F445012

General Info

Members Datasets Scaffolds Average Seq Length
443 260 414 223

Family's Representative Sequence

Representative Sequence 3300003577|Ga0007416J51690_1005421|Ga0007416J51690_10054213
Length 225
Sequence MTSSLLETIQIETAPNPTVSVIWIHGLGADGFDFVPIVRELDLSGCPGIRFIFPHAPTMPVTINGGYVMRAWYDILGLDANLIKHEDEAGLRQSQAAIEALIAQEKSRGIAVDRIVLAGFSQGCAMTLQTGLRHPEKLAGLLCLSGYVPINTTLAAERHAANQNTPIFMAHGRSDPVIPIDRAEKSRDLLKALNYSVEWREYMMQHAVCPEEIDDISAWLKRVLK

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
7 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
8 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
9 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
10 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
11 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
12 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
13 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
14 2842733646 Variovorax sp. R-72446 Isolate Unclassified
15 2842747753 Variovorax sp. R-72060 Isolate Unclassified
16 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
17 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
18 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
19 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
20 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
21 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
22 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
23 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
24 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
27 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
28 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
29 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
30 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
35 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
36 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
257 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 0.9
Isolates 6.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 1.35
Rhizoplane 3.84
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 10.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000499 3300002704 Bacteria 9484
2 JGI25155J39150_1000613 3300002704 Bacteria 7499
3 JGI25156J39149_1000099 3300002705 Bacteria 63582
4 JGI25156J39149_1004652 3300002705 Bacteria 4126
5 JGI25154J39366_1000119 3300002738 Bacteria 63565
6 JGI25154J39366_1000400 3300002738 Bacteria 23688
7 JGI25157J39369_1000094 3300002741 Bacteria 76378
8 JGI25159J45721_1001130 3300002987 Bacteria 11398
9 JGI26129J50193_1006685 3300003349 Bacteria 829
10 Ga0007416J51690_1005421 3300003577 Bacteria 2370
11 Ga0032354_1024932 3300003693 Bacteria 2230
12 Ga0055538_1000002 3300003751 Bacteria 999437
13 Ga0055539_1000002 3300003752 Bacteria 999437
14 Ga0055533_1000004 3300003756 Bacteria 999437
15 Ga0055532_1000017 3300003758 Bacteria 306880
16 Ga0055525_1000002 3300003759 Bacteria 999437
17 Ga0055535_1008038 3300003761 Bacteria 1944
18 Ga0055526_1000551 3300003771 Bacteria 29633
19 Ga0055537_1000144 3300003773 Bacteria 53397
20 Ga0055524_1001058 3300003775 Bacteria 16973
21 Ga0055534_1000072 3300003784 Bacteria 78212
22 Ga0055541_1000043 3300003841 Bacteria 161703
23 JGI25405J52794_10028229 3300003911 Bacteria 1158
24 Ga0055543_1006392 3300004625 Bacteria 2854
25 Ga0065165_1000187 3300005262 Bacteria 108694
26 Ga0070689_100971273 3300005340 Unclassified 754
27 Ga0070691_10033620 3300005341 Bacteria 2413
28 Ga0070700_100579549 3300005441 Bacteria 876
29 Ga0070694_100003620 3300005444 Bacteria 9230
30 Ga0070708_100069199 3300005445 Bacteria 3174
31 Ga0070662_100074119 3300005457 Bacteria 2517
32 Ga0070706_100143706 3300005467 Bacteria 2228
33 Ga0070707_100036559 3300005468 Bacteria 4685
34 Ga0070707_100216591 3300005468 Bacteria 1866
35 Ga0070699_100312984 3300005518 Bacteria 1410
36 Ga0070695_100000850 3300005545 Bacteria 16445
37 Ga0070696_100319498 3300005546 Bacteria 1194
38 Ga0068855_100000065 3300005563 Bacteria 129307
39 Ga0068855_100120477 3300005563 Bacteria 3003
40 Ga0068855_100200455 3300005563 Bacteria 2247
41 Ga0068857_100973332 3300005577 Bacteria 816
42 Ga0068856_100036672 3300005614 Bacteria 4808
43 Ga0068852_100015967 3300005616 Bacteria 5845
44 Ga0068860_100633699 3300005843 Bacteria 1076
45 Ga0081455_10000772 3300005937 Bacteria 41282
46 Ga0070717_10163890 3300006028 Bacteria 1930
47 Ga0075432_10048015 3300006058 Bacteria 1501
48 Ga0075430_100000248 3300006846 Bacteria 37345
49 Ga0075430_100114872 3300006846 Bacteria 2243
50 Ga0075431_100001170 3300006847 Bacteria 23654
51 Ga0075433_10009036 3300006852 Bacteria 7959
52 Ga0075434_100038098 3300006871 Bacteria 4762
53 Ga0075429_100000001 3300006880 Bacteria 139031
54 Ga0075436_100030092 3300006914 Bacteria 3736
55 Ga0079104_1008855 3300006946 Bacteria 3464
56 Ga0099826_10000003 3300006948 Bacteria 1067817
57 Ga0075435_100394492 3300007076 Bacteria 1190
58 Ga0105240_10001581 3300009093 Bacteria 38647
59 Ga0105240_10020891 3300009093 Bacteria 8720
60 Ga0111539_10115138 3300009094 Bacteria 3153
61 Ga0114129_10042384 3300009147 Bacteria 6410
62 Ga0114129_10058813 3300009147 Bacteria 5376
63 Ga0105237_10001959 3300009545 Bacteria 26205
64 Ga0105238_10051101 3300009551 Bacteria 4159
65 Ga0105238_10253471 3300009551 Bacteria 1739
66 Ga0157373_10108265 3300013100 Bacteria 1954
67 Ga0157371_10000001 3300013102 Bacteria 1162285
68 Ga0157371_10094454 3300013102 Bacteria 2119
69 Ga0163162_10154394 3300013306 Bacteria 2415
70 Ga0157372_10683434 3300013307 Bacteria 1195
71 Ga0182008_10055026 3300014497 Bacteria 1968
72 Ga0182006_1020047 3300015261 Bacteria 2806
73 Ga0182006_1022364 3300015261 Bacteria 2629
74 Ga0213872_10000494 3300021361 Bacteria 31496
75 Ga0213872_10002525 3300021361 Bacteria 10669
76 Ga0209435_100015 3300025206 Bacteria 321177
77 Ga0209435_100112 3300025206 Bacteria 31239
78 Ga0209436_122600 3300025208 Bacteria 807
79 Ga0209784_100002 3300025224 Bacteria 1753105
80 Ga0209566_100003 3300025225 Bacteria 1753105
81 Ga0209674_100004 3300025226 Bacteria 1753105
82 Ga0209147_100004 3300025229 Bacteria 1371850
83 Ga0209563_100006 3300025230 Bacteria 1753105
84 Ga0209437_100045 3300025233 Bacteria 429809
85 Ga0209258_100304 3300025242 Bacteria 79331
86 Ga0209646_1000020 3300025246 Bacteria 462204
87 Ga0209646_1000040 3300025246 Bacteria 347867
88 Ga0209026_1000034 3300025250 Bacteria 306953
89 Ga0209026_1004103 3300025250 Bacteria 4481
90 Ga0209677_100003 3300025253 Bacteria 1753105
91 Ga0209759_1000049 3300025256 Bacteria 221692
92 Ga0209759_1000073 3300025256 Bacteria 178048
93 Ga0209565_1000006 3300025263 Bacteria 897294
94 Ga0209565_1003538 3300025263 Bacteria 5008
95 Ga0209455_1000350 3300025272 Bacteria 43198
96 Ga0209673_1000004 3300025273 Bacteria 896155
97 Ga0209130_1000191 3300025284 Bacteria 85239
98 Ga0209675_1000006 3300025291 Bacteria 732267
99 Ga0209564_1000085 3300025295 Bacteria 251509
100 Ga0209564_1007682 3300025295 Bacteria 5500
101 Ga0209256_1000013 3300025299 Bacteria 689442
102 Ga0209256_1000037 3300025299 Bacteria 377661
