F444756

General Info

Members Datasets Scaffolds Average Seq Length
441 255 882 308

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0025160|Ga0496121_0025160_2256_3338
Length 360
Sequence VVRRPHDHPRRRAPGRDPQSAAVNARDGREGGEAIVKRLYLILLVALLILVPLSLLAGRVWLNPFDPHARNLAIIVLQLRLPRAVLALVVGAGLGSAGAAMQGYLRNPLADPGLFGIAPGAALGAVLSFWTGYAASVWLLPLFALVGAGGAMALLALIAGRADGAMGGGIALFTLAGLMIASLAGALMSLAISLSPTPFAMSEIVTWLMGALADRSWREVGIATPLTFAGIALLALAGRSLDALTLGEAAARSLGVDPRRLQALLIGGIGLTVGASVAVAGIIGFVGLIVPHLVRPLTDRRPSSLLLPSALAGALLLLVSDVACRILPLAGGELRLGIALSLIGAPFFLRLLLTMRRGLA

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
218 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
219 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
223 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
226 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
227 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
228 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
229 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
230 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
231 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
232 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
233 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
234 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
235 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
236 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
237 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
238 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
239 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
240 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
241 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
242 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
243 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
244 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
245 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
246 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
247 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
248 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
249 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
250 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
251 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
252 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
253 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
254 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
255 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.2
Nodule 0.45
Rhizoplane 7.26
Rhizosphere 67.35
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0025160 3300048924 Bacteria 5661
2 SwRhRL2b_contig_3113019 2162886007 Bacteria 39820
3 JGI24739J22299_10000805 3300001989 Bacteria 11477
4 JGI24739J22299_10020437 3300001989 Bacteria 2366
5 JGI24737J22298_10001946 3300001990 Bacteria 7388
6 JGI24735J21928_10003470 3300002067 Bacteria 5369
7 JGI24738J21930_10000931 3300002075 Bacteria 8408
8 JGI24751J29686_10000239 3300002459 Bacteria 22167
9 JGI25406J46586_10006065 3300003203 Bacteria 5585
10 Ga0065714_10120717 3300005288 Unclassified 1351
11 Ga0065704_10000192 3300005289 Bacteria 216848
12 Ga0065704_10000296 3300005289 Bacteria 57332
13 Ga0065712_10076521 3300005290 Bacteria 3646
