Ga0495601_0140444 3300053077 Bacteria 1575
436 Ga0495612_0070585 3300053078 Bacteria 1456
437 Ga0495619_0177244 3300053085 Bacteria 1474
438 Ga0495619_0183499 3300053085 Bacteria 1448
439 Ga0500616_0025163 3300053153 Bacteria 3302
440 Ga0501084_0000101 3300054114 Bacteria 63579
441 Ga0501084_0153132 3300054114 Bacteria 1944
442 Ga0501082_0056867 3300060353 Bacteria 3370
443 Ga0530510_0495086 3300061734 Bacteria 926
444 Ga0207645_10274956
445 Ga0070658_10579398
446 Ga0070683_100060318
447 Ga0070683_100061424
448 Ga0070683_100805448
449 Ga0070683_100938820
450 Ga0070690_100184410
451 Ga0070677_10401649
452 Ga0068869_101487849
453 Ga0070680_100871663
454 Ga0070682_100271224
455 Ga0068868_100736449
456 Ga0068868_101389657
457 Ga0068868_101471782
458 Ga0070660_100259788
459 Ga0070689_100114904
460 Ga0070691_10249035
461 Ga0070687_100064672
462 Ga0070668_100137822
463 Ga0070674_100046050
464 Ga0070673_100406545
465 Ga0070673_100984287
466 Ga0070688_100138093
467 Ga0070667_100265796
468 Ga0070703_10315418
469 Ga0070709_10059739
470 Ga0070709_10816677
471 Ga0070714_100052840
472 Ga0070714_100055942
473 Ga0070714_100412329
474 Ga0070714_100862460
475 Ga0070714_100965417
476 Ga0070714_102477997
477 Ga0070713_100030095
478 Ga0070713_100131593
479 Ga0070713_100345945
480 Ga0070713_100377214
481 Ga0070713_100438195
482 Ga0070713_101014873
483 Ga0070713_101634129
484 Ga0070710_10030568
485 Ga0070710_10433741
486 Ga0070711_100077207
487 Ga0070711_100600530
488 Ga0070711_101198326
489 Ga0070700_100323571
490 Ga0070708_100190295
491 Ga0070708_100359885
492 Ga0070708_100603862
493 Ga0070663_100185923
494 Ga0070678_100375997
495 Ga0070681_10237380
496 Ga0070681_10319834
497 Ga0070681_11210238
498 Ga0068867_100017064
499 Ga0068867_100497774
500 Ga0070685_10451796
501 Ga0070706_100109458
502 Ga0070706_100125980
503 Ga0070707_100211073
504 Ga0070698_100011598
505 Ga0070698_100032587
506 Ga0070699_100026267
507 Ga0070699_100047444
508 Ga0070679_100039937
509 Ga0070684_100108176
510 Ga0070684_100137678
511 Ga0070684_101749646
512 Ga0068853_100409521
513 Ga0068853_101215486
514 Ga0070672_100152405
515 Ga0070686_100966452
516 Ga0070665_100718468
517 Ga0070665_101748045
518 Ga0068855_102392989
519 Ga0068857_100097731
520 Ga0068857_100190924
521 Ga0068854_100119063
522 Ga0068854_101428731
523 Ga0068856_100144190
524 Ga0068856_101012509
525 Ga0070702_100158411
526 Ga0068852_101434430
527 Ga0068859_100214446
528 Ga0068859_100581389
529 Ga0068859_101593614
530 Ga0068859_101967311
531 Ga0068864_101537896
532 Ga0068866_10021062
533 Ga0068861_100307544
534 Ga0068863_100531294
535 Ga0068862_100822174
536 Ga0068862_102119955
537 Ga0070717_10112182
538 Ga0070717_10269242
539 Ga0070717_11058142
540 Ga0070717_11186174
541 Ga0070717_11275835
542 Ga0070717_11984701
543 Ga0075363_100109843
544 Ga0070716_100244684
545 Ga0070716_100494827
546 Ga0070716_100496616
547 Ga0070712_100174421
548 Ga0070712_100258433
549 Ga0070712_100671737
550 Ga0070712_101569076
551 Ga0097621_100078342
