F444969

General Info

Members Datasets Scaffolds Average Seq Length
442 285 884 130

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0321652|Ga0501043_0321652_357_788
Length 143
Sequence MVKRAAFNGIKKDFRPMRQLVSSGSPFEGEIGFSRAVRVGNRIEVSGTAPIRDGKTAGVGDCYEQTRAALEIIVKAVEEAGGKAEHIIRTRIFLTDISLWKDAARAHGEIFGQIRPASTFAEIKGLINPEWLVEIEASAQVED

Samples

Sample ID Description Type Environment
1 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
165 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
204 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
205 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
206 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
209 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
210 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 1.36
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501043_0321652 3300049579 Bacteria 1179
2 JGI24034J26672_10079270 3300002239 Bacteria 597
3 rootH1_10151111 3300003316 Bacteria 1831
4 rootH1_10174913 3300003316 Bacteria 2201
5 rootH2_10053959 3300003320 Bacteria 3588
6 rootH2_10074411 3300003320 Bacteria 1599
7 rootH2_10075098 3300003320 Bacteria 1280
8 rootL2_10015292 3300003322 Bacteria 1066
9 Ga0065707_10221074 3300005295 Bacteria 1225
10 Ga0070676_10075753 3300005328 Bacteria 2029
11 Ga0070676_10339618 3300005328 Bacteria 1029
12 Ga0070690_100000455 3300005330 Bacteria 20596
13 Ga0068869_100008273 3300005334 Bacteria 6700
14 Ga0068869_100223440 3300005334 Bacteria 1493
15 Ga0070666_10260432 3300005335 Bacteria 1229
16 Ga0070680_100066254 3300005336 Bacteria 2961
17 Ga0070680_100623972 3300005336 Unclassified 926
18 Ga0070682_100000749 3300005337 Bacteria 19374
19 Ga0068868_100000855 3300005338 Bacteria 20680
20 Ga0068868_100539902 3300005338 Bacteria 1026
21 Ga0070689_100000665 3300005340 Bacteria 20788
22 Ga0070689_100415176 3300005340 Bacteria 1140
23 Ga0070691_10000653 3300005341 Bacteria 13422
24 Ga0070687_100000628 3300005343 Bacteria 11691
25 Ga0070687_100044869 3300005343 Bacteria 2254
26 Ga0070661_101935127 3300005344 Unclassified 501
27 Ga0070692_10000818 3300005345 Bacteria 10376
28 Ga0070692_10105233 3300005345 Bacteria 1553
29 Ga0070692_10245634 3300005345 Bacteria 1069
30 Ga0070668_100048994 3300005347 Bacteria 3250
31 Ga0070669_100004210 3300005353 Bacteria 10406
32 Ga0070669_101457202 3300005353 Unclassified 595
33 Ga0070675_100016707 3300005354 Bacteria 5825
34 Ga0070674_100177399 3300005356 Bacteria 1629
35 Ga0070673_100212019 3300005364 Bacteria 1673
36 Ga0070688_100027213 3300005365 Bacteria 3405
37 Ga0070688_100160889 3300005365 Bacteria 1542
38 Ga0070688_100261938 3300005365 Bacteria 1235
39 Ga0070688_100452735 3300005365 Bacteria 960
40 Ga0070667_100650966 3300005367 Bacteria 973
41 Ga0070703_10071666 3300005406 Bacteria 1159
42 Ga0070703_10118010 3300005406 Bacteria 959
43 Ga0070714_100024073 3300005435 Bacteria 5010
44 Ga0070713_100476551 3300005436 Archaea 1175
45 Ga0070701_10000790 3300005438 Bacteria 11324
46 Ga0070705_100002373 3300005440 Bacteria 9486
47 Ga0070700_100000345 3300005441 Bacteria 23964
48 Ga0070700_100002123 3300005441 Bacteria 10059
49 Ga0070700_100238116 3300005441 Bacteria 1299
50 Ga0070694_100000942 3300005444 Bacteria 16439
51 Ga0070694_100029100 3300005444 Bacteria 3602
52 Ga0070694_100349573 3300005444 Bacteria 1145
53 Ga0070708_100161941 3300005445 Bacteria 2085
54 Ga0070678_101220717 3300005456 Bacteria 698
55 Ga0070662_100116022 3300005457 Bacteria 2046
56 Ga0070681_11524356 3300005458 Unclassified 593
57 Ga0068867_100000396 3300005459 Bacteria 29178
58 Ga0068867_100002614 3300005459 Bacteria 12702
59 Ga0070685_10237765 3300005466 Bacteria 1201
60 Ga0070685_10739210 3300005466 Bacteria 720
61 Ga0070679_100144241 3300005530 Bacteria 2359
62 Ga0070679_100355320 3300005530 Bacteria 1413
63 Ga0070684_100831050 3300005535 Bacteria 864
64 Ga0070697_100111363 3300005536 Bacteria 2282
65 Ga0070697_100153994 3300005536 Bacteria 1939
66 Ga0068853_100110911 3300005539 Bacteria 2437
67 Ga0070672_100284204 3300005543 Bacteria 1400
68 Ga0070686_100002870 3300005544 Bacteria 9472
69 Ga0070686_100085674 3300005544 Unclassified 2096
70 Ga0070686_101330959 3300005544 Bacteria 601