103 Ga0207699_10324463 3300025906 Bacteria 1081
104 Ga0207695_10018109 3300025913 Bacteria 8152
105 Ga0207695_10059018 3300025913 Bacteria 3981
106 Ga0207695_10482755 3300025913 Bacteria 1121
107 Ga0207671_10111343 3300025914 Bacteria 2083
108 Ga0207646_10035734 3300025922 Bacteria 4486
109 Ga0207681_10033486 3300025923 Bacteria 3369
110 Ga0207694_10031761 3300025924 Bacteria 4036
111 Ga0207694_10175030 3300025924 Bacteria 1739
112 Ga0207665_10164251 3300025939 Bacteria 1599
113 Ga0207665_10604369 3300025939 Bacteria 857
114 Ga0207667_10000025 3300025949 Bacteria 350159
115 Ga0207667_10026840 3300025949 Bacteria 6284
116 Ga0207698_10009580 3300026142 Bacteria 6185
117 Ga0209996_1000820 3300027395 Bacteria 3661
118 Ga0209995_1001611 3300027471 Bacteria 3502
119 Ga0209968_1002446 3300027526 Bacteria 2805
120 Ga0209970_1000203 3300027614 Bacteria 9442
121 Ga0209983_1000045 3300027665 Bacteria 17797
122 Ga0209282_1000002 3300027666 Bacteria 1067825
123 Ga0209971_1000557 3300027682 Bacteria 9744
124 Ga0209966_1000971 3300027695 Bacteria 5348
125 Ga0209998_10000460 3300027717 Bacteria 11281
126 Ga0268264_10398493 3300028381 Bacteria 1322
127 Ga0307513_10009051 3300031456 Bacteria 12629
128 Ga0307509_10518888 3300031507 Bacteria 873
129 Ga0307514_10000858 3300031649 Bacteria 48560
130 Ga0395900_0140268 3300037418 Bacteria 2475
131 Ga0395900_0150911 3300037418 Bacteria 2374
132 Ga0395901_0424154 3300038443 Bacteria 1363
133 Ga0436361_0062839 3300039447 Bacteria 58101
134 Ga0436361_0240489 3300039447 Bacteria 17218
135 Ga0450904_000071 3300042139 Bacteria 22967
136 Ga0439464_0003320 3300042439 Bacteria 4051
137 Ga0439460_0004749 3300042461 Bacteria 3315
138 Ga0451577_0179639 3300042876 Bacteria 1908
139 Ga0451577_0273551 3300042876 Bacteria 1530
140 Ga0466970_0007410 3300044765 Bacteria 5497
141 Ga0466957_0459443 3300044842 Bacteria 878
142 Ga0466959_0003015 3300045049 Bacteria 10879
143 Ga0451576_0489914 3300045051 Bacteria 1291
144 Ga0451576_1172676 3300045051 Bacteria 803
145 Ga0495617_000099 3300046452 Bacteria 62284
146 Ga0495617_002331 3300046452 Bacteria 7627
147 Ga0495627_012539 3300046453 Bacteria 3003
148 Ga0495629_0003492 3300046459 Bacteria 11889
149 Ga0495638_0002124 3300046460 Bacteria 16695
150 Ga0495638_0110726 3300046460 Bacteria 1631
151 Ga0495653_0032278 3300046463 Bacteria 4159
152 Ga0495582_0007532 3300046473 Bacteria 6021
153 Ga0495605_0011200 3300046474 Bacteria 5008
154 Ga0495605_0015104 3300046474 Bacteria 4210
155 Ga0495584_0000011 3300046491 Bacteria 208322
156 Ga0495584_0001797 3300046491 Bacteria 12472
157 Ga0495584_0003654 3300046491 Bacteria 8389
158 Ga0495585_0000078 3300046492 Bacteria 100168
159 Ga0495585_0000379 3300046492 Bacteria 42623
160 Ga0495585_0001869 3300046492 Bacteria 15892
161 Ga0495585_0005204 3300046492 Bacteria 8243
162 Ga0495585_0011231 3300046492 Bacteria 5305
163 Ga0495585_0022031 3300046492 Bacteria 3657
164 Ga0495585_0051564 3300046492 Bacteria 2279
165 Ga0495585_0059904 3300046492 Bacteria 2096
166 Ga0495585_0086974 3300046492 Bacteria 1687
167 Ga0495585_0113452 3300046492 Bacteria 1439
168 Ga0495585_0142666 3300046492 Bacteria 1253
169 Ga0495585_0152600 3300046492 Bacteria 1203
170 Ga0495585_0165458 3300046492 Bacteria 1145
171 Ga0495594_0254866 3300046499 Bacteria 999
172 Ga0495596_0000101 3300046500 Bacteria 60820
173 Ga0495596_0001565 3300046500 Bacteria 13035
174 Ga0495596_0024461 3300046500 Bacteria 2444
175 Ga0495607_0002672 3300046501 Bacteria 14254
176 Ga0495607_0065602 3300046501 Bacteria 2046
177 Ga0495607_0098672 3300046501 Bacteria 1568
178 Ga0495607_0113701 3300046501 Bacteria 1431
179 Ga0495607_0222125 3300046501 Bacteria 923
180 Ga0495583_0000004 3300046506 Bacteria 655287
181 Ga0495583_0000193 3300046506 Bacteria 101909
182 Ga0495583_0000430 3300046506 Bacteria 63194
183 Ga0495583_0000801 3300046506 Bacteria 38811
184 Ga0495583_0005833 3300046506 Bacteria 8222
185 Ga0495583_0127552 3300046506 Bacteria 1066
186 Ga0495583_0188901 3300046506 Bacteria 841
187 Ga0495606_0000007 3300046507 Bacteria 323713
188 Ga0495606_0002401 3300046507 Bacteria 21883
189 Ga0495606_0005464 3300046507 Bacteria 12166
190 Ga0495606_0016550 3300046507 Bacteria 5615
191 Ga0495606_0052266 3300046507 Bacteria 2658
192 Ga0495610_0030838 3300046512 Bacteria 2803
193 Ga0495616_0000103 3300046513 Bacteria 73155
194 Ga0495616_0000268 3300046513 Bacteria 42201
195 Ga0495616_0090789 3300046513 Bacteria 1446
196 Ga0495616_0152949 3300046513 Bacteria 1042
197 Ga0495620_0000960 3300046515 Bacteria 17763
198 Ga0495630_0100714 3300046517 Bacteria 2185
199 Ga0495631_0006824 3300046518 Bacteria 5859
200 Ga0495631_0019083 3300046518 Bacteria 3219
201 Ga0495631_0131267 3300046518 Bacteria 1076
202 Ga0495632_0062838 3300046519 Bacteria 1799
203 Ga0495637_0033733 3300046520 Bacteria 2246
204 Ga0495637_0039841 3300046520 Bacteria 2025
205 Ga0495643_0000192 3300046522 Bacteria 96511
206 Ga0495643_0023102 3300046522 Bacteria 3538
207 Ga0495643_0061343 3300046522 Bacteria 1994
208 Ga0495643_0095334 3300046522 Bacteria 1530
209 Ga0495643_0138781 3300046522 Bacteria 1214
210 Ga0495644_0001032 3300046523 Bacteria 11593
211 Ga0495644_0004002 3300046523 Bacteria 5796
212 Ga0495644_0031655 3300046523 Bacteria 1999
213 Ga0495644_0036492 3300046523 Bacteria 1854
214 Ga0495644_0087121 3300046523 Bacteria 1177
215 Ga0495644_0119620 3300046523 Bacteria 1001
216 Ga0495648_0000155 3300046524 Bacteria 81384
217 Ga0495648_0012027 3300046524 Bacteria 6484
218 Ga0495648_0012412 3300046524 Bacteria 6360
219 Ga0495648_0140119 3300046524 Bacteria 1274
220 Ga0495648_0161113 3300046524 Bacteria 1160
221 Ga0495663_0009236 3300046525 Bacteria 2735
222 Ga0495663_0099892 3300046525 Bacteria 954
223 Ga0495666_0112760 3300046526 Bacteria 1276
224 Ga0495642_0000799 3300046528 Bacteria 15291
225 Ga0495642_0001346 3300046528 Bacteria 11005
226 Ga0495642_0011091 3300046528 Bacteria 3456
227 Ga0495642_0074830 3300046528 Bacteria 1420
228 Ga0495642_0129942 3300046528 Bacteria 1084
229 Ga0495642_0162563 3300046528 Bacteria 968
230 Ga0495652_0069160 3300046529 Bacteria 2956
231 Ga0495654_0001375 3300046530 Bacteria 16863
232 Ga0495586_0142952 3300046535 Bacteria 1343
233 Ga0495586_0269334 3300046535 Bacteria 973
234 Ga0495609_0003205 3300046538 Bacteria 9498
235 Ga0495609_0010539 3300046538 Bacteria 4432
236 Ga0495609_0022122 3300046538 Bacteria 2930
237 Ga0495609_0065165 3300046538 Bacteria 1606
238 Ga0495609_0136568 3300046538 Bacteria 1048
239 Ga0495621_0000356 3300046539 Bacteria 11142
240 Ga0495597_0002644 3300046542 Bacteria 11109
241 Ga0495597_0022390 3300046542 Bacteria 2931
242 Ga0495597_0042478 3300046542 Bacteria 2027
243 Ga0495622_0000032 3300046557 Bacteria 125538
244 Ga0495622_0020539 3300046557 Bacteria 3075
245 Ga0495622_0093737 3300046557 Bacteria 1378
246 Ga0495622_0166392 3300046557 Bacteria 993
247 Ga0495633_0008342 3300046558 Bacteria 5849
248 Ga0495633_0019124 3300046558 Bacteria 3466
249 Ga0495633_0026409 3300046558 Bacteria 2850
250 Ga0495633_0055813 3300046558 Bacteria 1856
