F444841

General Info

Members Datasets Scaffolds Average Seq Length
442 252 884 111

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100982785|Ga0068856_1009827852
Length 125
Sequence MYTYLNKASPSFEDCMAGSDLFTGTLDILILKAASWGPRHGYAIGRWIRDTTTELVVVQEGALYPALYRLEGKGLLASEWGISETGREAKFYSLTPAGRSHLRAEAKRWSAFSAAIGRAITSASA

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
225 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
228 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
229 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
234 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
235 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
236 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
239 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
240 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
241 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 25.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100982785 3300005614 Bacteria 863
2 Ga0058860_11272407 3300004801 Unclassified 548
3 Ga0065707_10513727 3300005295 Bacteria 747
4 Ga0065707_10533526 3300005295 Unclassified 703
5 Ga0070683_100102013 3300005329 Bacteria 2702
6 Ga0070683_100165050 3300005329 Bacteria 2101
7 Ga0070683_100345275 3300005329 Bacteria 1417
8 Ga0070683_100576562 3300005329 Bacteria 1076
9 Ga0070683_100593620 3300005329 Unclassified 1060
10 Ga0070690_100819956 3300005330 Unclassified 723
11 Ga0070670_100009190 3300005331 Bacteria 8446
12 Ga0070670_100309390 3300005331 Bacteria 1383
13 Ga0068869_100053190 3300005334 Bacteria 2942
14 Ga0070666_10301229 3300005335 Bacteria 1142
15 Ga0070666_11117001 3300005335 Unclassified 586
16 Ga0070680_100011963 3300005336 Bacteria 6733
17 Ga0070680_101315376 3300005336 Unclassified 626
18 Ga0070682_100017789 3300005337 Bacteria 4146
19 Ga0068868_100054702 3300005338 Bacteria 3146
20 Ga0070660_100066690 3300005339 Bacteria 2803
21 Ga0070660_100236692 3300005339 Bacteria 1486
22 Ga0070689_100041165 3300005340 Bacteria 3546
23 Ga0070689_100175097 3300005340 Unclassified 1740
24 Ga0070691_10306164 3300005341 Bacteria 869
25 Ga0070687_100039623 3300005343 Bacteria 2369
26 Ga0070661_100014767 3300005344 Bacteria 5507
27 Ga0070661_100454466 3300005344 Bacteria 1019
28 Ga0070692_10074654 3300005345 Unclassified 1814
29 Ga0070692_10539595 3300005345 Bacteria 762
30 Ga0070668_100039709 3300005347 Bacteria 3599
31 Ga0070669_100018699 3300005353 Bacteria 4953
32 Ga0070669_100791033 3300005353 Bacteria 806
33 Ga0070669_101138381 3300005353 Unclassified 673
34 Ga0070675_100024452 3300005354 Bacteria 4837
35 Ga0070675_100663010 3300005354 Unclassified 949
36 Ga0070675_101503809 3300005354 Bacteria 621
37 Ga0070674_100210997 3300005356 Bacteria 1505
38 Ga0070674_100344092 3300005356 Unclassified 1202
39 Ga0070673_100156004 3300005364 Bacteria 1937
40 Ga0070673_100419940 3300005364 Bacteria 1199
41 Ga0070673_100715744 3300005364 Unclassified 920
42 Ga0070688_100213836 3300005365 Unclassified 1355
43 Ga0070659_100020378 3300005366 Bacteria 5035
44 Ga0070659_100204702 3300005366 Bacteria 1625
45 Ga0070667_100125463 3300005367 Unclassified 2237
46 Ga0070667_101086131 3300005367 Bacteria 748
47 Ga0070667_101239435 3300005367 Bacteria 698
48 Ga0070667_101416510 3300005367 Bacteria 652
49 Ga0070709_10009532 3300005434 Bacteria 5358
50 Ga0070709_10069187 3300005434 Unclassified 2273
51 Ga0070709_10562298 3300005434 Unclassified 874
52 Ga0070714_100004339 3300005435 Bacteria 10692
53 Ga0070714_100006121 3300005435 Bacteria 9249
54 Ga0070714_100936749 3300005435 Bacteria 841
55 Ga0070713_100002013 3300005436 Bacteria 13124
56 Ga0070713_100107057 3300005436 Bacteria 2431
57 Ga0070713_101021329 3300005436 Unclassified 798
58 Ga0070710_10157917 3300005437 Bacteria 1404
59 Ga0070700_100145709 3300005441 Bacteria 1614
60 Ga0070694_100840004 3300005444 Unclassified 755
61 Ga0070662_100070333 3300005457 Unclassified 2578
62 Ga0070662_100121337 3300005457 Bacteria 2004
63 Ga0070681_10005172 3300005458 Bacteria 12591
64 Ga0068867_100073348 3300005459 Bacteria 2563
65 Ga0068867_100745440 3300005459 Bacteria 868
66 Ga0070698_100395479 3300005471 Unclassified 1315
67 Ga0070698_100395486 3300005471 Bacteria 1315
68 Ga0070698_101139072 3300005471 Bacteria 729