71 Ga0070695_100003572 3300005545 Bacteria 9082
72 Ga0070695_100204209 3300005545 Bacteria 1414
73 Ga0070695_100214301 3300005545 Unclassified 1384
74 Ga0070696_100002515 3300005546 Bacteria 12139
75 Ga0070696_100003583 3300005546 Bacteria 10347
76 Ga0070696_100273941 3300005546 Bacteria 1284
77 Ga0070696_100877224 3300005546 Bacteria 743
78 Ga0070693_100000009 3300005547 Bacteria 77783
79 Ga0070704_100000091 3300005549 Bacteria 31281
80 Ga0070704_100401299 3300005549 Bacteria 1170
81 Ga0070704_101300601 3300005549 Bacteria 665
82 Ga0068855_100003912 3300005563 Bacteria 18180
83 Ga0068857_100231809 3300005577 Bacteria 1689
84 Ga0068854_100143179 3300005578 Unclassified 1836
85 Ga0068856_100052084 3300005614 Bacteria 4036
86 Ga0070702_100000066 3300005615 Bacteria 29418
87 Ga0070702_100052632 3300005615 Bacteria 2335
88 Ga0070702_100553905 3300005615 Bacteria 854
89 Ga0068859_100003675 3300005617 Bacteria 15626
90 Ga0068859_100159567 3300005617 Unclassified 2334
91 Ga0068859_101669713 3300005617 Bacteria 704
92 Ga0068866_10000144 3300005718 Bacteria 32128
93 Ga0068861_100000231 3300005719 Bacteria 30386
94 Ga0068861_100004297 3300005719 Bacteria 9557
95 Ga0068870_10019022 3300005840 Bacteria 3326
96 Ga0068870_10070540 3300005840 Bacteria 1904
97 Ga0068863_100272351 3300005841 Bacteria 1639
98 Ga0068863_101102814 3300005841 Bacteria 798
99 Ga0068858_100000921 3300005842 Bacteria 30521
100 Ga0068858_100169504 3300005842 Bacteria 2058
101 Ga0068860_100002180 3300005843 Bacteria 20596
102 Ga0068860_100599697 3300005843 Bacteria 1107
103 Ga0068860_102143331 3300005843 Unclassified 580
104 Ga0068862_100004600 3300005844 Bacteria 11628
105 Ga0068862_100006210 3300005844 Bacteria 9951
106 Ga0068862_100026659 3300005844 Bacteria 4858
107 Ga0068862_100050379 3300005844 Bacteria 3559
108 Ga0070717_11727947 3300006028 Bacteria 566
109 Ga0070715_10010543 3300006163 Bacteria 3297
110 Ga0070716_100297843 3300006173 Archaea 1120
111 Ga0097621_100000596 3300006237 Bacteria 25478
112 Ga0068871_100000495 3300006358 Bacteria 26957
113 Ga0075428_100161695 3300006844 Bacteria 2430
114 Ga0075430_100597692 3300006846 Bacteria 910
115 Ga0075430_101260975 3300006846 Bacteria 608
116 Ga0075431_101252513 3300006847 Bacteria 703
117 Ga0075433_10009402 3300006852 Bacteria 7810
118 Ga0075434_100000254 3300006871 Bacteria 37644
119 Ga0075434_100200306 3300006871 Bacteria 2016
120 Ga0075429_100001595 3300006880 Bacteria 18685
121 Ga0075429_100454798 3300006880 Bacteria 1122
122 Ga0075429_101338325 3300006880 Bacteria 624
123 Ga0068865_100001819 3300006881 Bacteria 12528
124 Ga0068865_100001943 3300006881 Bacteria 12178
125 Ga0075436_100135843 3300006914 Bacteria 1726
126 Ga0097620_100003675 3300006931 Bacteria 15626
127 Ga0097620_100159567 3300006931 Unclassified 2334
128 Ga0097620_101669885 3300006931 Bacteria 704
129 Ga0097620_101885321 3300006931 Bacteria 660
130 Ga0075435_100008643 3300007076 Bacteria 7321
131 Ga0075435_100026985 3300007076 Bacteria 4487
132 Ga0075435_100443271 3300007076 Bacteria 1119
133 Ga0111539_10050307 3300009094 Bacteria 4964
134 Ga0111539_10054371 3300009094 Bacteria 4764
135 Ga0111539_10055361 3300009094 Bacteria 4715
136 Ga0111539_10073516 3300009094 Bacteria 4031
137 Ga0111539_10121762 3300009094 Bacteria 3057
138 Ga0111539_10534871 3300009094 Bacteria 1365
139 Ga0111539_10686179 3300009094 Bacteria 1192
140 Ga0105245_10000830 3300009098 Bacteria 28117
141 Ga0114129_10000534 3300009147 Bacteria 46594
142 Ga0114129_10398543 3300009147 Bacteria 1814
143 Ga0114129_10922488 3300009147 Bacteria 1105
144 Ga0105243_10000809 3300009148 Bacteria 29781
145 Ga0105243_10002935 3300009148 Bacteria 14105
146 Ga0105241_10023190 3300009174 Bacteria 4600
147 Ga0105241_11531603 3300009174 Unclassified 643
148 Ga0105242_10000501 3300009176 Bacteria 30909
149 Ga0105242_10285990 3300009176 Bacteria 1499
150 Ga0105248_10735307 3300009177 Bacteria 1113
151 Ga0105238_10549451 3300009551 Bacteria 1159
152 Ga0105249_10001520 3300009553 Bacteria 20347
153 Ga0105249_10030483 3300009553 Bacteria 4876
154 Ga0105239_10166002 3300010375 Unclassified 2468
155 Ga0157373_11492010 3300013100 Unclassified 516