251 Ga0495633_0138553 3300046558 Bacteria 1125
252 Ga0495633_0168889 3300046558 Bacteria 1008
253 Ga0495633_0178202 3300046558 Bacteria 978
254 Ga0495656_0039323 3300046615 Bacteria 1964
255 Ga0495656_0055946 3300046615 Bacteria 1703
256 Ga0495668_0000008 3300046616 Bacteria 498364
257 Ga0495668_0003742 3300046616 Bacteria 11163
258 Ga0495668_0019598 3300046616 Bacteria 3897
259 Ga0495668_0239654 3300046616 Bacteria 993
260 Ga0495634_0029776 3300046642 Bacteria 3778
261 Ga0495611_0001444 3300046648 Bacteria 11809
262 Ga0495611_0008184 3300046648 Bacteria 4436
263 Ga0495611_0025758 3300046648 Bacteria 2565
264 Ga0495611_0088200 3300046648 Bacteria 1432
265 Ga0495611_0108454 3300046648 Bacteria 1291
266 Ga0495611_0149057 3300046648 Bacteria 1092
267 Ga0495625_0000473 3300046660 Bacteria 60605
268 Ga0495625_0006078 3300046660 Bacteria 10833
269 Ga0495625_0029345 3300046660 Bacteria 4115
270 Ga0495625_0052693 3300046660 Bacteria 2912
271 Ga0495625_0100811 3300046660 Bacteria 1984
272 Ga0495635_0152040 3300046663 Bacteria 1576
273 Ga0495659_0018818 3300046664 Bacteria 2305
274 Ga0495659_0055342 3300046664 Bacteria 1454
275 Ga0495661_0006974 3300046665 Bacteria 7898
276 Ga0495661_0022920 3300046665 Bacteria 4058
277 Ga0495661_0044959 3300046665 Bacteria 2703
278 Ga0495661_0069974 3300046665 Bacteria 2055
279 Ga0495661_0121326 3300046665 Bacteria 1444
280 Ga0495588_0073291 3300046674 Bacteria 1782
281 Ga0495623_0068908 3300046679 Bacteria 2205
282 Ga0495669_0000615 3300046684 Bacteria 15534
283 Ga0495624_0101626 3300046690 Bacteria 1770
284 Ga0495670_0004457 3300046691 Bacteria 6872
285 Ga0495670_0030478 3300046691 Bacteria 2679
286 Ga0495670_0037755 3300046691 Bacteria 2408
287 Ga0495670_0068891 3300046691 Bacteria 1788
288 Ga0495670_0072175 3300046691 Bacteria 1748
289 Ga0495670_0121006 3300046691 Bacteria 1359
290 Ga0495670_0280280 3300046691 Bacteria 891
291 Ga0495671_0014984 3300046692 Bacteria 4165
292 Ga0495671_0021738 3300046692 Bacteria 3366
293 Ga0495649_0090263 3300046694 Bacteria 1634
294 Ga0495649_0187397 3300046694 Bacteria 1078
295 Ga0495589_0025377 3300046794 Bacteria 3008
296 Ga0495589_0104296 3300046794 Bacteria 1370
297 Ga0495660_0020891 3300046810 Bacteria 3753
298 Ga0495581_0033960 3300047315 Bacteria 2952
299 Ga0495581_0177429 3300047315 Bacteria 1245
300 Ga0495604_0001907 3300047317 Bacteria 16899
301 Ga0495636_0023755 3300047318 Bacteria 2483
302 Ga0495636_0032120 3300047318 Bacteria 2153
303 Ga0495636_0035724 3300047318 Bacteria 2047
304 Ga0495636_0128679 3300047318 Bacteria 1125
305 Ga0495636_0142012 3300047318 Bacteria 1073
306 Ga0495674_0137955 3300047319 Bacteria 2051
307 Ga0495672_0016602 3300047320 Bacteria 4954
308 Ga0495672_0030193 3300047320 Bacteria 3404
309 Ga0495676_0027153 3300047321 Bacteria 4914
310 Ga0495676_0248695 3300047321 Bacteria 1214
311 Ga0495683_0005838 3300047323 Bacteria 6771
312 Ga0495683_0015667 3300047323 Bacteria 3939
313 Ga0495683_0033030 3300047323 Bacteria 2635
314 Ga0495683_0049217 3300047323 Bacteria 2111
315 Ga0495683_0082622 3300047323 Bacteria 1565
316 Ga0495683_0082762 3300047323 Bacteria 1563
317 Ga0495687_024827 3300047443 Bacteria 2843
318 Ga0495675_0009752 3300047444 Bacteria 5988
319 Ga0495675_0291749 3300047444 Bacteria 970
320 Ga0495677_0008212 3300047445 Bacteria 3879
321 Ga0495677_0008355 3300047445 Bacteria 3848
322 Ga0495677_0014949 3300047445 Bacteria 2822
323 Ga0495677_0029699 3300047445 Bacteria 1988
324 Ga0495677_0033460 3300047445 Bacteria 1874
325 Ga0495677_0037939 3300047445 Bacteria 1760
326 Ga0495685_000696 3300047447 Bacteria 10278
327 Ga0495685_028447 3300047447 Bacteria 1922
328 Ga0495685_086961 3300047447 Bacteria 1037
329 Ga0495673_0037369 3300047469 Bacteria 2217
330 Ga0495681_0033329 3300047470 Bacteria 2581
331 Ga0495681_0075557 3300047470 Bacteria 1516
332 Ga0495681_0076811 3300047470 Bacteria 1500
333 Ga0495686_0000740 3300047472 Bacteria 43603
334 Ga0495686_0082757 3300047472 Bacteria 1958
335 Ga0495686_0110941 3300047472 Bacteria 1645
336 Ga0495686_0159975 3300047472 Bacteria 1316
337 Ga0495686_0312868 3300047472 Bacteria 863
338 Ga0495593_0005932 3300047673 Bacteria 7196
339 Ga0495593_0035966 3300047673 Bacteria 2686
340 Ga0495615_0023219 3300048090 Bacteria 1419
341 Ga0495626_0002918 3300048091 Bacteria 11392
342 Ga0495626_0007825 3300048091 Bacteria 5920
343 Ga0495626_0009747 3300048091 Bacteria 5176
344 Ga0495626_0097153 3300048091 Bacteria 1288
345 Ga0496101_0052201 3300048904 Bacteria 2948
346 Ga0496102_0000253 3300048905 Bacteria 69634
347 Ga0496102_0080774 3300048905 Bacteria 2996
348 Ga0496103_0012952 3300048906 Bacteria 4947
349 Ga0496103_0015094 3300048906 Bacteria 4591
350 Ga0496103_0142004 3300048906 Bacteria 1536
351 Ga0496104_0346135 3300048907 Bacteria 1399
352 Ga0496104_0416781 3300048907 Bacteria 1255
353 Ga0496105_0667820 3300048908 Bacteria 800
354 Ga0496106_0342831 3300048909 Bacteria 1200
355 Ga0496108_0192738 3300048911 Bacteria 1767
356 Ga0496110_0025496 3300048913 Bacteria 5053
357 Ga0496110_0111531 3300048913 Bacteria 2458
358 Ga0496111_0017436 3300048914 Bacteria 4965
359 Ga0496114_0097566 3300048917 Bacteria 2504
360 Ga0496115_0001802 3300048918 Bacteria 15343
361 Ga0496115_0483435 3300048918 Bacteria 997
362 Ga0496116_0022030 3300048919 Bacteria 4791
363 Ga0496118_0122349 3300048921 Bacteria 1693
364 Ga0496118_0229126 3300048921 Bacteria 1074
365 Ga0496121_0017456 3300048924 Bacteria 7332
366 Ga0496122_0000449 3300048925 Bacteria 85961
367 Ga0496122_0001512 3300048925 Bacteria 37063
368 Ga0496123_0000263 3300048926 Bacteria 105886
369 Ga0496123_0001219 3300048926 Bacteria 37517
370 Ga0496123_0073114 3300048926 Bacteria 2129
371 Ga0496124_0010320 3300048927 Bacteria 9477
372 Ga0496125_0001541 3300048928 Bacteria 32972
373 Ga0496125_0030365 3300048928 Bacteria 4836
374 Ga0495678_028990 3300049459 Bacteria 2329
375 Ga0495682_0000197 3300049460 Bacteria 48575
376 Ga0495682_0000369 3300049460 Bacteria 32675
377 Ga0495682_0011252 3300049460 Bacteria 3444
378 Ga0495682_0110718 3300049460 Bacteria 984
379 Ga0495682_0136788 3300049460 Bacteria 875
380 Ga0501033_0249260 3300049570 Bacteria 1259
381 Ga0501034_0541582 3300049571 Bacteria 1074
382 Ga0501037_0033437 3300049573 Bacteria 3798
383 Ga0501042_0263612 3300049578 Bacteria 1244
384 Ga0501047_0028927 3300049581 Bacteria 5345
385 Ga0501069_0000120 3300049585 Bacteria 34758
386 Ga0501069_0009605 3300049585 Bacteria 5108
387 Ga0501073_0019407 3300049589 Bacteria 4909
388 Ga0501074_0326990 3300049590 Bacteria 1088
389 Ga0501075_0047809 3300049591 Bacteria 3215
390 Ga0501075_0301169 3300049591 Bacteria 1222
391 Ga0501238_005625 3300049671 Bacteria 1595
392 Ga0501079_0088752 3300049741 Bacteria 2394
393 Ga0501080_0395686 3300049742 Bacteria 1243
394 Ga0501035_0061211 3300049822 Bacteria 3351
395 Ga0501035_0160872 3300049822 Bacteria 1943
396 Ga0501044_0061946 3300049823 Bacteria 3826
397 nmdc:mga05p37_398728_c1 3300050507 Bacteria 1607
398 nmdc:mga05p37_6716_c1 3300050507 Bacteria 13561
399 nmdc:mga09592_10197_c1 3300050508 Bacteria 7647