69 Ga0070699_100138918 3300005518 Unclassified 2144
70 Ga0070679_100076051 3300005530 Bacteria 3347
71 Ga0070679_100228583 3300005530 Bacteria 1820
72 Ga0070679_101242551 3300005530 Bacteria 690
73 Ga0070684_100021380 3300005535 Bacteria 5383
74 Ga0070684_100032535 3300005535 Bacteria 4445
75 Ga0070684_100544170 3300005535 Unclassified 1077
76 Ga0070684_100944566 3300005535 Unclassified 808
77 Ga0068853_100239049 3300005539 Unclassified 1664
78 Ga0070672_100013906 3300005543 Bacteria 5694
79 Ga0070686_100231557 3300005544 Bacteria 1340
80 Ga0070686_100569140 3300005544 Unclassified 889
81 Ga0070695_100013064 3300005545 Bacteria 4988
82 Ga0070695_100189507 3300005545 Bacteria 1462
83 Ga0070696_100003503 3300005546 Bacteria 10433
84 Ga0070693_100008088 3300005547 Bacteria 5164
85 Ga0070693_100746771 3300005547 Bacteria 721
86 Ga0070665_100022052 3300005548 Bacteria 6407
87 Ga0070704_100044536 3300005549 Bacteria 3084
88 Ga0070704_100343247 3300005549 Bacteria 1258
89 Ga0068855_100126683 3300005563 Bacteria 2919
90 Ga0068855_101943564 3300005563 Unclassified 595
91 Ga0070664_100187153 3300005564 Unclassified 1843
92 Ga0070664_101610071 3300005564 Unclassified 615
93 Ga0068857_100733081 3300005577 Unclassified 940
94 Ga0068856_100028284 3300005614 Bacteria 5473
95 Ga0068856_102542244 3300005614 Unclassified 518
96 Ga0068852_100022365 3300005616 Bacteria 5070
97 Ga0068859_100000005 3300005617 Bacteria 430800
98 Ga0068859_100037135 3300005617 Bacteria 4889
99 Ga0068859_100379257 3300005617 Bacteria 1509
100 Ga0068859_101095622 3300005617 Unclassified 876
101 Ga0068864_100014236 3300005618 Bacteria 6605
102 Ga0068864_100091099 3300005618 Bacteria 2689
103 Ga0068864_100879287 3300005618 Unclassified 884
104 Ga0068861_100800718 3300005719 Bacteria 884
105 Ga0068861_102564022 3300005719 Bacteria 513
106 Ga0068851_10274453 3300005834 Unclassified 962
107 Ga0068870_10014991 3300005840 Bacteria 3670
108 Ga0068870_10047499 3300005840 Bacteria 2257
109 Ga0068863_100009660 3300005841 Bacteria 9413
110 Ga0068858_100154585 3300005842 Bacteria 2158
111 Ga0068858_100548825 3300005842 Bacteria 1119
112 Ga0068860_100707907 3300005843 Bacteria 1017
113 Ga0068862_100002809 3300005844 Bacteria 15261
114 Ga0081539_10000019 3300005985 Bacteria 369381
115 Ga0070717_10001409 3300006028 Bacteria 16571
116 Ga0070717_10403815 3300006028 Unclassified 1228
117 Ga0070716_101079950 3300006173 Unclassified 639
118 Ga0070716_101249093 3300006173 Unclassified 598
119 Ga0070712_100022936 3300006175 Bacteria 4116
120 Ga0070712_100535223 3300006175 Bacteria 986
121 Ga0068871_100723494 3300006358 Bacteria 913
122 Ga0075428_100203181 3300006844 Bacteria 2142
123 Ga0075428_101339368 3300006844 Bacteria 752
124 Ga0075430_100078952 3300006846 Bacteria 2758
125 Ga0075430_100945156 3300006846 Unclassified 710
126 Ga0075430_101742825 3300006846 Bacteria 511
127 Ga0075431_100091165 3300006847 Bacteria 3146
128 Ga0075431_100624979 3300006847 Unclassified 1059
129 Ga0075431_100978036 3300006847 Bacteria 814
130 Ga0075429_100044342 3300006880 Bacteria 3870
131 Ga0075429_100071041 3300006880 Bacteria 3031
132 Ga0068865_100057192 3300006881 Bacteria 2720
133 Ga0068865_100162469 3300006881 Unclassified 1705
134 Ga0097620_100000005 3300006931 Bacteria 430800
135 Ga0097620_100037139 3300006931 Bacteria 4889
136 Ga0097620_100379266 3300006931 Bacteria 1509
137 Ga0097620_101095379 3300006931 Unclassified 876
138 Ga0075435_100227311 3300007076 Bacteria 1585
139 Ga0111539_10045170 3300009094 Bacteria 5274
140 Ga0105245_10012592 3300009098 Bacteria 7362
141 Ga0105245_10031964 3300009098 Bacteria 4660
142 Ga0105247_10309157 3300009101 Unclassified 1099
143 Ga0114129_10055875 3300009147 Bacteria 5532
144 Ga0114129_10467475 3300009147 Bacteria 1652
145 Ga0105243_10169636 3300009148 Bacteria 1889
146 Ga0105243_10204672 3300009148 Bacteria 1733
147 Ga0105241_10287247 3300009174 Unclassified 1407
148 Ga0105241_11783359 3300009174 Bacteria 600
149 Ga0105241_11852818 3300009174 Bacteria 590
150 Ga0105242_10014205 3300009176 Bacteria 6166
151 Ga0105242_11840152 3300009176 Bacteria 645
152 Ga0105248_10009672 3300009177 Bacteria 10623
153 Ga0105248_10019612 3300009177 Bacteria 7485
154 Ga0105248_10529855 3300009177 Bacteria 1329