552 Ga0075428_100385945
553 Ga0075430_100400795
554 Ga0075431_100045982
555 Ga0075433_11458497
556 Ga0075434_101289779
557 Ga0075434_101817369
558 Ga0075429_100016345
559 Ga0068865_100055791
560 Ga0068865_101294571
561 Ga0097620_100214455
562 Ga0097620_100581316
563 Ga0097620_101594275
564 Ga0097620_101968582
565 Ga0105240_10714220
566 Ga0111539_10297415
567 Ga0105245_10207615
568 Ga0105245_10277035
569 Ga0105245_10368736
570 Ga0105245_10864368
571 Ga0105245_12146298
572 Ga0105247_10560929
573 Ga0105247_11210863
574 Ga0114129_10455827
575 Ga0114129_11417783
576 Ga0114129_11764726
577 Ga0105243_10008093
578 Ga0105243_10441681
579 Ga0105243_11668520
580 Ga0105242_10012179
581 Ga0105242_10255186
582 Ga0105242_11375158
583 Ga0105242_12883525
584 Ga0105249_10440521
585 Ga0105249_11541808
586 Ga0105246_10678419
587 Ga0157371_11262923
588 Ga0157369_10097453
589 Ga0157369_11229958
590 Ga0157374_11578528
591 Ga0157378_10004334
592 Ga0157378_10137758
593 Ga0157375_10980524
594 Ga0163163_10182435
595 Ga0157379_10180453
596 Ga0197907_11297966
597 Ga0206356_10517617
598 Ga0206349_1184708
599 Ga0206351_10653226
600 Ga0206350_11190453
601 Ga0206354_11450649
602 Ga0206354_11585591
603 Ga0206353_10849918
604 Ga0154015_1421395
605 Ga0224712_10006615
606 Ga0224712_10030361
607 Ga0224712_10215203
608 Ga0224712_10359351
609 Ga0224712_10543740
610 Ga0224712_10610531
611 Ga0228598_1045753
612 Ga0207692_10032479
613 Ga0207692_10587711
614 Ga0207642_10109607
615 Ga0207680_10482315
616 Ga0207647_10151930
617 Ga0207647_10236424
618 Ga0207699_10037455
619 Ga0207699_10125632
620 Ga0207705_10223481
621 Ga0207684_10121391
622 Ga0207684_10165763
623 Ga0207684_10348042
624 Ga0207707_10042275
625 Ga0207707_10191215
626 Ga0207707_10754237
627 Ga0207693_10180287
628 Ga0207693_10283696
629 Ga0207693_10386331
630 Ga0207693_10531403
631 Ga0207663_10096912
632 Ga0207663_10530999
633 Ga0207660_10407765
634 Ga0207662_10022063
635 Ga0207657_10233948
636 Ga0207652_10122696
637 Ga0207652_10820116
638 Ga0207646_10072279
639 Ga0207681_10266951
640 Ga0207687_10056290
641 Ga0207687_10087554
642 Ga0207700_10020607
643 Ga0207700_10069513
644 Ga0207700_10159509
645 Ga0207700_10275852
646 Ga0207700_10352146
647 Ga0207664_10018365
648 Ga0207664_10041741
649 Ga0207664_10300198
650 Ga0207664_10327202
651 Ga0207664_10354392
652 Ga0207664_10649192
653 Ga0207664_11344702
654 Ga0207690_10261895
655 Ga0207686_10049598
656 Ga0207709_10077513
657 Ga0207709_10448557
658 Ga0207670_10108386
659 Ga0207670_11009020
660 Ga0207669_10136041
661 Ga0207704_10086081
662 Ga0207665_10241667
663 Ga0207665_10344508
664 Ga0207665_10549828
665 Ga0207691_10295855
666 Ga0207691_10580649
667 Ga0207661_10053719
668 Ga0207661_10901507
669 Ga0207661_11206477
670 Ga0207651_10172153
671 Ga0207712_10148499
672 Ga0207640_10302050
673 Ga0207640_11334167
674 Ga0207658_10398698
675 Ga0207658_10525795
676 Ga0207658_11292665
677 Ga0207677_10234539
678 Ga0207639_11378528
679 Ga0207678_10005632
680 Ga0207678_10733446
681 Ga0207708_10389338