400 nmdc:mga0qj67_409124_c1 3300050509 Bacteria 1094
401 nmdc:mga06r32_1957_c1 3300050510 Bacteria 18373
402 nmdc:mga0n895_189522_c1 3300050512 Bacteria 2088
403 nmdc:mga0rr50_630627_c1 3300050513 Bacteria 914
404 nmdc:mga0rr50_96904_c1 3300050513 Bacteria 2309
405 nmdc:mga08x19_135870_c1 3300050514 Bacteria 1658
406 nmdc:mga08x19_93203_c1 3300050514 Bacteria 1991
407 nmdc:mga0a205_21051_c1 3300050515 Bacteria 6166
408 Ga0500618_000376 3300053125 Bacteria 30780
409 Ga0500618_007062 3300053125 Bacteria 3236
410 Ga0500618_010325 3300053125 Bacteria 2509
411 Ga0587082_018112 3300059504 Bacteria 1117
412 Ga0587111_0022659 3300060346 Bacteria 1222
413 Ga0501082_0189319 3300060353 Bacteria 1790
414 Ga0530510_0179010 3300061734 Bacteria 1572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0138781 Ga0495643_0138781_110_778 207
2 3300048927 Ga0496124_0010320 Ga0496124_0010320_1691_2371 207
3 3300005340 Ga0070689_100971273 Ga0070689_1009712731 208
4 3300005467 Ga0070706_100143706 Ga0070706_1001437062 209
5 3300005468 Ga0070707_100216591 Ga0070707_1002165912 209
6 3300006846 Ga0075430_100114872 Ga0075430_1001148722 210
7 3300050509 nmdc:mga0qj67_409124_c1 nmdc:mga0qj67_409124_c1_15_653 210
8 3300046660 Ga0495625_0100811 Ga0495625_0100811_721_1392 212
9 iso_pu_bacteria 2842733646 2842735720 216
10 iso_pu_bacteria 2842747753 2842750881 217
11 iso_pu_bacteria 2521172590 2521557811 218
12 iso_pu_bacteria 2551306416 2553002931 218
13 iso_pu_bacteria 2765235838 2765568924 218
14 iso_pu_bacteria 2808606386 2808984556 218
15 iso_pu_bacteria 2808606415 2809128113 218
16 iso_pu_bacteria 2808606419 2809151850 218
17 iso_pu_bacteria 2818991449 2819615047 218
18 iso_pu_bacteria 2839094727 2839096194 218
19 iso_pu_bacteria 2852618963 2852619934 218
20 iso_pu_bacteria 2904439833 2904441428 218
21 iso_pu_bacteria 2904530477 2904531634 218
22 iso_pu_bacteria 2904584206 2904586726 218
23 iso_pu_bacteria 2904589729 2904593241 218
24 iso_pu_bacteria 2904601388 2904602915 218
25 iso_pu_bacteria 2919046199 2919046274 218
26 iso_pu_bacteria 2919079590 2919084064 218
27 iso_pu_bacteria 2923510766 2923511029 218
28 iso_pu_bacteria 2928130867 2928130981 218
29 iso_pu_bacteria 2511231026 2511388070 219
30 iso_pu_bacteria 2739367655 2739610572 219
31 3300006058 Ga0075432_10048015 Ga0075432_100480152 220
32 3300015261 Ga0182006_1020047 Ga0182006_10200471 220
33 3300025923 Ga0207681_10033486 Ga0207681_100334864 220
34 3300025939 Ga0207665_10604369 Ga0207665_106043691 220
35 3300044765 Ga0466970_0007410 Ga0466970_0007410_932_1594 220
36 3300045049 Ga0466959_0003015 Ga0466959_0003015_6009_6671 220
37 3300048921 Ga0496118_0122349 Ga0496118_0122349_349_1011 220
38 3300048925 Ga0496122_0000449 Ga0496122_0000449_34874_35536 220
39 3300048926 Ga0496123_0000263 Ga0496123_0000263_70296_70958 220
40 3300053125 Ga0500618_010325 Ga0500618_010325_1114_1776 220
41 3300031507 Ga0307509_10518888 Ga0307509_105188881 221
42 3300046459 Ga0495629_0003492 Ga0495629_0003492_5154_5819 221
43 3300046463 Ga0495653_0032278 Ga0495653_0032278_2914_3579 221
44 3300046473 Ga0495582_0007532 Ga0495582_0007532_4772_5437 221
45 3300046517 Ga0495630_0100714 Ga0495630_0100714_38_703 221
46 3300046526 Ga0495666_0112760 Ga0495666_0112760_346_1011 221
47 3300046528 Ga0495642_0001346 Ga0495642_0001346_2612_3277 221
48 3300046529 Ga0495652_0069160 Ga0495652_0069160_329_994 221
49 3300046535 Ga0495586_0142952 Ga0495586_0142952_168_833 221
50 3300046557 Ga0495622_0020539 Ga0495622_0020539_1753_2418 221
51 3300046642 Ga0495634_0029776 Ga0495634_0029776_1953_2618 221
52 3300046660 Ga0495625_0006078 Ga0495625_0006078_10104_10769 221
53 3300046665 Ga0495661_0006974 Ga0495661_0006974_7115_7780 221
54 3300046679 Ga0495623_0068908 Ga0495623_0068908_1123_1788 221
55 3300046690 Ga0495624_0101626 Ga0495624_0101626_841_1506 221
56 3300047315 Ga0495581_0177429 Ga0495581_0177429_315_980 221
57 3300047317 Ga0495604_0001907 Ga0495604_0001907_3467_4132 221
58 3300047319 Ga0495674_0137955 Ga0495674_0137955_185_850 221
59 3300047321 Ga0495676_0248695 Ga0495676_0248695_36_701 221
60 3300047323 Ga0495683_0082622 Ga0495683_0082622_870_1535 221
61 3300047444 Ga0495675_0291749 Ga0495675_0291749_266_931 221
62 3300047445 Ga0495677_0033460 Ga0495677_0033460_325_990 221
63 3300047673 Ga0495593_0035966 Ga0495593_0035966_1610_2275 221
64 3300048918 Ga0496115_0001802 Ga0496115_0001802_9615_10280 221
65 3300048918 Ga0496115_0483435 Ga0496115_0483435_270_935 221
66 3300049570 Ga0501033_0249260 Ga0501033_0249260_47_712 221
67 3300049571 Ga0501034_0541582 Ga0501034_0541582_329_994 221
68 3300049573 Ga0501037_0033437 Ga0501037_0033437_1011_1676 221
69 3300049581 Ga0501047_0028927 Ga0501047_0028927_4521_5186 221
70 3300049585 Ga0501069_0009605 Ga0501069_0009605_161_826 221
71 3300049589 Ga0501073_0019407 Ga0501073_0019407_1471_2136 221
72 3300049590 Ga0501074_0326990 Ga0501074_0326990_356_1021 221
73 3300049742 Ga0501080_0395686 Ga0501080_0395686_68_733 221
74 3300049822 Ga0501035_0061211 Ga0501035_0061211_280_945 221
75 3300049823 Ga0501044_0061946 Ga0501044_0061946_760_1425 221
76 iso_pu_bacteria 2548876994 2550693656 221
77 iso_pu_bacteria 2818991445 2819592108 221
78 iso_pu_bacteria 2884811622 2884815105 221
79 iso_pu_bacteria 2884836552 2884840473 221
80 iso_pu_bacteria 2884852848 2884855730 221
81 iso_pu_bacteria 2896154374 2896157345 221
82 3300002987 JGI25159J45721_1001130 JGI25159J45721_10011304 222
83 3300003771 Ga0055526_1000551 Ga0055526_100055120 222
84 3300003773 Ga0055537_1000144 Ga0055537_100014433 222
85 3300003775 Ga0055524_1001058 Ga0055524_100105819 222
86 3300003784 Ga0055534_1000072 Ga0055534_100007241 222
87 3300004625 Ga0055543_1006392 Ga0055543_10063924 222
88 3300005262 Ga0065165_1000187 Ga0065165_100018742 222
89 3300005563 Ga0068855_100000065 Ga0068855_10000006529 222
90 3300005563 Ga0068855_100200455 Ga0068855_1002004553 222
91 3300009545 Ga0105237_10001959 Ga0105237_1000195919 222
92 3300009551 Ga0105238_10253471 Ga0105238_102534712 222
93 3300013102 Ga0157371_10000001 Ga0157371_10000001969 222
94 3300013307 Ga0157372_10683434 Ga0157372_106834342 222
95 3300021361 Ga0213872_10002525 Ga0213872_100025259 222
96 3300025208 Ga0209436_122600 Ga0209436_1226001 222
97 3300025263 Ga0209565_1000006 Ga0209565_1000006420 222
98 3300025273 Ga0209673_1000004 Ga0209673_1000004409 222
99 3300025284 Ga0209130_1000191 Ga0209130_100019111 222
100 3300025291 Ga0209675_1000006 Ga0209675_1000006419 222
101 3300025295 Ga0209564_1000085 Ga0209564_1000085144 222
102 3300025299 Ga0209256_1000037 Ga0209256_1000037253 222
103 3300025913 Ga0207695_10482755 Ga0207695_104827552 222
104 3300025914 Ga0207671_10111343 Ga0207671_101113432 222
105 3300025924 Ga0207694_10175030 Ga0207694_101750302 222
106 3300025949 Ga0207667_10000025 Ga0207667_1000002570 222
107 3300025949 Ga0207667_10026840 Ga0207667_100268403 222
108 3300037418 Ga0395900_0140268 Ga0395900_0140268_939_1607 222
109 3300038443 Ga0395901_0424154 Ga0395901_0424154_376_1044 222
110 3300039447 Ga0436361_0240489 Ga0436361_0240489_9166_9834 222