155 Ga0105237_11037325 3300009545 Bacteria 827
156 Ga0105238_10092921 3300009551 Bacteria 3005
157 Ga0105249_10003140 3300009553 Bacteria 14285
158 Ga0105249_10996493 3300009553 Bacteria 907
159 Ga0105249_11008702 3300009553 Bacteria 901
160 Ga0105239_10622314 3300010375 Bacteria 1232
161 Ga0105239_11905259 3300010375 Bacteria 689
162 Ga0105246_10005065 3300011119 Bacteria 8017
163 Ga0157373_10011649 3300013100 Bacteria 6458
164 Ga0157371_10006195 3300013102 Bacteria 9919
165 Ga0157371_10019684 3300013102 Bacteria 4972
166 Ga0157369_10355715 3300013105 Bacteria 1521
167 Ga0157369_10771887 3300013105 Bacteria 988
168 Ga0157369_11996213 3300013105 Bacteria 589
169 Ga0157374_10094118 3300013296 Bacteria 2863
170 Ga0157374_11518502 3300013296 Bacteria 693
171 Ga0157378_12341056 3300013297 Unclassified 586
172 Ga0163162_10082837 3300013306 Bacteria 3280
173 Ga0163162_11279372 3300013306 Unclassified 833
174 Ga0157372_10000762 3300013307 Bacteria 34920
175 Ga0157372_10008232 3300013307 Bacteria 11082
176 Ga0157372_10090322 3300013307 Bacteria 3482
177 Ga0157372_10097013 3300013307 Bacteria 3361
178 Ga0157372_10654187 3300013307 Bacteria 1224
179 Ga0157372_10885617 3300013307 Bacteria 1036
180 Ga0157372_11110890 3300013307 Bacteria 914
181 Ga0157375_10022345 3300013308 Bacteria 5822
182 Ga0157375_10090437 3300013308 Bacteria 3120
183 Ga0163163_10197548 3300014325 Bacteria 2060
184 Ga0163163_10308465 3300014325 Bacteria 1635
185 Ga0157380_11476210 3300014326 Bacteria 732
186 Ga0157377_10008153 3300014745 Bacteria 5095
187 Ga0157377_10579161 3300014745 Bacteria 797
188 Ga0157379_10424992 3300014968 Bacteria 1224
189 Ga0157379_11050627 3300014968 Bacteria 778
190 Ga0157376_10019246 3300014969 Bacteria 5256
191 Ga0157376_10768213 3300014969 Unclassified 974
192 Ga0157376_10768630 3300014969 Bacteria 974
193 Ga0163161_10552040 3300017792 Bacteria 944
194 Ga0207656_10028469 3300025321 Bacteria 2294
195 Ga0207692_10503596 3300025898 Unclassified 769
196 Ga0207680_10598762 3300025903 Bacteria 788
197 Ga0207680_11059561 3300025903 Unclassified 580
198 Ga0207647_10183719 3300025904 Bacteria 1213
199 Ga0207699_10034740 3300025906 Bacteria 2862
200 Ga0207699_10937736 3300025906 Unclassified 639
201 Ga0207643_10004140 3300025908 Bacteria 7813
202 Ga0207643_10023126 3300025908 Bacteria 3426
203 Ga0207707_10016985 3300025912 Bacteria 6339
204 Ga0207693_10063841 3300025915 Bacteria 2885
205 Ga0207693_10230440 3300025915 Bacteria 1455
206 Ga0207693_10474463 3300025915 Bacteria 977
207 Ga0207663_10611029 3300025916 Unclassified 857
208 Ga0207660_10078644 3300025917 Bacteria 2417
209 Ga0207662_10040445 3300025918 Bacteria 2741
210 Ga0207657_10340151 3300025919 Unclassified 1184
211 Ga0207657_10908670 3300025919 Unclassified 678
212 Ga0207649_11452931 3300025920 Bacteria 543
213 Ga0207652_10148535 3300025921 Unclassified 2098
214 Ga0207652_10671040 3300025921 Bacteria 926
215 Ga0207652_11322482 3300025921 Bacteria 623
216 Ga0207681_10045638 3300025923 Bacteria 2943
217 Ga0207694_10085026 3300025924 Bacteria 2489
218 Ga0207650_10161387 3300025925 Bacteria 1776
219 Ga0207650_10725878 3300025925 Bacteria 840
220 Ga0207650_11338818 3300025925 Unclassified 609
221 Ga0207659_10015722 3300025926 Bacteria 4913
222 Ga0207659_10624814 3300025926 Unclassified 919
223 Ga0207687_10059182 3300025927 Unclassified 2698
224 Ga0207687_11255895 3300025927 Unclassified 637
225 Ga0207700_10001386 3300025928 Bacteria 13765
226 Ga0207700_10041542 3300025928 Bacteria 3365
227 Ga0207664_10028526 3300025929 Unclassified 4243
228 Ga0207664_10029096 3300025929 Bacteria 4205
229 Ga0207664_10773488 3300025929 Unclassified 864
230 Ga0207690_10012258 3300025932 Bacteria 5129
231 Ga0207690_10166403 3300025932 Bacteria 1648
232 Ga0207690_10247447 3300025932 Bacteria 1376
233 Ga0207706_10006529 3300025933 Bacteria 10809
234 Ga0207706_10296658 3300025933 Bacteria 1409
235 Ga0207686_10130393 3300025934 Unclassified 1723
236 Ga0207709_10087402 3300025935 Bacteria 2026
237 Ga0207709_10611535 3300025935 Bacteria 864
238 Ga0207670_10232861 3300025936 Unclassified 1415
239 Ga0207669_10450352 3300025937 Unclassified 1020
240 Ga0207704_10177911 3300025938 Unclassified 1534
241 Ga0207704_10207650 3300025938 Bacteria 1439