156 Ga0157371_10725745 3300013102 Bacteria 745
157 Ga0157371_11048931 3300013102 Unclassified 623
158 Ga0157370_10198035 3300013104 Bacteria 1864
159 Ga0157369_10002320 3300013105 Bacteria 22898
160 Ga0157378_10011388 3300013297 Bacteria 7786
161 Ga0157378_11718155 3300013297 Bacteria 675
162 Ga0163162_10794799 3300013306 Bacteria 1064
163 Ga0157375_10506102 3300013308 Bacteria 1372
164 Ga0157380_10132879 3300014326 Bacteria 2126
165 Ga0157380_10205348 3300014326 Bacteria 1751
166 Ga0157377_10541516 3300014745 Bacteria 821
167 Ga0157379_10947076 3300014968 Unclassified 819
168 Ga0157379_11183664 3300014968 Bacteria 735
169 Ga0157376_10002985 3300014969 Bacteria 11599
170 Ga0183365_10002 3300015684 Bacteria 545891
171 Ga0207653_10040881 3300025885 Bacteria 1521
172 Ga0207642_10000370 3300025899 Bacteria 13564
173 Ga0207688_10133315 3300025901 Bacteria 1457
174 Ga0207680_10331952 3300025903 Bacteria 1065
175 Ga0207647_10302589 3300025904 Bacteria 910
176 Ga0207645_10076585 3300025907 Bacteria 2142
177 Ga0207643_10044964 3300025908 Bacteria 2493
178 Ga0207643_10259028 3300025908 Bacteria 1074
179 Ga0207654_10013644 3300025911 Bacteria 4182
180 Ga0207660_10001746 3300025917 Bacteria 14558
181 Ga0207660_11390883 3300025917 Bacteria 569
182 Ga0207662_10000129 3300025918 Bacteria 36284
183 Ga0207662_10150178 3300025918 Bacteria 1481
184 Ga0207652_10101807 3300025921 Bacteria 2538
185 Ga0207652_10549262 3300025921 Bacteria 1038
186 Ga0207681_10001355 3300025923 Bacteria 15822
187 Ga0207650_10396759 3300025925 Bacteria 1141
188 Ga0207659_10196396 3300025926 Bacteria 1608
189 Ga0207687_10002926 3300025927 Bacteria 11597
190 Ga0207700_10476103 3300025928 Archaea 1103
191 Ga0207706_10253775 3300025933 Bacteria 1536
192 Ga0207686_10001808 3300025934 Bacteria 11886
193 Ga0207686_10476076 3300025934 Bacteria 965
194 Ga0207709_10003052 3300025935 Bacteria 10136
195 Ga0207709_10009465 3300025935 Bacteria 5360
196 Ga0207670_10002476 3300025936 Bacteria 9692
197 Ga0207670_11707806 3300025936 Bacteria 535
198 Ga0207669_10006866 3300025937 Bacteria 5235
199 Ga0207704_10020714 3300025938 Bacteria 3485
200 Ga0207704_10032575 3300025938 Bacteria 2951
201 Ga0207665_10290217 3300025939 Unclassified 1220
202 Ga0207691_10149379 3300025940 Bacteria 2055
203 Ga0207691_10827157 3300025940 Bacteria 777
204 Ga0207711_10519913 3300025941 Bacteria 1110
205 Ga0207689_10000544 3300025942 Bacteria 35849
206 Ga0207689_10024726 3300025942 Bacteria 5035
207 Ga0207661_12129771 3300025944 Bacteria 507
208 Ga0207667_10014955 3300025949 Bacteria 8826
209 Ga0207651_10195168 3300025960 Bacteria 1618
210 Ga0207712_10005328 3300025961 Bacteria 8122
211 Ga0207712_10006172 3300025961 Bacteria 7550
212 Ga0207668_10054934 3300025972 Bacteria 2766
213 Ga0207640_10079320 3300025981 Unclassified 2237
214 Ga0207677_10002310 3300026023 Bacteria 10021
215 Ga0207703_10005033 3300026035 Bacteria 10717
216 Ga0207703_10137333 3300026035 Bacteria 2118
217 Ga0207639_10089322 3300026041 Bacteria 2462
218 Ga0207708_10000417 3300026075 Bacteria 33347
219 Ga0207708_10001370 3300026075 Bacteria 18328
220 Ga0207702_10037948 3300026078 Bacteria 4034
221 Ga0207702_10116516 3300026078 Bacteria 2384
222 Ga0207641_11291080 3300026088 Bacteria 730
223 Ga0207648_10000135 3300026089 Bacteria 73544
224 Ga0207648_10006874 3300026089 Bacteria 11280
225 Ga0207676_10296659 3300026095 Bacteria 1474
226 Ga0207675_100000999 3300026118 Bacteria 27989
227 Ga0207675_100002718 3300026118 Bacteria 17433
228 Ga0207675_100111066 3300026118 Bacteria 2586
229 Ga0207675_100133105 3300026118 Bacteria 2358
230 Ga0207683_10090374 3300026121 Bacteria 2727
231 Ga0207683_10328969 3300026121 Bacteria 1400
232 Ga0207698_10816262 3300026142 Bacteria 936
233 Ga0209981_1008926 3300027378 Bacteria 1365
234 Ga0209996_1020110 3300027395 Bacteria 934
235 Ga0209588_1223145 3300027671 Unclassified 582
236 Ga0209971_1055043 3300027682 Bacteria 962
237 Ga0209966_1002827 3300027695 Bacteria 2911
238 Ga0207428_10021199 3300027907 Bacteria 5504
239 Ga0207428_10035513 3300027907 Bacteria 4074
240 Ga0268265_10002203 3300028380 Bacteria 15024
241 Ga0268265_10003508 3300028380 Bacteria 11222
242 Ga0268265_10101071 3300028380 Bacteria 2329