111 3300042139 Ga0450904_000071 Ga0450904_000071_4907_5575 222
112 3300046452 Ga0495617_000099 Ga0495617_000099_52947_53615 222
113 3300046452 Ga0495617_002331 Ga0495617_002331_5785_6453 222
114 3300046453 Ga0495627_012539 Ga0495627_012539_2257_2925 222
115 3300046460 Ga0495638_0002124 Ga0495638_0002124_11284_11952 222
116 3300046460 Ga0495638_0110726 Ga0495638_0110726_407_1075 222
117 3300046474 Ga0495605_0011200 Ga0495605_0011200_1169_1837 222
118 3300046474 Ga0495605_0015104 Ga0495605_0015104_616_1284 222
119 3300046491 Ga0495584_0000011 Ga0495584_0000011_69677_70345 222
120 3300046491 Ga0495584_0001797 Ga0495584_0001797_7676_8344 222
121 3300046491 Ga0495584_0003654 Ga0495584_0003654_950_1618 222
122 3300046492 Ga0495585_0000379 Ga0495585_0000379_6153_6821 222
123 3300046492 Ga0495585_0001869 Ga0495585_0001869_9538_10206 222
124 3300046492 Ga0495585_0005204 Ga0495585_0005204_867_1535 222
125 3300046492 Ga0495585_0011231 Ga0495585_0011231_3663_4331 222
126 3300046492 Ga0495585_0022031 Ga0495585_0022031_2769_3437 222
127 3300046492 Ga0495585_0051564 Ga0495585_0051564_136_804 222
128 3300046492 Ga0495585_0059904 Ga0495585_0059904_719_1387 222
129 3300046492 Ga0495585_0086974 Ga0495585_0086974_140_808 222
130 3300046492 Ga0495585_0113452 Ga0495585_0113452_704_1372 222
131 3300046492 Ga0495585_0142666 Ga0495585_0142666_457_1125 222
132 3300046492 Ga0495585_0165458 Ga0495585_0165458_430_1098 222
133 3300046499 Ga0495594_0254866 Ga0495594_0254866_279_953 222
134 3300046500 Ga0495596_0000101 Ga0495596_0000101_34441_35109 222
135 3300046500 Ga0495596_0001565 Ga0495596_0001565_2358_3026 222
136 3300046500 Ga0495596_0024461 Ga0495596_0024461_1483_2151 222
137 3300046501 Ga0495607_0002672 Ga0495607_0002672_3304_3972 222
138 3300046501 Ga0495607_0065602 Ga0495607_0065602_146_814 222
139 3300046501 Ga0495607_0098672 Ga0495607_0098672_618_1340 222
140 3300046501 Ga0495607_0113701 Ga0495607_0113701_39_707 222
141 3300046501 Ga0495607_0222125 Ga0495607_0222125_63_731 222
142 3300046506 Ga0495583_0000004 Ga0495583_0000004_232899_233567 222
143 3300046506 Ga0495583_0000193 Ga0495583_0000193_69516_70184 222
144 3300046506 Ga0495583_0000430 Ga0495583_0000430_62071_62739 222
145 3300046506 Ga0495583_0000801 Ga0495583_0000801_22642_23310 222
146 3300046506 Ga0495583_0005833 Ga0495583_0005833_1023_1691 222
147 3300046506 Ga0495583_0188901 Ga0495583_0188901_163_831 222
148 3300046507 Ga0495606_0002401 Ga0495606_0002401_18761_19429 222
149 3300046507 Ga0495606_0005464 Ga0495606_0005464_8018_8686 222
150 3300046507 Ga0495606_0016550 Ga0495606_0016550_4228_4896 222
151 3300046507 Ga0495606_0052266 Ga0495606_0052266_426_1094 222
152 3300046512 Ga0495610_0030838 Ga0495610_0030838_103_771 222
153 3300046513 Ga0495616_0000103 Ga0495616_0000103_34593_35261 222
154 3300046513 Ga0495616_0000268 Ga0495616_0000268_18599_19267 222
155 3300046513 Ga0495616_0090789 Ga0495616_0090789_629_1297 222
156 3300046513 Ga0495616_0152949 Ga0495616_0152949_114_782 222
157 3300046518 Ga0495631_0006824 Ga0495631_0006824_2550_3218 222
158 3300046518 Ga0495631_0019083 Ga0495631_0019083_2485_3153 222
159 3300046518 Ga0495631_0131267 Ga0495631_0131267_253_921 222
160 3300046519 Ga0495632_0062838 Ga0495632_0062838_1008_1676 222
161 3300046520 Ga0495637_0039841 Ga0495637_0039841_907_1575 222
162 3300046522 Ga0495643_0000192 Ga0495643_0000192_47058_47726 222
163 3300046522 Ga0495643_0023102 Ga0495643_0023102_1374_2042 222
164 3300046522 Ga0495643_0061343 Ga0495643_0061343_1196_1864 222
165 3300046522 Ga0495643_0095334 Ga0495643_0095334_845_1513 222
166 3300046523 Ga0495644_0001032 Ga0495644_0001032_8059_8727 222
167 3300046523 Ga0495644_0004002 Ga0495644_0004002_2795_3463 222
168 3300046523 Ga0495644_0031655 Ga0495644_0031655_1032_1700 222
169 3300046523 Ga0495644_0036492 Ga0495644_0036492_464_1132 222
170 3300046523 Ga0495644_0087121 Ga0495644_0087121_116_784 222
171 3300046523 Ga0495644_0119620 Ga0495644_0119620_82_750 222
172 3300046524 Ga0495648_0000155 Ga0495648_0000155_38053_38721 222
173 3300046524 Ga0495648_0012027 Ga0495648_0012027_5007_5675 222
174 3300046524 Ga0495648_0012412 Ga0495648_0012412_193_861 222
175 3300046524 Ga0495648_0140119 Ga0495648_0140119_331_999 222
176 3300046524 Ga0495648_0161113 Ga0495648_0161113_154_822 222
177 3300046525 Ga0495663_0009236 Ga0495663_0009236_1151_1819 222
178 3300046525 Ga0495663_0099892 Ga0495663_0099892_37_705 222
179 3300046528 Ga0495642_0011091 Ga0495642_0011091_2309_2977 222
180 3300046528 Ga0495642_0129942 Ga0495642_0129942_171_839 222
181 3300046535 Ga0495586_0269334 Ga0495586_0269334_198_866 222
182 3300046538 Ga0495609_0003205 Ga0495609_0003205_2656_3324 222
183 3300046538 Ga0495609_0010539 Ga0495609_0010539_1206_1874 222
184 3300046538 Ga0495609_0022122 Ga0495609_0022122_1057_1725 222
185 3300046538 Ga0495609_0065165 Ga0495609_0065165_779_1447 222
186 3300046538 Ga0495609_0136568 Ga0495609_0136568_185_853 222
187 3300046542 Ga0495597_0002644 Ga0495597_0002644_7961_8629 222
188 3300046542 Ga0495597_0022390 Ga0495597_0022390_2146_2814 222
189 3300046542 Ga0495597_0042478 Ga0495597_0042478_453_1121 222
190 3300046557 Ga0495622_0000032 Ga0495622_0000032_72477_73145 222
191 3300046557 Ga0495622_0093737 Ga0495622_0093737_282_950 222
192 3300046557 Ga0495622_0166392 Ga0495622_0166392_31_699 222
193 3300046558 Ga0495633_0008342 Ga0495633_0008342_3253_3921 222
194 3300046558 Ga0495633_0019124 Ga0495633_0019124_2475_3143 222
195 3300046558 Ga0495633_0026409 Ga0495633_0026409_1615_2283 222
196 3300046558 Ga0495633_0055813 Ga0495633_0055813_393_1061 222
197 3300046558 Ga0495633_0138553 Ga0495633_0138553_356_1024 222
198 3300046558 Ga0495633_0168889 Ga0495633_0168889_201_869 222
199 3300046558 Ga0495633_0178202 Ga0495633_0178202_129_797 222
200 3300046615 Ga0495656_0039323 Ga0495656_0039323_1139_1861 222
201 3300046615 Ga0495656_0055946 Ga0495656_0055946_37_705 222
202 3300046616 Ga0495668_0000008 Ga0495668_0000008_100715_101383 222
203 3300046616 Ga0495668_0003742 Ga0495668_0003742_2321_2989 222
204 3300046616 Ga0495668_0019598 Ga0495668_0019598_1060_1728 222
205 3300046648 Ga0495611_0001444 Ga0495611_0001444_1179_1847 222
206 3300046648 Ga0495611_0008184 Ga0495611_0008184_1306_1974 222
207 3300046648 Ga0495611_0025758 Ga0495611_0025758_537_1205 222
208 3300046648 Ga0495611_0088200 Ga0495611_0088200_389_1057 222
209 3300046648 Ga0495611_0108454 Ga0495611_0108454_103_771 222
210 3300046660 Ga0495625_0029345 Ga0495625_0029345_229_897 222
211 3300046660 Ga0495625_0052693 Ga0495625_0052693_114_782 222
212 3300046663 Ga0495635_0152040 Ga0495635_0152040_737_1405 222
213 3300046664 Ga0495659_0018818 Ga0495659_0018818_1216_1884 222
214 3300046664 Ga0495659_0055342 Ga0495659_0055342_255_923 222
215 3300046665 Ga0495661_0044959 Ga0495661_0044959_1273_1941 222
216 3300046665 Ga0495661_0069974 Ga0495661_0069974_184_852 222
217 3300046665 Ga0495661_0121326 Ga0495661_0121326_279_947 222
218 3300046674 Ga0495588_0073291 Ga0495588_0073291_360_1028 222
219 3300046684 Ga0495669_0000615 Ga0495669_0000615_6693_7361 222