242 Ga0207665_10888388 3300025939 Unclassified 706
243 Ga0207691_10080790 3300025940 Bacteria 2923
244 Ga0207711_10010736 3300025941 Bacteria 7618
245 Ga0207711_10134366 3300025941 Unclassified 2221
246 Ga0207711_10687562 3300025941 Bacteria 954
247 Ga0207689_10042770 3300025942 Bacteria 3746
248 Ga0207661_10013758 3300025944 Bacteria 5909
249 Ga0207661_10196310 3300025944 Unclassified 1772
250 Ga0207661_10262219 3300025944 Bacteria 1539
251 Ga0207661_10488328 3300025944 Unclassified 1125
252 Ga0207661_10605252 3300025944 Bacteria 1006
253 Ga0207679_10101453 3300025945 Bacteria 2251
254 Ga0207679_11035195 3300025945 Bacteria 753
255 Ga0207667_11054020 3300025949 Bacteria 798
256 Ga0207667_11489326 3300025949 Bacteria 648
257 Ga0207651_10187313 3300025960 Bacteria 1648
258 Ga0207651_10199093 3300025960 Unclassified 1604
259 Ga0207651_11183223 3300025960 Unclassified 686
260 Ga0207712_10000298 3300025961 Bacteria 46541
261 Ga0207668_10039537 3300025972 Bacteria 3176
262 Ga0207658_10691050 3300025986 Bacteria 922
263 Ga0207658_11681774 3300025986 Unclassified 580
264 Ga0207677_10018423 3300026023 Bacteria 4189
265 Ga0207703_10046404 3300026035 Bacteria 3499
266 Ga0207703_10418079 3300026035 Bacteria 1247
267 Ga0207639_10171276 3300026041 Unclassified 1839
268 Ga0207708_10093860 3300026075 Bacteria 2316
269 Ga0207702_10110473 3300026078 Bacteria 2443
270 Ga0207702_10375153 3300026078 Bacteria 1367
271 Ga0207702_11455322 3300026078 Unclassified 679
272 Ga0207641_10025407 3300026088 Bacteria 4884
273 Ga0207641_11052501 3300026088 Bacteria 811
274 Ga0207648_10046356 3300026089 Bacteria 3811
275 Ga0207648_10727458 3300026089 Bacteria 921
276 Ga0207676_10005972 3300026095 Bacteria 8585
277 Ga0207676_10147474 3300026095 Bacteria 2022
278 Ga0207676_10388557 3300026095 Bacteria 1301
279 Ga0207674_10010291 3300026116 Bacteria 10611
280 Ga0207674_10012658 3300026116 Bacteria 9429
281 Ga0207675_100608725 3300026118 Bacteria 1096
282 Ga0207698_10022020 3300026142 Bacteria 4420
283 Ga0207698_12216682 3300026142 Bacteria 562
284 Ga0207428_10393549 3300027907 Bacteria 1015
285 Ga0268266_10446275 3300028379 Bacteria 1229
286 Ga0268265_10006917 3300028380 Bacteria 7671
287 Ga0268264_10459260 3300028381 Bacteria 1235
288 Ga0307408_100350554 3300031548 Bacteria 1252
289 Ga0316576_10120695 3300031727 Bacteria 1968
290 Ga0307405_10006249 3300031731 Bacteria 5842
291 Ga0307405_10030498 3300031731 Bacteria 3162
292 Ga0307413_10001080 3300031824 Bacteria 9953
293 Ga0307413_10027414 3300031824 Bacteria 3156
294 Ga0307413_10076107 3300031824 Bacteria 2132
295 Ga0307413_10953970 3300031824 Unclassified 732
296 Ga0307413_11465719 3300031824 Unclassified 602
297 Ga0307410_10008927 3300031852 Bacteria 5592
298 Ga0307410_10037619 3300031852 Bacteria 3162
299 Ga0307410_10167338 3300031852 Bacteria 1653
300 Ga0307410_10225846 3300031852 Bacteria 1443
301 Ga0307410_10491079 3300031852 Bacteria 1009
302 Ga0307410_10587962 3300031852 Unclassified 927
303 Ga0307406_10001581 3300031901 Bacteria 12542
304 Ga0307406_10015386 3300031901 Bacteria 4426
305 Ga0307406_11257338 3300031901 Bacteria 645
306 Ga0307406_11703681 3300031901 Bacteria 559
307 Ga0307407_10001087 3300031903 Bacteria 9471
308 Ga0307407_10100101 3300031903 Unclassified 1797
309 Ga0307407_10176906 3300031903 Bacteria 1410
310 Ga0307407_10705436 3300031903 Bacteria 760
311 Ga0307407_11089799 3300031903 Unclassified 620
312 Ga0307412_10017754 3300031911 Bacteria 4263
313 Ga0307412_10259013 3300031911 Bacteria 1355
314 Ga0307412_10553233 3300031911 Unclassified 967
315 Ga0307412_11270987 3300031911 Unclassified 661
316 Ga0307409_100037641 3300031995 Bacteria 3568
317 Ga0307409_100041726 3300031995 Bacteria 3430
318 Ga0307409_100042097 3300031995 Bacteria 3417
319 Ga0307409_100215041 3300031995 Bacteria 1731
320 Ga0307409_100604565 3300031995 Bacteria 1084
321 Ga0307409_101774071 3300031995 Bacteria 646
322 Ga0307409_102836763 3300031995 Unclassified 512
323 Ga0307416_100013451 3300032002 Bacteria 5562
324 Ga0307416_100045522 3300032002 Bacteria 3455
325 Ga0307416_100157372 3300032002 Bacteria 2094
326 Ga0307416_100209288 3300032002 Bacteria 1859
327 Ga0307416_100248344 3300032002 Unclassified 1730