243 Ga0268265_10353145 3300028380 Bacteria 1343
244 Ga0268264_10002949 3300028381 Bacteria 14779
245 Ga0268264_10024272 3300028381 Bacteria 4950
246 Ga0268264_11065168 3300028381 Bacteria 816
247 Ga0265320_10249493 3300031240 Bacteria 787
248 Ga0307408_100064677 3300031548 Bacteria 2680
249 Ga0316575_10241749 3300031665 Unclassified 756
250 Ga0316576_10294773 3300031727 Bacteria 1213
251 Ga0316578_10108532 3300031728 Bacteria 1666
252 Ga0307405_10395143 3300031731 Bacteria 1081
253 Ga0307405_10414808 3300031731 Bacteria 1058
254 Ga0307405_10821302 3300031731 Bacteria 780
255 Ga0307405_11505933 3300031731 Unclassified 591
256 Ga0316577_10747180 3300031733 Unclassified 555
257 Ga0307410_11842138 3300031852 Bacteria 538
258 Ga0307406_10835567 3300031901 Bacteria 780
259 Ga0307412_11405607 3300031911 Bacteria 632
260 Ga0307409_101066707 3300031995 Bacteria 828
261 Ga0307409_102118240 3300031995 Bacteria 592
262 Ga0307416_100105333 3300032002 Bacteria 2468
263 Ga0307411_10175268 3300032005 Bacteria 1622
264 Ga0307415_101286148 3300032126 Bacteria 692
265 Ga0373948_0002955 3300034817 Unclassified 2569
266 Ga0373950_0012694 3300034818 Bacteria 1395
267 Ga0373938_0030349 3300034957 Bacteria 1153
268 Ga0373926_0015200 3300035083 Bacteria 2623
269 Ga0373928_0198199 3300035084 Bacteria 578
270 Ga0373934_0000306 3300035086 Bacteria 17220
271 Ga0373940_0012106 3300035088 Unclassified 2062
272 Ga0373944_0018779 3300035089 Bacteria 1978
273 Ga0373949_0012904 3300035090 Bacteria 1851
274 Ga0373951_0172824 3300035091 Unclassified 617
275 Ga0373923_0232648 3300035111 Bacteria 859
276 Ga0373932_0001346 3300035112 Bacteria 6877
277 Ga0373932_0089005 3300035112 Unclassified 987
278 Ga0373936_0003283 3300035113 Bacteria 6063
279 Ga0373939_0408678 3300035114 Unclassified 564
280 Ga0373941_0002466 3300035115 Bacteria 4079
281 Ga0373941_0064647 3300035115 Bacteria 1199
282 Ga0373945_0031095 3300035116 Bacteria 1885
283 Ga0373953_0007413 3300035117 Bacteria 3672
284 Ga0373953_0077524 3300035117 Bacteria 1378
285 Ga0373954_0049491 3300035118 Bacteria 1970
286 Ga0373956_0001501 3300035119 Bacteria 9646
287 Ga0373956_0031530 3300035119 Bacteria 2323
288 Ga0373957_0014110 3300035120 Bacteria 2725
289 Ga0373957_0111454 3300035120 Bacteria 1102
290 Ga0373960_0027315 3300035121 Bacteria 1566
291 Ga0373960_0082354 3300035121 Bacteria 1015
292 Ga0373960_0436719 3300035121 Bacteria 511
293 Ga0373943_0001683 3300035170 Bacteria 10039
294 Ga0373946_0002413 3300035171 Bacteria 6607
295 Ga0373955_0062373 3300035172 Bacteria 2061
296 Ga0373942_0000743 3300035207 Bacteria 8994
297 Ga0373942_0002477 3300035207 Plasmid 4481
298 Ga0373962_0008135 3300035242 Bacteria 2576
299 Ga0373924_0173063 3300035410 Unclassified 949
300 Ga0373924_0442709 3300035410 Bacteria 582
301 Ga0373931_0002692 3300035691 Bacteria 7908
302 Ga0373931_0150178 3300035691 Bacteria 1357
303 Ga0373931_0785981 3300035691 Bacteria 634
304 Ga0373935_0019773 3300035692 Bacteria 4108
305 Ga0373935_0058653 3300035692 Bacteria 2459
306 Ga0373927_0059537 3300035695 Bacteria 2470
307 Ga0373933_0003029 3300035724 Bacteria 9377
308 Ga0373933_0013207 3300035724 Bacteria 4574
309 Ga0373933_1142336 3300035724 Bacteria 513
310 Ga0373947_0007412 3300035725 Bacteria 6352
311 Ga0373937_0004860 3300036401 Bacteria 11422
312 Ga0373937_0024574 3300036401 Bacteria 5436
313 Ga0373937_0038155 3300036401 Bacteria 4378
314 Ga0316584_0005812 3300036712 Bacteria 8324
315 Ga0373925_0004033 3300037068 Bacteria 11153
316 Ga0395900_0174587 3300037418 Bacteria 2186
317 Ga0395898_0258244 3300037466 Bacteria 1662
318 Ga0395898_0280619 3300037466 Bacteria 1589
319 Ga0395905_0002765 3300037471 Bacteria 19214
320 Ga0395905_0110232 3300037471 Bacteria 2585
321 Ga0395905_0136365 3300037471 Bacteria 2309
322 Ga0395905_0531541 3300037471 Bacteria 1077
323 Ga0395905_0984090 3300037471 Bacteria 746
324 Ga0395901_0004919 3300038443 Bacteria 13484
325 Ga0395901_0271968 3300038443 Bacteria 1762
326 Ga0400484_31528 3300038725 Bacteria 1416
327 Ga0400488_30217 3300038741 Bacteria 16860
328 Ga0400488_62567 3300038741 Unclassified 2815
329 Ga0400483_064815 3300039062 Bacteria 7259
330 Ga0400483_239491 3300039062 Bacteria 9477