682 Ga0207702_10023810
683 Ga0207702_10220616
684 Ga0207702_10721783
685 Ga0207641_10391600
686 Ga0207648_10001906
687 Ga0207648_11334294
688 Ga0207676_10916589
689 Ga0207674_10216259
690 Ga0207675_100697362
691 Ga0207683_10348534
692 Ga0207698_10816765
693 Ga0265357_1016941
694 Ga0268266_10080354
695 Ga0268266_10513322
696 Ga0268265_10348839
697 Ga0268265_10359544
698 Ga0265337_1006931
699 Ga0265326_10003835
700 Ga0265326_10076296
701 Ga0265319_1003472
702 Ga0265334_10001673
703 Ga0265318_10034628
704 Ga0265323_10007860
705 Ga0265322_10029653
706 Ga0265336_10009655
707 Ga0265336_10012357
708 Ga0307515_10295537
709 Ga0265338_10000791
710 Ga0265338_10039572
711 Ga0265338_10098117
712 Ga0265324_10009261
713 Ga0265763_1009560
714 Ga0265332_10010283
715 Ga0265320_10124625
716 Ga0265325_10151894
717 Ga0265340_10014602
718 Ga0265339_10073105
719 Ga0265327_10010757
720 Ga0307513_10381758
721 Ga0307514_10406955
722 Ga0265314_10085784
723 Ga0265342_10268529
724 Ga0316214_1006514
725 Ga0316212_1000422
726 Ga0373934_0006193
727 Ga0373934_0201791
728 Ga0373923_0027163
729 Ga0373936_0023589
730 Ga0373953_0020510
731 Ga0373954_0087368
732 Ga0373956_0030772
733 Ga0373957_0010836
734 Ga0373946_0536463
735 Ga0373955_0133531
736 Ga0373955_0481242
737 Ga0373961_0024024
738 Ga0373924_0023416
739 Ga0373931_0077898
740 Ga0373935_0351354
741 Ga0373935_0407264
742 Ga0373927_0153709
743 Ga0373933_0069511
744 Ga0373947_0460249
745 Ga0373937_0515154
746 Ga0372808_001697
747 Ga0373925_0000348
748 Ga0373925_0665599
749 Ga0395900_0251337
750 Ga0395900_0523739
751 Ga0395898_0166596
752 Ga0395898_0348427
753 Ga0436364_1492750
754 Ga0436360_0342892
755 Ga0451847_0539739
756 Ga0466967_0691773
757 Ga0495592_0087407
758 Ga0495651_0125566
759 Ga0495653_0245879
760 Ga0495653_0320269
761 Ga0495653_0537397
762 Ga0495608_0095055
763 Ga0495618_0227315
764 Ga0495628_0209787
765 Ga0495628_0627749
766 Ga0495630_0074771
767 Ga0495630_0075437
768 Ga0495630_0105365
769 Ga0495652_0197134
770 Ga0495652_0437075
771 Ga0495640_0124154
772 Ga0495640_0174945
773 Ga0495586_0290276
774 Ga0495587_0244012
775 Ga0495645_0188064
776 Ga0495645_0493177
777 Ga0495667_0073426
778 Ga0495667_0490428
779 Ga0495634_0107040
780 Ga0495635_0174485
781 Ga0495635_0180965
782 Ga0495588_0449604
783 Ga0495657_0119110
784 Ga0495657_0453410
785 Ga0495623_0023565
786 Ga0495646_0073023
787 Ga0495658_0593181
788 Ga0495658_0623539
789 Ga0495613_0000649
790 Ga0495613_0288807
791 Ga0495613_1096440
792 Ga0495624_0351565
793 Ga0495624_0514670
794 Ga0495600_0286540
795 Ga0495604_0119925
796 Ga0495674_0050136
797 Ga0495680_0016493
798 Ga0495680_0178777
799 Ga0495680_0195750
800 Ga0495675_0161298
801 Ga0495684_0006975
802 Ga0495684_0063118
803 Ga0495593_0313806
804 Ga0495602_0047319
805 Ga0495614_0117678
806 Ga0496100_0051956
807 Ga0496100_0108322
808 Ga0496101_0044229
809 Ga0496101_0407172
810 Ga0496102_0050276
811 Ga0496102_0106798
812 Ga0496102_0294286
813 Ga0496102_1330792
814 Ga0496103_0102540
815 Ga0496103_0380319