328 Ga0307416_101534261 3300032002 Unclassified 772
329 Ga0307416_102670666 3300032002 Unclassified 596
330 Ga0307414_10016340 3300032004 Bacteria 4509
331 Ga0307414_10018368 3300032004 Bacteria 4303
332 Ga0307414_10232189 3300032004 Unclassified 1522
333 Ga0307411_10004091 3300032005 Bacteria 6914
334 Ga0307411_10004204 3300032005 Bacteria 6844
335 Ga0307411_10224312 3300032005 Bacteria 1460
336 Ga0307411_11118784 3300032005 Bacteria 711
337 Ga0307411_11740151 3300032005 Bacteria 578
338 Ga0307415_100028974 3300032126 Bacteria 3531
339 Ga0307415_100072528 3300032126 Bacteria 2425
340 Ga0373934_0018047 3300035086 Bacteria 2698
341 Ga0373936_0521585 3300035113 Bacteria 554
342 Ga0373941_0113109 3300035115 Bacteria 959
343 Ga0373953_0063951 3300035117 Bacteria 1508
344 Ga0373954_0062357 3300035118 Bacteria 1761
345 Ga0373956_0021801 3300035119 Bacteria 2734
346 Ga0373957_0039398 3300035120 Bacteria 1772
347 Ga0373961_0420473 3300035241 Unclassified 516
348 Ga0373931_0084655 3300035691 Bacteria 1756
349 Ga0373935_0826290 3300035692 Bacteria 685
350 Ga0373933_0006253 3300035724 Bacteria 6481
351 Ga0373937_0026446 3300036401 Bacteria 5244
352 Ga0373937_0411509 3300036401 Unclassified 1283
353 Ga0395905_0407726 3300037471 Bacteria 1254
354 Ga0436365_1872971 3300039437 Bacteria 723
355 Ga0436363_0443654 3300039450 Unclassified 924
356 Ga0450894_065253 3300042131 Unclassified 552
357 Ga0466963_0854581 3300044694 Bacteria 641
358 Ga0453684_2037703 3300044712 Unclassified 577
359 Ga0466959_1123996 3300045049 Bacteria 522
360 Ga0451576_0158900 3300045051 Bacteria 2358
361 Ga0451576_0419601 3300045051 Bacteria 1404
362 Ga0466967_0933257 3300045976 Bacteria 863
363 Ga0495629_0013197 3300046459 Bacteria 5965
364 Ga0495651_0013216 3300046462 Bacteria 6382
365 Ga0495653_0018995 3300046463 Bacteria 5577
366 Ga0495584_0691902 3300046491 Bacteria 520
367 Ga0495608_0062233 3300046511 Bacteria 2452
368 Ga0495628_0065269 3300046516 Bacteria 2848
369 Ga0495630_0034559 3300046517 Bacteria 3775
370 Ga0495652_0019030 3300046529 Bacteria 6118
371 Ga0495652_0452131 3300046529 Unclassified 899
372 Ga0495665_0168435 3300046531 Bacteria 1141
373 Ga0495587_0002972 3300046536 Bacteria 11336
374 Ga0495621_0289974 3300046539 Unclassified 676
375 Ga0495645_0011125 3300046543 Bacteria 6326
376 Ga0495645_0157252 3300046543 Bacteria 1574
377 Ga0495667_0027606 3300046559 Bacteria 3823
378 Ga0495656_0816738 3300046615 Bacteria 504
379 Ga0495634_0498964 3300046642 Bacteria 714
380 Ga0495635_0014172 3300046663 Bacteria 5578
381 Ga0495659_0382194 3300046664 Unclassified 606
382 Ga0495659_0452655 3300046664 Unclassified 559
383 Ga0495657_0010636 3300046675 Bacteria 6917
384 Ga0495599_0025096 3300046678 Bacteria 3730
385 Ga0495623_0007271 3300046679 Bacteria 7188
386 Ga0495646_0372364 3300046680 Bacteria 746
387 Ga0495658_0050742 3300046683 Bacteria 2348
388 Ga0495613_0449226 3300046689 Bacteria 873
389 Ga0495600_0003652 3300046809 Bacteria 9079
390 Ga0495581_0006978 3300047315 Bacteria 6543
391 Ga0495581_0371463 3300047315 Bacteria 835
392 Ga0495604_0338264 3300047317 Bacteria 1002
393 Ga0495674_0043838 3300047319 Bacteria 3979
394 Ga0495680_0037307 3300047322 Bacteria 3893
395 Ga0495680_0904527 3300047322 Unclassified 570
396 Ga0495675_0009805 3300047444 Bacteria 5972
397 Ga0495675_0056756 3300047444 Bacteria 2483
398 Ga0495684_0005010 3300047471 Bacteria 10331
399 Ga0495602_0024203 3300048088 Bacteria 5895
400 Ga0496105_1099482 3300048908 Bacteria 590
401 Ga0496108_0049864 3300048911 Bacteria 3502
402 Ga0496109_0163436 3300048912 Unclassified 2086
403 Ga0496111_0207464 3300048914 Bacteria 1456
404 Ga0496112_0006264 3300048915 Bacteria 10429
405 Ga0496113_0028466 3300048916 Bacteria 4020
406 Ga0501290_095076 3300049513 Bacteria 524
407 Ga0501292_113178 3300049515 Unclassified 548
408 Ga0501069_0903171 3300049585 Unclassified 537
409 Ga0501202_038946 3300049652 Bacteria 1020
410 Ga0501223_028240 3300049663 Bacteria 1093
411 Ga0501224_049022 3300049664 Unclassified 646
412 Ga0501235_197892 3300049669 Bacteria 543
413 Ga0501240_027282 3300049673 Bacteria 896
414 Ga0501249_075533 3300049679 Unclassified 789
415 Ga0501250_085691 3300049680 Bacteria 542
416 Ga0501253_040491 3300049683 Unclassified 936