14 Ga0070658_10000730 3300005327 Bacteria 28340
15 Ga0070658_10003221 3300005327 Bacteria 13481
16 Ga0070658_10114082 3300005327 Bacteria 2240
17 Ga0070658_10153542 3300005327 Bacteria 1929
18 Ga0070690_100009382 3300005330 Bacteria 5667
19 Ga0068869_100150232 3300005334 Unclassified 1806
20 Ga0070666_10015224 3300005335 Bacteria 4904
21 Ga0070682_100122500 3300005337 Unclassified 1748
22 Ga0070660_100017147 3300005339 Bacteria 5273
23 Ga0070689_100000449 3300005340 Bacteria 24329
24 Ga0070687_100000786 3300005343 Bacteria 10550
25 Ga0070661_100010033 3300005344 Bacteria 6574
26 Ga0070661_100387350 3300005344 Bacteria 1103
27 Ga0070692_10231507 3300005345 Unclassified 1097
28 Ga0070668_100033518 3300005347 Bacteria 3911
29 Ga0070669_100000137 3300005353 Bacteria 65956
30 Ga0070669_100000455 3300005353 Bacteria 31134
31 Ga0070669_100012477 3300005353 Bacteria 6029
32 Ga0070669_100098689 3300005353 Bacteria 2200
33 Ga0070675_100000663 3300005354 Bacteria 23791
34 Ga0070671_100000031 3300005355 Bacteria 108269
35 Ga0070671_100000444 3300005355 Bacteria 28779
36 Ga0070671_100003952 3300005355 Bacteria 11668
37 Ga0070673_100002486 3300005364 Bacteria 11250
38 Ga0070688_100006712 3300005365 Bacteria 6166
39 Ga0070667_100000157 3300005367 Bacteria 84556
40 Ga0070667_100000654 3300005367 Bacteria 33644
41 Ga0070667_100004476 3300005367 Bacteria 11786
42 Ga0070667_100020216 3300005367 Bacteria 5528
43 Ga0070667_100106786 3300005367 Bacteria 2423
44 Ga0070701_10004515 3300005438 Bacteria 5650
45 Ga0070678_100071530 3300005456 Bacteria 2597
46 Ga0070662_100297654 3300005457 Bacteria 1310
47 Ga0068867_100103174 3300005459 Unclassified 2181
48 Ga0070685_10172841 3300005466 Bacteria 1386
49 Ga0070679_100013935 3300005530 Bacteria 7704
50 Ga0070679_100031084 3300005530 Bacteria 5274
51 Ga0070684_100006160 3300005535 Bacteria 9248
52 Ga0068853_100079017 3300005539 Bacteria 2876
53 Ga0068853_100191542 3300005539 Bacteria 1858
54 Ga0070672_100014110 3300005543 Bacteria 5654
55 Ga0070686_100008879 3300005544 Bacteria 5633
56 Ga0070686_100017781 3300005544 Bacteria 4161
57 Ga0070665_100000766 3300005548 Bacteria 42469
58 Ga0070665_100000969 3300005548 Bacteria 36490
59 Ga0070665_100001456 3300005548 Bacteria 27714
60 Ga0070665_100010323 3300005548 Bacteria 9446
61 Ga0070665_100017767 3300005548 Bacteria 7141
62 Ga0070665_100037203 3300005548 Bacteria 4896
63 Ga0070665_100110886 3300005548 Bacteria 2746
64 Ga0068855_100033012 3300005563 Bacteria 6179
65 Ga0068855_100076548 3300005563 Bacteria 3883
66 Ga0068855_100323450 3300005563 Bacteria 1704
67 Ga0070664_100003031 3300005564 Bacteria 13583
68 Ga0068857_100005868 3300005577 Bacteria 10484
69 Ga0068857_100009973 3300005577 Bacteria 8246
70 Ga0068857_100426011 3300005577 Bacteria 1238
71 Ga0068854_100006417 3300005578 Bacteria 7482
72 Ga0068854_100142899 3300005578 Bacteria 1838
73 Ga0068854_100214748 3300005578 Unclassified 1519
74 Ga0068856_100019387 3300005614 Bacteria 6602
75 Ga0070702_100000425 3300005615 Bacteria 14988
76 Ga0068852_100000148 3300005616 Bacteria 47327
77 Ga0068852_100086874 3300005616 Bacteria 2789
78 Ga0068859_100005918 3300005617 Bacteria 12406
79 Ga0068859_100020191 3300005617 Bacteria 6690
80 Ga0068864_100007996 3300005618 Bacteria 8720