331 Ga0400489_53017 3300039093 Bacteria 19281
332 Ga0436365_0547820 3300039437 Bacteria 958
333 Ga0450917_011518 3300042120 Bacteria 712
334 Ga0450920_034798 3300042122 Bacteria 997
335 Ga0450896_030535 3300042133 Unclassified 815
336 Ga0451577_0023484 3300042876 Bacteria 5624
337 Ga0466972_0558275 3300044658 Bacteria 540
338 Ga0453683_0583478 3300044673 Unclassified 728
339 Ga0453684_0062699 3300044712 Bacteria 4760
340 Ga0466959_0271299 3300045049 Bacteria 1166
341 Ga0451576_0010370 3300045051 Bacteria 10697
342 Ga0451576_0025384 3300045051 Bacteria 6383
343 Ga0451576_0346300 3300045051 Bacteria 1556
344 Ga0451576_0390858 3300045051 Bacteria 1458
345 Ga0466967_1081202 3300045976 Bacteria 799
346 Ga0495592_0007156 3300046454 Bacteria 8356
347 Ga0495592_0548192 3300046454 Unclassified 711
348 Ga0495641_0065099 3300046461 Bacteria 1641
349 Ga0495651_0001141 3300046462 Bacteria 20547
350 Ga0495651_0229714 3300046462 Bacteria 1279
351 Ga0495653_0230225 3300046463 Unclassified 1241
352 Ga0495580_0040552 3300046472 Bacteria 3325
353 Ga0495580_0494432 3300046472 Bacteria 817
354 Ga0495594_0081247 3300046499 Bacteria 1810
355 Ga0495608_0145546 3300046511 Bacteria 1511
356 Ga0495608_0350518 3300046511 Bacteria 908
357 Ga0495618_0099156 3300046514 Bacteria 1864
358 Ga0495628_0005543 3300046516 Bacteria 11050
359 Ga0495630_0035959 3300046517 Bacteria 3702
360 Ga0495666_0163320 3300046526 Bacteria 1032
361 Ga0495652_0205619 3300046529 Bacteria 1491
362 Ga0495640_0376000 3300046533 Unclassified 874
363 Ga0495586_0011863 3300046535 Bacteria 4630
364 Ga0495586_0028279 3300046535 Bacteria 3000
365 Ga0495587_0103115 3300046536 Bacteria 1642
366 Ga0495621_0099348 3300046539 Unclassified 1106
367 Ga0495645_0175566 3300046543 Bacteria 1471
368 Ga0495667_0021757 3300046559 Bacteria 4326
369 Ga0495667_0037347 3300046559 Bacteria 3238
370 Ga0495667_0506391 3300046559 Bacteria 756
371 Ga0495656_0182678 3300046615 Bacteria 1032
372 Ga0495634_0024277 3300046642 Bacteria 4256
373 Ga0495634_0160214 3300046642 Bacteria 1419
374 Ga0495599_0110881 3300046678 Bacteria 1709
375 Ga0495669_0029944 3300046684 Bacteria 2389
376 Ga0495613_0025412 3300046689 Bacteria 4412
377 Ga0495624_0311284 3300046690 Unclassified 949
378 Ga0495600_0209898 3300046809 Bacteria 1248
379 Ga0495604_0079920 3300047317 Bacteria 2451
380 Ga0495680_0006692 3300047322 Bacteria 10669
381 Ga0495680_0084763 3300047322 Bacteria 2387
382 Ga0495684_0022362 3300047471 Bacteria 4866
383 Ga0495686_0082044 3300047472 Bacteria 1968
384 Ga0496101_1529999 3300048904 Bacteria 519
385 Ga0496107_0941733 3300048910 Unclassified 628
386 Ga0496111_1258917 3300048914 Bacteria 522
387 Ga0496114_0208171 3300048917 Unclassified 1715
388 Ga0496115_0000286 3300048918 Bacteria 43642
389 Ga0496115_0319205 3300048918 Bacteria 1271
390 Ga0501299_168079 3300049522 Bacteria 565
391 Ga0501031_0030591 3300049568 Bacteria 3512
392 Ga0501033_0532690 3300049570 Bacteria 810
393 Ga0501034_0017349 3300049571 Bacteria 7384
394 Ga0501034_0168950 3300049571 Bacteria 2155
395 Ga0501036_0286718 3300049572 Bacteria 1378
396 Ga0501040_0592202 3300049576 Unclassified 801
397 Ga0501042_0209443 3300049578 Bacteria 1406
398 Ga0501043_0307233 3300049579 Bacteria 1211
399 Ga0501046_0345405 3300049580 Bacteria 1081
400 Ga0501047_0337955 3300049581 Bacteria 1344
401 Ga0501069_0005684 3300049585 Bacteria 6495
402 Ga0501070_0027040 3300049586 Bacteria 4812
403 Ga0501070_0127737 3300049586 Bacteria 2100
404 Ga0501070_0199491 3300049586 Bacteria 1643
405 Ga0501071_0115640 3300049587 Bacteria 1985
406 Ga0501075_0934653 3300049591 Bacteria 659
407 Ga0501076_1011836 3300049592 Bacteria 685
408 Ga0501077_0169351 3300049593 Bacteria 1388
409 Ga0501079_1014411 3300049741 Bacteria 654
410 Ga0501080_0042421 3300049742 Bacteria 4236
411 Ga0501080_0137011 3300049742 Bacteria 2265
412 Ga0501081_0355011 3300049743 Bacteria 1081
413 Ga0501083_0052037 3300049744 Bacteria 2752
414 Ga0501035_0055251 3300049822 Bacteria 3545
415 nmdc:mga05p37_1034568_c1 3300050507 Bacteria 868
416 nmdc:mga05p37_575503_c1 3300050507 Bacteria 1276
417 nmdc:mga05p37_765341_c1 3300050507 Bacteria 1062
418 nmdc:mga09592_1560553_c1 3300050508 Bacteria 536