417 Ga0501259_026031 3300049688 Bacteria 1075
418 Ga0501260_029352 3300049689 Unclassified 628
419 Ga0501081_1134841 3300049743 Unclassified 592
420 Ga0501268_018537 3300049765 Unclassified 1171
421 Ga0501270_014040 3300049767 Unclassified 1121
422 Ga0501270_142580 3300049767 Unclassified 540
423 Ga0501270_149139 3300049767 Unclassified 532
424 Ga0501273_084766 3300049770 Bacteria 531
425 Ga0501212_049067 3300049851 Bacteria 712
426 nmdc:mga05p37_1608497_c1 3300050507 Unclassified 639
427 nmdc:mga09592_1451785_c1 3300050508 Bacteria 559
428 nmdc:mga09592_246645_c1 3300050508 Unclassified 1548
429 nmdc:mga09592_35656_c1 3300050508 Bacteria 4165
430 nmdc:mga0qj67_1455862_c1 3300050509 Unclassified 528
431 nmdc:mga0qj67_509773_c1 3300050509 Bacteria 967
432 nmdc:mga06r32_1219922_c1 3300050510 Bacteria 698
433 nmdc:mga06r32_1656009_c1 3300050510 Bacteria 577
434 nmdc:mga08y16_52652_c1 3300050511 Bacteria 4258
435 nmdc:mga0rr50_1121776_c1 3300050513 Bacteria 669
436 Ga0495601_0004824 3300053077 Bacteria 7820
437 Ga0495601_0102783 3300053077 Unclassified 1847
438 Ga0495612_0001713 3300053078 Bacteria 8998
439 Ga0495595_0031246 3300053084 Bacteria 2393
440 Ga0495619_0096681 3300053085 Bacteria 2005
441 Ga0495619_0530262 3300053085 Unclassified 809
442 Ga0530510_0777873 3300061734 Unclassified 730
443 Ga0068856_100982785
444 Ga0058860_11272407
445 Ga0065707_10513727
446 Ga0065707_10533526
447 Ga0070683_100102013
448 Ga0070683_100165050
449 Ga0070683_100345275
450 Ga0070683_100576562
451 Ga0070683_100593620
452 Ga0070690_100819956
453 Ga0070670_100009190
454 Ga0070670_100309390
455 Ga0068869_100053190
456 Ga0070666_10301229
457 Ga0070666_11117001
458 Ga0070680_100011963
459 Ga0070680_101315376
460 Ga0070682_100017789
461 Ga0068868_100054702
462 Ga0070660_100066690
463 Ga0070660_100236692
464 Ga0070689_100041165
465 Ga0070689_100175097
466 Ga0070691_10306164
467 Ga0070687_100039623
468 Ga0070661_100014767
469 Ga0070661_100454466
470 Ga0070692_10074654
471 Ga0070692_10539595
472 Ga0070668_100039709
473 Ga0070669_100018699
474 Ga0070669_100791033
475 Ga0070669_101138381
476 Ga0070675_100024452
477 Ga0070675_100663010
478 Ga0070675_101503809
479 Ga0070674_100210997
480 Ga0070674_100344092
481 Ga0070673_100156004
482 Ga0070673_100419940
483 Ga0070673_100715744
484 Ga0070688_100213836
485 Ga0070659_100020378
486 Ga0070659_100204702
487 Ga0070667_100125463
488 Ga0070667_101086131
489 Ga0070667_101239435
490 Ga0070667_101416510
491 Ga0070709_10009532
492 Ga0070709_10069187
493 Ga0070709_10562298
494 Ga0070714_100004339
495 Ga0070714_100006121
496 Ga0070714_100936749
497 Ga0070713_100002013
498 Ga0070713_100107057
499 Ga0070713_101021329
500 Ga0070710_10157917
501 Ga0070700_100145709
502 Ga0070694_100840004
503 Ga0070662_100070333
504 Ga0070662_100121337
505 Ga0070681_10005172
506 Ga0068867_100073348
507 Ga0068867_100745440
508 Ga0070698_100395479
509 Ga0070698_100395486
510 Ga0070698_101139072
511 Ga0070699_100138918
512 Ga0070679_100076051
513 Ga0070679_100228583
514 Ga0070679_101242551
515 Ga0070684_100021380
516 Ga0070684_100032535
517 Ga0070684_100544170
518 Ga0070684_100944566
519 Ga0068853_100239049
520 Ga0070672_100013906
521 Ga0070686_100231557
522 Ga0070686_100569140
523 Ga0070695_100013064
524 Ga0070695_100189507
525 Ga0070696_100003503
526 Ga0070693_100008088
527 Ga0070693_100746771
528 Ga0070665_100022052
529 Ga0070704_100044536
530 Ga0070704_100343247
531 Ga0068855_100126683
532 Ga0068855_101943564
533 Ga0070664_100187153
534 Ga0070664_101610071
535 Ga0068857_100733081
536 Ga0068856_100028284
537 Ga0068856_102542244
538 Ga0068852_100022365
539 Ga0068859_100000005
540 Ga0068859_100037135
541 Ga0068859_100379257
542 Ga0068859_101095622
543 Ga0068864_100014236
544 Ga0068864_100091099
545 Ga0068864_100879287
546 Ga0068861_100800718
547 Ga0068861_102564022
548 Ga0068851_10274453
549 Ga0068870_10014991
550 Ga0068870_10047499
551 Ga0068863_100009660
552 Ga0068858_100154585
553 Ga0068858_100548825
554 Ga0068860_100707907
555 Ga0068862_100002809
556 Ga0081539_10000019
557 Ga0070717_10001409
558 Ga0070717_10403815
559 Ga0070716_101079950
560 Ga0070716_101249093
561 Ga0070712_100022936
562 Ga0070712_100535223
563 Ga0068871_100723494
564 Ga0075428_100203181
565 Ga0075428_101339368