81 Ga0068861_100015327 3300005719 Bacteria 5398
82 Ga0068861_100046362 3300005719 Bacteria 3276
83 Ga0068870_10056709 3300005840 Unclassified 2092
84 Ga0068863_100000138 3300005841 Bacteria 77596
85 Ga0068863_100003773 3300005841 Bacteria 14983
86 Ga0068863_100019679 3300005841 Bacteria 6457
87 Ga0068863_100044925 3300005841 Bacteria 4192
88 Ga0068863_100077267 3300005841 Bacteria 3151
89 Ga0068863_100131671 3300005841 Bacteria 2388
90 Ga0068858_100019904 3300005842 Bacteria 6274
91 Ga0068858_100154555 3300005842 Bacteria 2158
92 Ga0068858_100201054 3300005842 Bacteria 1884
93 Ga0068860_100000028 3300005843 Bacteria 266461
94 Ga0068860_100013293 3300005843 Bacteria 8073
95 Ga0068860_100019515 3300005843 Bacteria 6572
96 Ga0068860_100022159 3300005843 Bacteria 6149
97 Ga0068860_100023042 3300005843 Bacteria 6022
98 Ga0068860_100029116 3300005843 Bacteria 5312
99 Ga0068860_100078683 3300005843 Bacteria 3135
100 Ga0068862_100008189 3300005844 Bacteria 8642
101 Ga0068862_100012039 3300005844 Bacteria 7148
102 Ga0068862_100077513 3300005844 Bacteria 2878
103 Ga0068862_100103842 3300005844 Bacteria 2489
104 Ga0081455_10004524 3300005937 Bacteria 15532
105 Ga0081539_10000016 3300005985 Bacteria 381648
106 Ga0075365_10007600 3300006038 Bacteria 6087
107 Ga0075368_10000279 3300006042 Bacteria 14708
108 Ga0075363_100171339 3300006048 Bacteria 1232
109 Ga0075364_10133776 3300006051 Bacteria 1665
110 Ga0075432_10016234 3300006058 Bacteria 2541
111 Ga0075362_10000038 3300006177 Bacteria 48567
112 Ga0075362_10005134 3300006177 Bacteria 4768
113 Ga0075367_10074944 3300006178 Bacteria 2040
114 Ga0075369_10009512 3300006186 Bacteria 3779
115 Ga0075369_10059451 3300006186 Bacteria 1665
116 Ga0075366_10000020 3300006195 Bacteria 57286
117 Ga0075366_10041170 3300006195 Bacteria 2734
118 Ga0075370_10000020 3300006353 Bacteria 57778
119 Ga0075370_10005413 3300006353 Bacteria 6344
120 Ga0075370_10071163 3300006353 Bacteria 1990
121 Ga0068871_100279063 3300006358 Bacteria 1461
122 Ga0075429_100007838 3300006880 Bacteria 9277
123 Ga0068865_100027761 3300006881 Bacteria 3742
124 Ga0097620_100005918 3300006931 Bacteria 12406
125 Ga0097620_100020191 3300006931 Bacteria 6690
126 Ga0075435_100452758 3300007076 Bacteria 1107
127 Ga0105251_10010139 3300009011 Bacteria 5494
128 Ga0105250_10005557 3300009092 Bacteria 5638
129 Ga0105240_10002335 3300009093 Bacteria 30672
130 Ga0105240_10013604 3300009093 Bacteria 11164
131 Ga0105240_10032880 3300009093 Bacteria 6708
132 Ga0105247_10064763 3300009101 Bacteria 2272
133 Ga0114129_10002803 3300009147 Bacteria 24325
134 Ga0105243_10218757 3300009148 Unclassified 1682
135 Ga0105248_10002853 3300009177 Bacteria 19181
136 Ga0105248_10020718 3300009177 Bacteria 7285
137 Ga0105248_10031000 3300009177 Bacteria 5974
138 Ga0105248_10492493 3300009177 Bacteria 1382
139 Ga0105237_10020113 3300009545 Bacteria 6890
140 Ga0105237_10060111 3300009545 Bacteria 3802
141 Ga0105249_10030187 3300009553 Bacteria 4899
142 Ga0105249_10064131 3300009553 Bacteria 3377
143 Ga0105239_10000031 3300010375 Bacteria 226947
144 Ga0163162_10017641 3300013306 Bacteria 6983
145 Ga0163162_10063790 3300013306 Bacteria 3728
146 Ga0163162_10072254 3300013306 Bacteria 3505
147 Ga0163162_10177883 3300013306 Bacteria 2253