419 nmdc:mga09592_2751_c1 3300050508 Bacteria 14213
420 nmdc:mga09592_311275_c1 3300050508 Bacteria 1365
421 nmdc:mga0qj67_385696_c1 3300050509 Bacteria 1131
422 nmdc:mga0qj67_498847_c1 3300050509 Bacteria 979
423 nmdc:mga06r32_385732_c1 3300050510 Bacteria 1384
424 nmdc:mga08y16_112225_c1 3300050511 Unclassified 2838
425 nmdc:mga08y16_12031_c2 3300050511 Bacteria 6431
426 nmdc:mga08y16_33579_c1 3300050511 Bacteria 5388
427 nmdc:mga0n895_37110_c1 3300050512 Bacteria 4712
428 nmdc:mga0n895_455961_c1 3300050512 Bacteria 1291
429 nmdc:mga0rr50_10311_c1 3300050513 Bacteria 5923
430 nmdc:mga0rr50_118484_c1 3300050513 Unclassified 2104
431 nmdc:mga0rr50_288847_c1 3300050513 Bacteria 1370
432 nmdc:mga08x19_1311_c1 3300050514 Bacteria 15443
433 nmdc:mga08x19_386387_c1 3300050514 Bacteria 980
434 nmdc:mga0a205_124292_c1 3300050515 Bacteria 2480
435 nmdc:mga0a205_1935_c1 3300050515 Bacteria 17991
436 Ga0500635_0012369 3300053080 Bacteria 2449
437 Ga0495619_0046929 3300053085 Bacteria 2842
438 Ga0495619_0170771 3300053085 Unclassified 1504
439 Ga0495619_0430400 3300053085 Unclassified 910
440 Ga0500559_0159195 3300053136 Bacteria 1061
441 Ga0501084_0989952 3300054114 Bacteria 707
442 2739791361 2739367756 Bacteria 4553612
443 Ga0501043_0321652
444 JGI24034J26672_10079270
445 rootH1_10151111
446 rootH1_10174913
447 rootH2_10053959
448 rootH2_10074411
449 rootH2_10075098
450 rootL2_10015292
451 Ga0065707_10221074
452 Ga0070676_10075753
453 Ga0070676_10339618
454 Ga0070690_100000455
455 Ga0068869_100008273
456 Ga0068869_100223440
457 Ga0070666_10260432
458 Ga0070680_100066254
459 Ga0070680_100623972
460 Ga0070682_100000749
461 Ga0068868_100000855
462 Ga0068868_100539902
463 Ga0070689_100000665
464 Ga0070689_100415176
465 Ga0070691_10000653
466 Ga0070687_100000628
467 Ga0070687_100044869
468 Ga0070661_101935127
469 Ga0070692_10000818
470 Ga0070692_10105233
471 Ga0070692_10245634
472 Ga0070668_100048994
473 Ga0070669_100004210
474 Ga0070669_101457202
475 Ga0070675_100016707
476 Ga0070674_100177399
477 Ga0070673_100212019
478 Ga0070688_100027213
479 Ga0070688_100160889
480 Ga0070688_100261938
481 Ga0070688_100452735
482 Ga0070667_100650966
483 Ga0070703_10071666
484 Ga0070703_10118010
485 Ga0070714_100024073
486 Ga0070713_100476551
487 Ga0070701_10000790
488 Ga0070705_100002373
489 Ga0070700_100000345
490 Ga0070700_100002123
491 Ga0070700_100238116
492 Ga0070694_100000942
493 Ga0070694_100029100
494 Ga0070694_100349573
495 Ga0070708_100161941
496 Ga0070678_101220717
497 Ga0070662_100116022
498 Ga0070681_11524356
499 Ga0068867_100000396
500 Ga0068867_100002614
501 Ga0070685_10237765
502 Ga0070685_10739210
503 Ga0070679_100144241
504 Ga0070679_100355320
505 Ga0070684_100831050
506 Ga0070697_100111363
507 Ga0070697_100153994
508 Ga0068853_100110911
509 Ga0070672_100284204
510 Ga0070686_100002870
511 Ga0070686_100085674
512 Ga0070686_101330959
513 Ga0070695_100003572
514 Ga0070695_100204209
515 Ga0070695_100214301
516 Ga0070696_100002515
517 Ga0070696_100003583
518 Ga0070696_100273941
519 Ga0070696_100877224
520 Ga0070693_100000009
521 Ga0070704_100000091
522 Ga0070704_100401299
523 Ga0070704_101300601
524 Ga0068855_100003912
525 Ga0068857_100231809
526 Ga0068854_100143179
527 Ga0068856_100052084
528 Ga0070702_100000066
529 Ga0070702_100052632
530 Ga0070702_100553905
531 Ga0068859_100003675
532 Ga0068859_100159567
533 Ga0068859_101669713
534 Ga0068866_10000144
535 Ga0068861_100000231
536 Ga0068861_100004297
537 Ga0068870_10019022
538 Ga0068870_10070540
539 Ga0068863_100272351
540 Ga0068863_101102814
541 Ga0068858_100000921
542 Ga0068858_100169504
543 Ga0068860_100002180
544 Ga0068860_100599697
545 Ga0068860_102143331
546 Ga0068862_100004600
547 Ga0068862_100006210
548 Ga0068862_100026659
549 Ga0068862_100050379
550 Ga0070717_11727947
551 Ga0070715_10010543
552 Ga0070716_100297843
553 Ga0097621_100000596
554 Ga0068871_100000495
555 Ga0075428_100161695
556 Ga0075430_100597692
557 Ga0075430_101260975
558 Ga0075431_101252513
559 Ga0075433_10009402
560 Ga0075434_100000254
561 Ga0075434_100200306
562 Ga0075429_100001595
563 Ga0075429_100454798
564 Ga0075429_101338325
565 Ga0068865_100001819
566 Ga0068865_100001943