566 Ga0075430_100078952
567 Ga0075430_100945156
568 Ga0075430_101742825
569 Ga0075431_100091165
570 Ga0075431_100624979
571 Ga0075431_100978036
572 Ga0075429_100044342
573 Ga0075429_100071041
574 Ga0068865_100057192
575 Ga0068865_100162469
576 Ga0097620_100000005
577 Ga0097620_100037139
578 Ga0097620_100379266
579 Ga0097620_101095379
580 Ga0075435_100227311
581 Ga0111539_10045170
582 Ga0105245_10012592
583 Ga0105245_10031964
584 Ga0105247_10309157
585 Ga0114129_10055875
586 Ga0114129_10467475
587 Ga0105243_10169636
588 Ga0105243_10204672
589 Ga0105241_10287247
590 Ga0105241_11783359
591 Ga0105241_11852818
592 Ga0105242_10014205
593 Ga0105242_11840152
594 Ga0105248_10009672
595 Ga0105248_10019612
596 Ga0105248_10529855
597 Ga0105237_11037325
598 Ga0105238_10092921
599 Ga0105249_10003140
600 Ga0105249_10996493
601 Ga0105249_11008702
602 Ga0105239_10622314
603 Ga0105239_11905259
604 Ga0105246_10005065
605 Ga0157373_10011649
606 Ga0157371_10006195
607 Ga0157371_10019684
608 Ga0157369_10355715
609 Ga0157369_10771887
610 Ga0157369_11996213
611 Ga0157374_10094118
612 Ga0157374_11518502
613 Ga0157378_12341056
614 Ga0163162_10082837
615 Ga0163162_11279372
616 Ga0157372_10000762
617 Ga0157372_10008232
618 Ga0157372_10090322
619 Ga0157372_10097013
620 Ga0157372_10654187
621 Ga0157372_10885617
622 Ga0157372_11110890
623 Ga0157375_10022345
624 Ga0157375_10090437
625 Ga0163163_10197548
626 Ga0163163_10308465
627 Ga0157380_11476210
628 Ga0157377_10008153
629 Ga0157377_10579161
630 Ga0157379_10424992
631 Ga0157379_11050627
632 Ga0157376_10019246
633 Ga0157376_10768213
634 Ga0157376_10768630
635 Ga0163161_10552040
636 Ga0207656_10028469
637 Ga0207692_10503596
638 Ga0207680_10598762
639 Ga0207680_11059561
640 Ga0207647_10183719
641 Ga0207699_10034740
642 Ga0207699_10937736
643 Ga0207643_10004140
644 Ga0207643_10023126
645 Ga0207707_10016985
646 Ga0207693_10063841
647 Ga0207693_10230440
648 Ga0207693_10474463
649 Ga0207663_10611029
650 Ga0207660_10078644
651 Ga0207662_10040445
652 Ga0207657_10340151
653 Ga0207657_10908670
654 Ga0207649_11452931
655 Ga0207652_10148535
656 Ga0207652_10671040
657 Ga0207652_11322482
658 Ga0207681_10045638
659 Ga0207694_10085026
660 Ga0207650_10161387
661 Ga0207650_10725878
662 Ga0207650_11338818
663 Ga0207659_10015722
664 Ga0207659_10624814
665 Ga0207687_10059182
666 Ga0207687_11255895
667 Ga0207700_10001386
668 Ga0207700_10041542
669 Ga0207664_10028526
670 Ga0207664_10029096
671 Ga0207664_10773488
672 Ga0207690_10012258
673 Ga0207690_10166403
674 Ga0207690_10247447
675 Ga0207706_10006529
676 Ga0207706_10296658
677 Ga0207686_10130393
678 Ga0207709_10087402
679 Ga0207709_10611535
680 Ga0207670_10232861
681 Ga0207669_10450352
682 Ga0207704_10177911
683 Ga0207704_10207650
684 Ga0207665_10888388
685 Ga0207691_10080790
686 Ga0207711_10010736
687 Ga0207711_10134366
688 Ga0207711_10687562
689 Ga0207689_10042770
690 Ga0207661_10013758
691 Ga0207661_10196310
692 Ga0207661_10262219
693 Ga0207661_10488328
694 Ga0207661_10605252
695 Ga0207679_10101453
696 Ga0207679_11035195
697 Ga0207667_11054020
698 Ga0207667_11489326
699 Ga0207651_10187313
700 Ga0207651_10199093
701 Ga0207651_11183223
702 Ga0207712_10000298
703 Ga0207668_10039537
704 Ga0207658_10691050
705 Ga0207658_11681774
706 Ga0207677_10018423
707 Ga0207703_10046404
708 Ga0207703_10418079
709 Ga0207639_10171276
710 Ga0207708_10093860
711 Ga0207702_10110473
712 Ga0207702_10375153
713 Ga0207702_11455322
714 Ga0207641_10025407
715 Ga0207641_11052501
716 Ga0207648_10046356
717 Ga0207648_10727458
718 Ga0207676_10005972
719 Ga0207676_10147474
720 Ga0207676_10388557
721 Ga0207674_10010291
722 Ga0207674_10012658
723 Ga0207675_100608725
724 Ga0207698_10022020
725 Ga0207698_12216682
726 Ga0207428_10393549
727 Ga0268266_10446275
728 Ga0268265_10006917
729 Ga0268264_10459260
730 Ga0307408_100350554
731 Ga0316576_10120695
732 Ga0307405_10006249
733 Ga0307405_10030498
734 Ga0307413_10001080
735 Ga0307413_10027414
736 Ga0307413_10076107
737 Ga0307413_10953970
738 Ga0307413_11465719
739 Ga0307410_10008927
740 Ga0307410_10037619
741 Ga0307410_10167338
742 Ga0307410_10225846
743 Ga0307410_10491079
744 Ga0307410_10587962
745 Ga0307406_10001581
746 Ga0307406_10015386
747 Ga0307406_11257338
748 Ga0307406_11703681