220 3300046691 Ga0495670_0004457 Ga0495670_0004457_1736_2404 222
221 3300046691 Ga0495670_0030478 Ga0495670_0030478_1518_2186 222
222 3300046691 Ga0495670_0037755 Ga0495670_0037755_1054_1722 222
223 3300046691 Ga0495670_0068891 Ga0495670_0068891_126_794 222
224 3300046691 Ga0495670_0072175 Ga0495670_0072175_178_846 222
225 3300046691 Ga0495670_0121006 Ga0495670_0121006_110_778 222
226 3300046691 Ga0495670_0280280 Ga0495670_0280280_202_870 222
227 3300046692 Ga0495671_0014984 Ga0495671_0014984_2317_2985 222
228 3300046692 Ga0495671_0021738 Ga0495671_0021738_1798_2466 222
229 3300046694 Ga0495649_0187397 Ga0495649_0187397_382_1050 222
230 3300046794 Ga0495589_0025377 Ga0495589_0025377_1828_2496 222
231 3300046794 Ga0495589_0104296 Ga0495589_0104296_556_1224 222
232 3300047315 Ga0495581_0033960 Ga0495581_0033960_379_1053 222
233 3300047318 Ga0495636_0023755 Ga0495636_0023755_123_791 222
234 3300047318 Ga0495636_0032120 Ga0495636_0032120_1296_1964 222
235 3300047318 Ga0495636_0035724 Ga0495636_0035724_929_1597 222
236 3300047318 Ga0495636_0128679 Ga0495636_0128679_289_957 222
237 3300047318 Ga0495636_0142012 Ga0495636_0142012_175_843 222
238 3300047320 Ga0495672_0016602 Ga0495672_0016602_3252_3920 222
239 3300047320 Ga0495672_0030193 Ga0495672_0030193_2001_2669 222
240 3300047321 Ga0495676_0027153 Ga0495676_0027153_3956_4624 222
241 3300047323 Ga0495683_0005838 Ga0495683_0005838_1363_2031 222
242 3300047323 Ga0495683_0015667 Ga0495683_0015667_1356_2024 222
243 3300047323 Ga0495683_0049217 Ga0495683_0049217_1109_1777 222
244 3300047323 Ga0495683_0082762 Ga0495683_0082762_360_1028 222
245 3300047444 Ga0495675_0009752 Ga0495675_0009752_58_726 222
246 3300047445 Ga0495677_0008212 Ga0495677_0008212_1400_2068 222
247 3300047445 Ga0495677_0008355 Ga0495677_0008355_1346_2014 222
248 3300047445 Ga0495677_0014949 Ga0495677_0014949_1107_1775 222
249 3300047445 Ga0495677_0029699 Ga0495677_0029699_268_936 222
250 3300047445 Ga0495677_0037939 Ga0495677_0037939_879_1547 222
251 3300047447 Ga0495685_000696 Ga0495685_000696_6747_7415 222
252 3300047447 Ga0495685_028447 Ga0495685_028447_1182_1850 222
253 3300047447 Ga0495685_086961 Ga0495685_086961_23_691 222
254 3300047469 Ga0495673_0037369 Ga0495673_0037369_650_1318 222
255 3300047470 Ga0495681_0075557 Ga0495681_0075557_542_1210 222
256 3300047470 Ga0495681_0076811 Ga0495681_0076811_66_734 222
257 3300047472 Ga0495686_0082757 Ga0495686_0082757_538_1206 222
258 3300047472 Ga0495686_0110941 Ga0495686_0110941_293_961 222
259 3300047472 Ga0495686_0312868 Ga0495686_0312868_79_747 222
260 3300047673 Ga0495593_0005932 Ga0495593_0005932_5184_5852 222
261 3300048091 Ga0495626_0007825 Ga0495626_0007825_674_1342 222
262 3300048091 Ga0495626_0009747 Ga0495626_0009747_3924_4592 222
263 3300048091 Ga0495626_0097153 Ga0495626_0097153_269_937 222
264 3300048905 Ga0496102_0000253 Ga0496102_0000253_4501_5169 222
265 3300048905 Ga0496102_0080774 Ga0496102_0080774_1454_2122 222
266 3300048906 Ga0496103_0012952 Ga0496103_0012952_1724_2392 222
267 3300048907 Ga0496104_0346135 Ga0496104_0346135_490_1158 222
268 3300048908 Ga0496105_0667820 Ga0496105_0667820_61_729 222
269 3300049459 Ga0495678_028990 Ga0495678_028990_1054_1722 222
270 3300049460 Ga0495682_0000197 Ga0495682_0000197_46792_47460 222
271 3300049460 Ga0495682_0000369 Ga0495682_0000369_5785_6453 222
272 3300049460 Ga0495682_0011252 Ga0495682_0011252_429_1097 222
273 3300049460 Ga0495682_0110718 Ga0495682_0110718_109_777 222
274 3300049460 Ga0495682_0136788 Ga0495682_0136788_153_821 222
275 3300053125 Ga0500618_000376 Ga0500618_000376_24531_25199 222
276 iso_pu_bacteria 2511231003 2511250128 222
277 3300003349 JGI26129J50193_1006685 JGI26129J50193_10066851 223
278 3300003577 Ga0007416J51690_1005421 Ga0007416J51690_10054213 223
279 3300003693 Ga0032354_1024932 Ga0032354_10249323 223
280 3300003751 Ga0055538_1000002 Ga0055538_1000002850 223
281 3300003752 Ga0055539_1000002 Ga0055539_1000002850 223
282 3300003756 Ga0055533_1000004 Ga0055533_1000004850 223
283 3300003759 Ga0055525_1000002 Ga0055525_1000002850 223
284 3300003841 Ga0055541_1000043 Ga0055541_100004364 223
285 3300003911 JGI25405J52794_10028229 JGI25405J52794_100282291 223
286 3300005341 Ga0070691_10033620 Ga0070691_100336203 223
287 3300005441 Ga0070700_100579549 Ga0070700_1005795491 223
288 3300005444 Ga0070694_100003620 Ga0070694_1000036203 223
289 3300005445 Ga0070708_100069199 Ga0070708_1000691992 223
290 3300005457 Ga0070662_100074119 Ga0070662_1000741193 223
291 3300005468 Ga0070707_100036559 Ga0070707_1000365594 223
292 3300005518 Ga0070699_100312984 Ga0070699_1003129841 223
293 3300005545 Ga0070695_100000850 Ga0070695_1000008504 223
294 3300005546 Ga0070696_100319498 Ga0070696_1003194981 223
295 3300005843 Ga0068860_100633699 Ga0068860_1006336991 223
296 3300005937 Ga0081455_10000772 Ga0081455_100007728 223
297 3300006028 Ga0070717_10163890 Ga0070717_101638903 223
298 3300006852 Ga0075433_10009036 Ga0075433_100090365 223
299 3300006871 Ga0075434_100038098 Ga0075434_1000380982 223
300 3300006914 Ga0075436_100030092 Ga0075436_1000300923 223
301 3300006946 Ga0079104_1008855 Ga0079104_10088555 223
302 3300006948 Ga0099826_10000003 Ga0099826_10000003658 223
303 3300007076 Ga0075435_100394492 Ga0075435_1003944922 223
304 3300009094 Ga0111539_10115138 Ga0111539_101151382 223
305 3300009147 Ga0114129_10058813 Ga0114129_100588135 223
306 3300013102 Ga0157371_10094454 Ga0157371_100944542 223
307 3300013306 Ga0163162_10154394 Ga0163162_101543942 223
308 3300015261 Ga0182006_1022364 Ga0182006_10223643 223
309 3300025224 Ga0209784_100002 Ga0209784_1000021070 223
310 3300025225 Ga0209566_100003 Ga0209566_1000031070 223
311 3300025226 Ga0209674_100004 Ga0209674_1000041070 223
312 3300025230 Ga0209563_100006 Ga0209563_1000061070 223
313 3300025253 Ga0209677_100003 Ga0209677_1000031070 223
314 3300025263 Ga0209565_1003538 Ga0209565_10035385 223
315 3300025272 Ga0209455_1000350 Ga0209455_100035021 223
316 3300025295 Ga0209564_1007682 Ga0209564_10076826 223
317 3300025299 Ga0209256_1000013 Ga0209256_1000013273 223
318 3300025906 Ga0207699_10324463 Ga0207699_103244632 223
319 3300025922 Ga0207646_10035734 Ga0207646_100357342 223
320 3300025939 Ga0207665_10164251 Ga0207665_101642512 223
321 3300027395 Ga0209996_1000820 Ga0209996_10008203 223
322 3300027471 Ga0209995_1001611 Ga0209995_10016113 223
323 3300027526 Ga0209968_1002446 Ga0209968_10024463 223
324 3300027614 Ga0209970_1000203 Ga0209970_10002035 223
325 3300027665 Ga0209983_1000045 Ga0209983_100004514 223
326 3300027666 Ga0209282_1000002 Ga0209282_1000002340 223
327 3300027682 Ga0209971_1000557 Ga0209971_10005576 223
328 3300027695 Ga0209966_1000971 Ga0209966_10009712 223
329 3300027717 Ga0209998_10000460 Ga0209998_100004606 223
330 3300028381 Ga0268264_10398493 Ga0268264_103984932 223
331 3300031456 Ga0307513_10009051 Ga0307513_100090515 223
332 3300031649 Ga0307514_10000858 Ga0307514_1000085842 223
333 3300042439 Ga0439464_0003320 Ga0439464_0003320_602_1273 223