567 Ga0075436_100135843
568 Ga0097620_100003675
569 Ga0097620_100159567
570 Ga0097620_101669885
571 Ga0097620_101885321
572 Ga0075435_100008643
573 Ga0075435_100026985
574 Ga0075435_100443271
575 Ga0111539_10050307
576 Ga0111539_10054371
577 Ga0111539_10055361
578 Ga0111539_10073516
579 Ga0111539_10121762
580 Ga0111539_10534871
581 Ga0111539_10686179
582 Ga0105245_10000830
583 Ga0114129_10000534
584 Ga0114129_10398543
585 Ga0114129_10922488
586 Ga0105243_10000809
587 Ga0105243_10002935
588 Ga0105241_10023190
589 Ga0105241_11531603
590 Ga0105242_10000501
591 Ga0105242_10285990
592 Ga0105248_10735307
593 Ga0105238_10549451
594 Ga0105249_10001520
595 Ga0105249_10030483
596 Ga0105239_10166002
597 Ga0157373_11492010
598 Ga0157371_10725745
599 Ga0157371_11048931
600 Ga0157370_10198035
601 Ga0157369_10002320
602 Ga0157378_10011388
603 Ga0157378_11718155
604 Ga0163162_10794799
605 Ga0157375_10506102
606 Ga0157380_10132879
607 Ga0157380_10205348
608 Ga0157377_10541516
609 Ga0157379_10947076
610 Ga0157379_11183664
611 Ga0157376_10002985
612 Ga0183365_10002
613 Ga0207653_10040881
614 Ga0207642_10000370
615 Ga0207688_10133315
616 Ga0207680_10331952
617 Ga0207647_10302589
618 Ga0207645_10076585
619 Ga0207643_10044964
620 Ga0207643_10259028
621 Ga0207654_10013644
622 Ga0207660_10001746
623 Ga0207660_11390883
624 Ga0207662_10000129
625 Ga0207662_10150178
626 Ga0207652_10101807
627 Ga0207652_10549262
628 Ga0207681_10001355
629 Ga0207650_10396759
630 Ga0207659_10196396
631 Ga0207687_10002926
632 Ga0207700_10476103
633 Ga0207706_10253775
634 Ga0207686_10001808
635 Ga0207686_10476076
636 Ga0207709_10003052
637 Ga0207709_10009465
638 Ga0207670_10002476
639 Ga0207670_11707806
640 Ga0207669_10006866
641 Ga0207704_10020714
642 Ga0207704_10032575
643 Ga0207665_10290217
644 Ga0207691_10149379
645 Ga0207691_10827157
646 Ga0207711_10519913
647 Ga0207689_10000544
648 Ga0207689_10024726
649 Ga0207661_12129771
650 Ga0207667_10014955
651 Ga0207651_10195168
652 Ga0207712_10005328
653 Ga0207712_10006172
654 Ga0207668_10054934
655 Ga0207640_10079320
656 Ga0207677_10002310
657 Ga0207703_10005033
658 Ga0207703_10137333
659 Ga0207639_10089322
660 Ga0207708_10000417
661 Ga0207708_10001370
662 Ga0207702_10037948
663 Ga0207702_10116516
664 Ga0207641_11291080
665 Ga0207648_10000135
666 Ga0207648_10006874
667 Ga0207676_10296659
668 Ga0207675_100000999
669 Ga0207675_100002718
670 Ga0207675_100111066
671 Ga0207675_100133105
672 Ga0207683_10090374
673 Ga0207683_10328969
674 Ga0207698_10816262
675 Ga0209981_1008926
676 Ga0209996_1020110
677 Ga0209588_1223145
678 Ga0209971_1055043
679 Ga0209966_1002827
680 Ga0207428_10021199
681 Ga0207428_10035513
682 Ga0268265_10002203
683 Ga0268265_10003508
684 Ga0268265_10101071
685 Ga0268265_10353145
686 Ga0268264_10002949
687 Ga0268264_10024272
688 Ga0268264_11065168
689 Ga0265320_10249493
690 Ga0307408_100064677
691 Ga0316575_10241749
692 Ga0316576_10294773
693 Ga0316578_10108532
694 Ga0307405_10395143
695 Ga0307405_10414808
696 Ga0307405_10821302
697 Ga0307405_11505933
698 Ga0316577_10747180
699 Ga0307410_11842138
700 Ga0307406_10835567
701 Ga0307412_11405607
702 Ga0307409_101066707
703 Ga0307409_102118240
704 Ga0307416_100105333
705 Ga0307411_10175268
706 Ga0307415_101286148
707 Ga0373948_0002955
708 Ga0373950_0012694
709 Ga0373938_0030349
710 Ga0373926_0015200
711 Ga0373928_0198199
712 Ga0373934_0000306
713 Ga0373940_0012106
714 Ga0373944_0018779
715 Ga0373949_0012904
716 Ga0373951_0172824
717 Ga0373923_0232648
718 Ga0373932_0001346
719 Ga0373932_0089005
720 Ga0373936_0003283
721 Ga0373939_0408678
722 Ga0373941_0002466
723 Ga0373941_0064647
724 Ga0373945_0031095
725 Ga0373953_0007413
726 Ga0373953_0077524
727 Ga0373954_0049491
728 Ga0373956_0001501
729 Ga0373956_0031530
730 Ga0373957_0014110
731 Ga0373957_0111454
732 Ga0373960_0027315
733 Ga0373960_0082354
734 Ga0373960_0436719
735 Ga0373943_0001683
736 Ga0373946_0002413
737 Ga0373955_0062373
738 Ga0373942_0000743
739 Ga0373942_0002477
740 Ga0373962_0008135
741 Ga0373924_0173063
742 Ga0373924_0442709
743 Ga0373931_0002692
744 Ga0373931_0150178
745 Ga0373931_0785981
746 Ga0373935_0019773
747 Ga0373935_0058653
748 Ga0373927_0059537
749 Ga0373933_0003029