148 Ga0157372_10034954 3300013307 Bacteria 5530
149 Ga0157375_10080503 3300013308 Bacteria 3295
150 Ga0163163_10005747 3300014325 Bacteria 10767
151 Ga0157377_10002348 3300014745 Bacteria 8346
152 Ga0157379_10228719 3300014968 Unclassified 1686
153 Ga0209455_1002960 3300025272 Bacteria 6246
154 Ga0207696_1008139 3300025711 Bacteria 4042
155 Ga0207713_1005355 3300025735 Bacteria 8056
156 Ga0207713_1009507 3300025735 Bacteria 5472
157 Ga0207710_10116074 3300025900 Bacteria 1274
158 Ga0207688_10029044 3300025901 Unclassified 3042
159 Ga0207647_10003114 3300025904 Bacteria 12459
160 Ga0207647_10111615 3300025904 Bacteria 1616
161 Ga0207705_10000023 3300025909 Bacteria 301755
162 Ga0207705_10004449 3300025909 Bacteria 10590
163 Ga0207705_10010586 3300025909 Bacteria 6703
164 Ga0207705_10047990 3300025909 Bacteria 3071
165 Ga0207695_10005422 3300025913 Bacteria 16927
166 Ga0207695_10044466 3300025913 Bacteria 4724
167 Ga0207671_10006733 3300025914 Bacteria 10176
168 Ga0207671_10020607 3300025914 Bacteria 5015
169 Ga0207662_10009814 3300025918 Bacteria 5283
170 Ga0207657_10013700 3300025919 Bacteria 7942
171 Ga0207649_10030250 3300025920 Unclassified 3205
172 Ga0207649_10355875 3300025920 Bacteria 1085
173 Ga0207652_10001918 3300025921 Bacteria 17995
174 Ga0207652_10030673 3300025921 Bacteria 4505
175 Ga0207652_10222094 3300025921 Bacteria 1702
176 Ga0207681_10000590 3300025923 Bacteria 24685
177 Ga0207681_10024312 3300025923 Bacteria 3887
178 Ga0207681_10088880 3300025923 Bacteria 2201
179 Ga0207650_10018477 3300025925 Bacteria 4893
180 Ga0207644_10000018 3300025931 Bacteria 174861
181 Ga0207644_10002089 3300025931 Bacteria 12934
182 Ga0207644_10002518 3300025931 Bacteria 11778
183 Ga0207644_10012093 3300025931 Bacteria 5726
184 Ga0207690_10101889 3300025932 Bacteria 2052
185 Ga0207690_10118583 3300025932 Bacteria 1918
186 Ga0207706_10009478 3300025933 Bacteria 8940
187 Ga0207706_10035701 3300025933 Bacteria 4418
188 Ga0207670_10007016 3300025936 Bacteria 6271
189 Ga0207704_10031549 3300025938 Bacteria 2987
190 Ga0207691_10065489 3300025940 Bacteria 3289
191 Ga0207711_10004261 3300025941 Bacteria 12222
192 Ga0207711_10197359 3300025941 Bacteria 1836
193 Ga0207679_10008797 3300025945 Bacteria 6438
194 Ga0207667_10027763 3300025949 Bacteria 6156
195 Ga0207667_10240521 3300025949 Bacteria 1853
196 Ga0207651_10019316 3300025960 Bacteria 4080
197 Ga0207712_10027543 3300025961 Bacteria 3796
198 Ga0207712_10168948 3300025961 Bacteria 1707
199 Ga0207640_10000228 3300025981 Bacteria 39076
200 Ga0207640_10124419 3300025981 Bacteria 1854
201 Ga0207640_10253304 3300025981 Unclassified 1368
202 Ga0207658_10005189 3300025986 Bacteria 8970
203 Ga0207658_10005346 3300025986 Bacteria 8828
204 Ga0207658_10009876 3300025986 Bacteria 6484
205 Ga0207658_10044345 3300025986 Bacteria 3238
206 Ga0207703_10002196 3300026035 Bacteria 17129
207 Ga0207703_10038060 3300026035 Bacteria 3836
208 Ga0207703_10102027 3300026035 Bacteria 2434
209 Ga0207703_10113745 3300026035 Bacteria 2313
210 Ga0207639_10160932 3300026041 Bacteria 1891
211 Ga0207702_10024781 3300026078 Bacteria 4978
212 Ga0207641_10001046 3300026088 Bacteria 27960
213 Ga0207641_10002102 3300026088 Bacteria 18830
214 Ga0207641_10013549 3300026088 Bacteria 6689
215 Ga0207641_10016444 3300026088 Bacteria 6058