816 Ga0496103_0925340
817 Ga0496104_0021367
818 Ga0496104_0184649
819 Ga0496105_0007415
820 Ga0496105_0279337
821 Ga0496105_0996968
822 Ga0496106_0020913
823 Ga0496107_0149515
824 Ga0496107_0219932
825 Ga0496108_0202077
826 Ga0496108_0250818
827 Ga0496109_0711346
828 Ga0496109_1223370
829 Ga0496110_0016829
830 Ga0496110_0151332
831 Ga0496110_1438394
832 Ga0496111_0228306
833 Ga0496111_0417272
834 Ga0496112_0019626
835 Ga0496112_0512949
836 Ga0496112_0813145
837 Ga0496112_0920440
838 Ga0496113_0835952
839 Ga0496114_0016738
840 Ga0496114_0179051
841 Ga0496114_0245182
842 Ga0496115_0050020
843 Ga0496118_0128614
844 Ga0496119_0000253
845 Ga0496120_0015806
846 Ga0496126_0035786
847 Ga0496126_0037276
848 Ga0496126_0086524
849 Ga0501031_0236468
850 Ga0501036_0113508
851 Ga0501038_0482150
852 Ga0501039_0046768
853 Ga0501040_0166648
854 Ga0501041_0053571
855 Ga0501047_0761000
856 Ga0501068_0053016
857 Ga0501069_0000305
858 Ga0501070_0005032
859 Ga0501071_0053261
860 Ga0501072_0351452
861 Ga0501073_0008736
862 Ga0501074_0008702
863 Ga0501076_0223045
864 Ga0501077_0307056
865 Ga0501079_0067684
866 Ga0501079_0237120
867 Ga0501080_0003484
868 Ga0501080_1271276
869 Ga0501083_0000167
870 Ga0501035_0921841
871 Ga0501045_0254470
872 nmdc:mga03n38_144257_c1
873 nmdc:mga00v17_384776_c1
874 nmdc:mga05p37_302849_c1
875 nmdc:mga09592_59626_c1
876 nmdc:mga0qj67_860066_c1
877 nmdc:mga06r32_125207_c1
878 Ga0495601_0140444
879 Ga0495612_0070585
880 Ga0495619_0177244
881 Ga0495619_0183499
882 Ga0500616_0025163
883 Ga0501084_0000101
884 Ga0501084_0153132
885 Ga0501082_0056867
886 Ga0530510_0495086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

37

133

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lus-assembly1.cif.gz_A crystal structure of a putative organic hydroperoxide resistance protein with molecule of captopril bound in one of the active sites from vibrio cholerae o1 biovar eltor str. n16961 0.7977 38 139
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.7273 7 140
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.7106 23 140
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.699 17 137
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.695 1 139
ID Description Score Start End Superfamily
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8678 43 140 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8634 43 140 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8551 41 140 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8401 43 140 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8387 43 140 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V6D478-F1-model_v4 Peroxiredoxin 0.9867 74 140
AF-A0A0S6VUX4-F1-model_v4 Osmotically inducible protein C 0.984 58 140 GO:0004601
GO:0006979
AF-A0A534ZDK2-F1-model_v4 OsmC family peroxiredoxin 0.982 44 140 GO:0004601
GO:0006979
AF-A0A536PQY6-F1-model_v4 Peroxiredoxin 0.9757 63 140
AF-A0A084A7I3-F1-model_v4 Osmotically inducible protein C 0.9733 58 140 GO:0004601
GO:0006979

Map