749 Ga0307407_10001087
750 Ga0307407_10100101
751 Ga0307407_10176906
752 Ga0307407_10705436
753 Ga0307407_11089799
754 Ga0307412_10017754
755 Ga0307412_10259013
756 Ga0307412_10553233
757 Ga0307412_11270987
758 Ga0307409_100037641
759 Ga0307409_100041726
760 Ga0307409_100042097
761 Ga0307409_100215041
762 Ga0307409_100604565
763 Ga0307409_101774071
764 Ga0307409_102836763
765 Ga0307416_100013451
766 Ga0307416_100045522
767 Ga0307416_100157372
768 Ga0307416_100209288
769 Ga0307416_100248344
770 Ga0307416_101534261
771 Ga0307416_102670666
772 Ga0307414_10016340
773 Ga0307414_10018368
774 Ga0307414_10232189
775 Ga0307411_10004091
776 Ga0307411_10004204
777 Ga0307411_10224312
778 Ga0307411_11118784
779 Ga0307411_11740151
780 Ga0307415_100028974
781 Ga0307415_100072528
782 Ga0373934_0018047
783 Ga0373936_0521585
784 Ga0373941_0113109
785 Ga0373953_0063951
786 Ga0373954_0062357
787 Ga0373956_0021801
788 Ga0373957_0039398
789 Ga0373961_0420473
790 Ga0373931_0084655
791 Ga0373935_0826290
792 Ga0373933_0006253
793 Ga0373937_0026446
794 Ga0373937_0411509
795 Ga0395905_0407726
796 Ga0436365_1872971
797 Ga0436363_0443654
798 Ga0450894_065253
799 Ga0466963_0854581
800 Ga0453684_2037703
801 Ga0466959_1123996
802 Ga0451576_0158900
803 Ga0451576_0419601
804 Ga0466967_0933257
805 Ga0495629_0013197
806 Ga0495651_0013216
807 Ga0495653_0018995
808 Ga0495584_0691902
809 Ga0495608_0062233
810 Ga0495628_0065269
811 Ga0495630_0034559
812 Ga0495652_0019030
813 Ga0495652_0452131
814 Ga0495665_0168435
815 Ga0495587_0002972
816 Ga0495621_0289974
817 Ga0495645_0011125
818 Ga0495645_0157252
819 Ga0495667_0027606
820 Ga0495656_0816738
821 Ga0495634_0498964
822 Ga0495635_0014172
823 Ga0495659_0382194
824 Ga0495659_0452655
825 Ga0495657_0010636
826 Ga0495599_0025096
827 Ga0495623_0007271
828 Ga0495646_0372364
829 Ga0495658_0050742
830 Ga0495613_0449226
831 Ga0495600_0003652
832 Ga0495581_0006978
833 Ga0495581_0371463
834 Ga0495604_0338264
835 Ga0495674_0043838
836 Ga0495680_0037307
837 Ga0495680_0904527
838 Ga0495675_0009805
839 Ga0495675_0056756
840 Ga0495684_0005010
841 Ga0495602_0024203
842 Ga0496105_1099482
843 Ga0496108_0049864
844 Ga0496109_0163436
845 Ga0496111_0207464
846 Ga0496112_0006264
847 Ga0496113_0028466
848 Ga0501290_095076
849 Ga0501292_113178
850 Ga0501069_0903171
851 Ga0501202_038946
852 Ga0501223_028240
853 Ga0501224_049022
854 Ga0501235_197892
855 Ga0501240_027282
856 Ga0501249_075533
857 Ga0501250_085691
858 Ga0501253_040491
859 Ga0501259_026031
860 Ga0501260_029352
861 Ga0501081_1134841
862 Ga0501268_018537
863 Ga0501270_014040
864 Ga0501270_142580
865 Ga0501270_149139
866 Ga0501273_084766
867 Ga0501212_049067
868 nmdc:mga05p37_1608497_c1
869 nmdc:mga09592_1451785_c1
870 nmdc:mga09592_246645_c1
871 nmdc:mga09592_35656_c1
872 nmdc:mga0qj67_1455862_c1
873 nmdc:mga0qj67_509773_c1
874 nmdc:mga06r32_1219922_c1
875 nmdc:mga06r32_1656009_c1
876 nmdc:mga08y16_52652_c1
877 nmdc:mga0rr50_1121776_c1
878 Ga0495601_0004824
879 Ga0495601_0102783
880 Ga0495612_0001713
881 Ga0495595_0031246
882 Ga0495619_0096681
883 Ga0495619_0530262
884 Ga0530510_0777873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

30

104

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9517 9 104
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9325 9 104
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9133 1 102
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.9111 9 104
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.9055 9 106
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9304 8 107 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9181 7 106 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9146 8 108 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9054 9 106 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9019 11 91 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6J4S1B4-F1-model_v4 Transcriptional regulator, PadR family 0.9969 14 107
AF-A0A4V2G1F2-F1-model_v4 PadR family transcriptional regulator 0.9923 8 107
AF-A0A2V6MFC0-F1-model_v4 PadR family transcriptional regulator 0.99 8 95
AF-A0A2V8HPL0-F1-model_v4 PadR family transcriptional regulator 0.9889 8 106
AF-A0A2V8J116-F1-model_v4 PadR family transcriptional regulator 0.9889 14 105

Map