334 3300042461 Ga0439460_0004749 Ga0439460_0004749_1462_2133 223
335 3300042876 Ga0451577_0179639 Ga0451577_0179639_1224_1895 223
336 3300042876 Ga0451577_0273551 Ga0451577_0273551_609_1280 223
337 3300044842 Ga0466957_0459443 Ga0466957_0459443_17_688 223
338 3300045051 Ga0451576_0489914 Ga0451576_0489914_419_1090 223
339 3300045051 Ga0451576_1172676 Ga0451576_1172676_60_731 223
340 3300046492 Ga0495585_0000078 Ga0495585_0000078_61194_61865 223
341 3300046492 Ga0495585_0152600 Ga0495585_0152600_192_863 223
342 3300046506 Ga0495583_0127552 Ga0495583_0127552_70_741 223
343 3300046507 Ga0495606_0000007 Ga0495606_0000007_248096_248773 223
344 3300046515 Ga0495620_0000960 Ga0495620_0000960_798_1469 223
345 3300046520 Ga0495637_0033733 Ga0495637_0033733_1544_2215 223
346 3300046528 Ga0495642_0000799 Ga0495642_0000799_2034_2705 223
347 3300046528 Ga0495642_0074830 Ga0495642_0074830_722_1393 223
348 3300046528 Ga0495642_0162563 Ga0495642_0162563_173_910 223
349 3300046530 Ga0495654_0001375 Ga0495654_0001375_2682_3377 223
350 3300046539 Ga0495621_0000356 Ga0495621_0000356_4296_4967 223
351 3300046616 Ga0495668_0239654 Ga0495668_0239654_33_704 223
352 3300046648 Ga0495611_0149057 Ga0495611_0149057_214_885 223
353 3300046665 Ga0495661_0022920 Ga0495661_0022920_80_817 223
354 3300046694 Ga0495649_0090263 Ga0495649_0090263_357_1028 223
355 3300046810 Ga0495660_0020891 Ga0495660_0020891_201_872 223
356 3300047323 Ga0495683_0033030 Ga0495683_0033030_65_736 223
357 3300047443 Ga0495687_024827 Ga0495687_024827_2121_2792 223
358 3300047470 Ga0495681_0033329 Ga0495681_0033329_642_1313 223
359 3300047472 Ga0495686_0000740 Ga0495686_0000740_17218_17889 223
360 3300047472 Ga0495686_0159975 Ga0495686_0159975_550_1221 223
361 3300048090 Ga0495615_0023219 Ga0495615_0023219_737_1408 223
362 3300048091 Ga0495626_0002918 Ga0495626_0002918_10701_11372 223
363 3300048904 Ga0496101_0052201 Ga0496101_0052201_859_1530 223
364 3300048906 Ga0496103_0015094 Ga0496103_0015094_2129_2809 223
365 3300048906 Ga0496103_0142004 Ga0496103_0142004_280_951 223
366 3300048907 Ga0496104_0416781 Ga0496104_0416781_47_718 223
367 3300048909 Ga0496106_0342831 Ga0496106_0342831_12_683 223
368 3300048911 Ga0496108_0192738 Ga0496108_0192738_135_806 223
369 3300048913 Ga0496110_0025496 Ga0496110_0025496_4163_4834 223
370 3300048913 Ga0496110_0111531 Ga0496110_0111531_147_818 223
371 3300048914 Ga0496111_0017436 Ga0496111_0017436_166_837 223
372 3300048917 Ga0496114_0097566 Ga0496114_0097566_1317_1988 223
373 3300048926 Ga0496123_0073114 Ga0496123_0073114_600_1334 223
374 3300049578 Ga0501042_0263612 Ga0501042_0263612_78_752 223
375 3300049585 Ga0501069_0000120 Ga0501069_0000120_18977_19648 223
376 3300049671 Ga0501238_005625 Ga0501238_005625_727_1398 223
377 3300049822 Ga0501035_0160872 Ga0501035_0160872_1252_1923 223
378 3300050507 nmdc:mga05p37_398728_c1 nmdc:mga05p37_398728_c1_750_1421 223
379 3300050512 nmdc:mga0n895_189522_c1 nmdc:mga0n895_189522_c1_1322_1993 223
380 3300050513 nmdc:mga0rr50_630627_c1 nmdc:mga0rr50_630627_c1_13_687 223
381 3300050513 nmdc:mga0rr50_96904_c1 nmdc:mga0rr50_96904_c1_1316_1987 223
382 3300050514 nmdc:mga08x19_135870_c1 nmdc:mga08x19_135870_c1_323_994 223
383 3300050514 nmdc:mga08x19_93203_c1 nmdc:mga08x19_93203_c1_865_1536 223
384 3300050515 nmdc:mga0a205_21051_c1 nmdc:mga0a205_21051_c1_4046_4717 223
385 3300053125 Ga0500618_007062 Ga0500618_007062_728_1477 223
386 3300059504 Ga0587082_018112 Ga0587082_018112_88_759 223
387 3300060346 Ga0587111_0022659 Ga0587111_0022659_369_1040 223
388 3300006846 Ga0075430_100000248 Ga0075430_10000024834 224
389 3300006847 Ga0075431_100001170 Ga0075431_10000117010 224
390 3300006880 Ga0075429_100000001 Ga0075429_10000000120 224
391 3300009147 Ga0114129_10042384 Ga0114129_100423846 224
392 3300021361 Ga0213872_10000494 Ga0213872_1000049423 224
393 3300037418 Ga0395900_0150911 Ga0395900_0150911_102_776 224
394 3300039447 Ga0436361_0062839 Ga0436361_0062839_31445_32119 224
395 3300048921 Ga0496118_0229126 Ga0496118_0229126_191_973 224
396 3300049591 Ga0501075_0047809 Ga0501075_0047809_1666_2352 224
397 3300049591 Ga0501075_0301169 Ga0501075_0301169_287_979 224
398 3300049741 Ga0501079_0088752 Ga0501079_0088752_884_1570 224
399 3300050507 nmdc:mga05p37_6716_c1 nmdc:mga05p37_6716_c1_5784_6479 224
400 3300050508 nmdc:mga09592_10197_c1 nmdc:mga09592_10197_c1_3333_4028 224
401 3300050510 nmdc:mga06r32_1957_c1 nmdc:mga06r32_1957_c1_8903_9598 224
402 3300060353 Ga0501082_0189319 Ga0501082_0189319_406_1092 224
403 3300061734 Ga0530510_0179010 Ga0530510_0179010_390_1076 224
404 3300002704 JGI25155J39150_1000499 JGI25155J39150_10004995 225
405 3300002704 JGI25155J39150_1000613 JGI25155J39150_10006134 225
406 3300002705 JGI25156J39149_1000099 JGI25156J39149_10000995 225
407 3300002705 JGI25156J39149_1004652 JGI25156J39149_10046523 225
408 3300002738 JGI25154J39366_1000119 JGI25154J39366_100011957 225
409 3300002738 JGI25154J39366_1000400 JGI25154J39366_10004004 225
410 3300002741 JGI25157J39369_1000094 JGI25157J39369_100009417 225
411 3300003758 Ga0055532_1000017 Ga0055532_1000017220 225
412 3300003761 Ga0055535_1008038 Ga0055535_10080382 225
413 3300005563 Ga0068855_100120477 Ga0068855_1001204774 225
414 3300005577 Ga0068857_100973332 Ga0068857_1009733321 225
415 3300005614 Ga0068856_100036672 Ga0068856_1000366723 225
416 3300005616 Ga0068852_100015967 Ga0068852_1000159673 225
417 3300009093 Ga0105240_10001581 Ga0105240_1000158134 225
418 3300009093 Ga0105240_10020891 Ga0105240_100208913 225
419 3300009551 Ga0105238_10051101 Ga0105238_100511012 225
420 3300013100 Ga0157373_10108265 Ga0157373_101082652 225
421 3300014497 Ga0182008_10055026 Ga0182008_100550263 225
422 3300025206 Ga0209435_100015 Ga0209435_100015235 225
423 3300025206 Ga0209435_100112 Ga0209435_10011217 225
424 3300025229 Ga0209147_100004 Ga0209147_100004992 225
425 3300025233 Ga0209437_100045 Ga0209437_100045311 225
426 3300025242 Ga0209258_100304 Ga0209258_10030455 225
427 3300025246 Ga0209646_1000020 Ga0209646_1000020209 225
428 3300025246 Ga0209646_1000040 Ga0209646_1000040265 225
429 3300025250 Ga0209026_1000034 Ga0209026_100003455 225
430 3300025250 Ga0209026_1004103 Ga0209026_10041032 225
431 3300025256 Ga0209759_1000049 Ga0209759_1000049149 225
432 3300025256 Ga0209759_1000073 Ga0209759_100007315 225
433 3300025913 Ga0207695_10018109 Ga0207695_100181095 225
434 3300025913 Ga0207695_10059018 Ga0207695_100590184 225
435 3300025924 Ga0207694_10031761 Ga0207694_100317615 225
436 3300026142 Ga0207698_10009580 Ga0207698_100095804 225
437 3300046660 Ga0495625_0000473 Ga0495625_0000473_6321_6998 225
438 3300048919 Ga0496116_0022030 Ga0496116_0022030_176_853 225
439 3300048924 Ga0496121_0017456 Ga0496121_0017456_2153_2833 225
440 3300048925 Ga0496122_0001512 Ga0496122_0001512_18146_18823 225
441 3300048926 Ga0496123_0001219 Ga0496123_0001219_18449_19126 225
442 3300048928 Ga0496125_0001541 Ga0496125_0001541_25986_26663 225
443 3300048928 Ga0496125_0030365 Ga0496125_0030365_1584_2261 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