750 Ga0373933_0013207
751 Ga0373933_1142336
752 Ga0373947_0007412
753 Ga0373937_0004860
754 Ga0373937_0024574
755 Ga0373937_0038155
756 Ga0316584_0005812
757 Ga0373925_0004033
758 Ga0395900_0174587
759 Ga0395898_0258244
760 Ga0395898_0280619
761 Ga0395905_0002765
762 Ga0395905_0110232
763 Ga0395905_0136365
764 Ga0395905_0531541
765 Ga0395905_0984090
766 Ga0395901_0004919
767 Ga0395901_0271968
768 Ga0400484_31528
769 Ga0400488_30217
770 Ga0400488_62567
771 Ga0400483_064815
772 Ga0400483_239491
773 Ga0400489_53017
774 Ga0436365_0547820
775 Ga0450917_011518
776 Ga0450920_034798
777 Ga0450896_030535
778 Ga0451577_0023484
779 Ga0466972_0558275
780 Ga0453683_0583478
781 Ga0453684_0062699
782 Ga0466959_0271299
783 Ga0451576_0010370
784 Ga0451576_0025384
785 Ga0451576_0346300
786 Ga0451576_0390858
787 Ga0466967_1081202
788 Ga0495592_0007156
789 Ga0495592_0548192
790 Ga0495641_0065099
791 Ga0495651_0001141
792 Ga0495651_0229714
793 Ga0495653_0230225
794 Ga0495580_0040552
795 Ga0495580_0494432
796 Ga0495594_0081247
797 Ga0495608_0145546
798 Ga0495608_0350518
799 Ga0495618_0099156
800 Ga0495628_0005543
801 Ga0495630_0035959
802 Ga0495666_0163320
803 Ga0495652_0205619
804 Ga0495640_0376000
805 Ga0495586_0011863
806 Ga0495586_0028279
807 Ga0495587_0103115
808 Ga0495621_0099348
809 Ga0495645_0175566
810 Ga0495667_0021757
811 Ga0495667_0037347
812 Ga0495667_0506391
813 Ga0495656_0182678
814 Ga0495634_0024277
815 Ga0495634_0160214
816 Ga0495599_0110881
817 Ga0495669_0029944
818 Ga0495613_0025412
819 Ga0495624_0311284
820 Ga0495600_0209898
821 Ga0495604_0079920
822 Ga0495680_0006692
823 Ga0495680_0084763
824 Ga0495684_0022362
825 Ga0495686_0082044
826 Ga0496101_1529999
827 Ga0496107_0941733
828 Ga0496111_1258917
829 Ga0496114_0208171
830 Ga0496115_0000286
831 Ga0496115_0319205
832 Ga0501299_168079
833 Ga0501031_0030591
834 Ga0501033_0532690
835 Ga0501034_0017349
836 Ga0501034_0168950
837 Ga0501036_0286718
838 Ga0501040_0592202
839 Ga0501042_0209443
840 Ga0501043_0307233
841 Ga0501046_0345405
842 Ga0501047_0337955
843 Ga0501069_0005684
844 Ga0501070_0027040
845 Ga0501070_0127737
846 Ga0501070_0199491
847 Ga0501071_0115640
848 Ga0501075_0934653
849 Ga0501076_1011836
850 Ga0501077_0169351
851 Ga0501079_1014411
852 Ga0501080_0042421
853 Ga0501080_0137011
854 Ga0501081_0355011
855 Ga0501083_0052037
856 Ga0501035_0055251
857 nmdc:mga05p37_1034568_c1
858 nmdc:mga05p37_575503_c1
859 nmdc:mga05p37_765341_c1
860 nmdc:mga09592_1560553_c1
861 nmdc:mga09592_2751_c1
862 nmdc:mga09592_311275_c1
863 nmdc:mga0qj67_385696_c1
864 nmdc:mga0qj67_498847_c1
865 nmdc:mga06r32_385732_c1
866 nmdc:mga08y16_112225_c1
867 nmdc:mga08y16_12031_c2
868 nmdc:mga08y16_33579_c1
869 nmdc:mga0n895_37110_c1
870 nmdc:mga0n895_455961_c1
871 nmdc:mga0rr50_10311_c1
872 nmdc:mga0rr50_118484_c1
873 nmdc:mga0rr50_288847_c1
874 nmdc:mga08x19_1311_c1
875 nmdc:mga08x19_386387_c1
876 nmdc:mga0a205_124292_c1
877 nmdc:mga0a205_1935_c1
878 Ga0500635_0012369
879 Ga0495619_0046929
880 Ga0495619_0170771
881 Ga0495619_0430400
882 Ga0500559_0159195
883 Ga0501084_0989952
884 2739791361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

25

141

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9603 1 126
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9551 17 127
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9523 1 126
2dyy-assembly4.cif.gz_K crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.951 17 127
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9377 18 125
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9603 1 126 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9566 17 126 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9551 17 127 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9523 1 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9375 18 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2S7K256-F1-model_v4 RidA family protein 1.001 22 127
AF-A0A2N6AYX5-F1-model_v4 RidA family protein 0.9965 1 127
AF-A0A4R4R3J9-F1-model_v4 RidA family protein 0.9956 1 128
AF-A0A455W4W9-F1-model_v4 RidA family protein 0.9956 28 128
AF-A0A1C6U8L9-F1-model_v4 Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family 0.994 1 129

Map