7

224

0.92

PF01738

DLH

Dienelactone hydrolase family

76

218

0.81

PF03959

FSH1

Serine hydrolase (FSH1)

21

216

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1aur-assembly1.cif.gz_B pmsf-inhibited carboxylesterase from pseudomonas fluorescens 0.9357 6 223
6bje-assembly1.cif.gz_A crystal structure of lysophospholipase a2 conjugated with phenylmethylsulfonyl fluoride 0.9349 6 224
5syn-assembly3.cif.gz_C cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349 0.9344 6 225
1aur-assembly1.cif.gz_B pmsf-inhibited carboxylesterase from pseudomonas fluorescens 0.9273 6 223
6bje-assembly2.cif.gz_B crystal structure of lysophospholipase a2 conjugated with phenylmethylsulfonyl fluoride 0.9259 6 224
ID Description Score Start End Superfamily
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9352 4 223 3.40.50.1820
af_Q55FK4_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9338 9 225 3.40.50.1820
af_Q54T49_3_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9319 9 225 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.923 4 223 3.40.50.1820
af_Q7XR62_2_223_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9228 14 223 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A522IXL0-F1-model_v4 Carboxylesterase 0.9999 86 223 GO:0016787
AF-A0A7C7G4M2-F1-model_v4 Carboxylesterase 0.9986 118 223 GO:0016787
AF-A0A536YKE2-F1-model_v4 Carboxylesterase 0.9975 127 223 GO:0016787
AF-A0A7C4E9R3-F1-model_v4 Carboxylesterase 0.9967 100 223 GO:0016787
AF-A0A3C1N676-F1-model_v4 Carboxylesterase 0.9944 91 223 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.12 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map