216 Ga0207641_10232864 3300026088 Bacteria 1713
217 Ga0207648_10043168 3300026089 Bacteria 3959
218 Ga0207676_10006646 3300026095 Bacteria 8174
219 Ga0207676_10118686 3300026095 Bacteria 2226
220 Ga0207676_10174710 3300026095 Bacteria 1875
221 Ga0207674_10008384 3300026116 Bacteria 11952
222 Ga0207674_10016159 3300026116 Bacteria 8177
223 Ga0207675_100001659 3300026118 Bacteria 22267
224 Ga0207675_100025903 3300026118 Bacteria 5457
225 Ga0207683_10035813 3300026121 Bacteria 4317
226 Ga0207698_10000685 3300026142 Bacteria 19678
227 Ga0207698_10045554 3300026142 Bacteria 3306
228 Ga0207698_10314479 3300026142 Bacteria 1464
229 Ga0209813_10000047 3300027866 Bacteria 49657
230 Ga0207428_10052393 3300027907 Bacteria 3259
231 Ga0268266_10000002 3300028379 Bacteria 3059047
232 Ga0268266_10001804 3300028379 Bacteria 24265
233 Ga0268266_10029255 3300028379 Bacteria 4683
234 Ga0268266_10042451 3300028379 Bacteria 3885
235 Ga0268266_10070700 3300028379 Unclassified 3024
236 Ga0268265_10004619 3300028380 Bacteria 9511
237 Ga0268265_10007669 3300028380 Bacteria 7283
238 Ga0268265_10011165 3300028380 Bacteria 6070
239 Ga0268264_10000066 3300028381 Bacteria 285125
240 Ga0268264_10016487 3300028381 Bacteria 6050
241 Ga0268264_10027474 3300028381 Bacteria 4650
242 Ga0268264_10060571 3300028381 Bacteria 3173
243 Ga0268264_10100148 3300028381 Bacteria 2516
244 Ga0265331_10049502 3300031250 Bacteria 2018
245 Ga0307408_100005165 3300031548 Bacteria 8756
246 Ga0316576_10239821 3300031727 Bacteria 1362
247 Ga0307405_10117274 3300031731 Bacteria 1815
248 Ga0307413_10104392 3300031824 Bacteria 1881
249 Ga0307406_10062463 3300031901 Bacteria 2410
250 Ga0307406_10340919 3300031901 Bacteria 1167
251 Ga0307412_10003836 3300031911 Bacteria 8351
252 Ga0307412_10009936 3300031911 Bacteria 5473
253 Ga0307412_10023532 3300031911 Bacteria 3791
254 Ga0307412_10267154 3300031911 Bacteria 1337
255 Ga0307416_100016829 3300032002 Bacteria 5095
256 Ga0307416_100100151 3300032002 Bacteria 2519
257 Ga0307414_10007583 3300032004 Bacteria 6103
258 Ga0307414_10048286 3300032004 Bacteria 2935
259 Ga0316583_10015786 3300032133 Bacteria 2720
260 Ga0316574_0003601 3300035398 Bacteria 8019
261 Ga0316584_0020811 3300036712 Bacteria 4763
262 Ga0395900_0054248 3300037418 Bacteria 4127
263 Ga0395905_0064102 3300037471 Bacteria 3438
264 Ga0395901_0027288 3300038443 Bacteria 5866
265 Ga0400487_36419 3300039110 Bacteria 7258
266 Ga0400487_54596 3300039110 Bacteria 1924
267 Ga0436363_0911720 3300039450 Bacteria 2073
268 Ga0439448_0004676 3300042005 Bacteria 3874
269 Ga0439448_0051257 3300042005 Bacteria 1351
270 Ga0439458_0000191 3300042157 Bacteria 14057
271 Ga0439464_0041373 3300042439 Bacteria 1314
272 Ga0466966_0014858 3300044684 Bacteria 5151
273 Ga0466961_0046743 3300044693 Bacteria 2767
274 Ga0453684_0224038 3300044712 Bacteria 2176
275 Ga0466971_0092454 3300044719 Bacteria 1386
276 Ga0466970_0007112 3300044765 Bacteria 5601
277 Ga0451576_0000023 3300045051 Bacteria 477965
278 Ga0451576_0082464 3300045051 Bacteria 3344
279 Ga0495627_001124 3300046453 Bacteria 17381
280 Ga0495650_0003145 3300046471 Bacteria 12357
281 Ga0495596_0000193 3300046500 Bacteria 42101
282 Ga0495607_0003996 3300046501 Bacteria 11075
283 Ga0495606_0091557 3300046507 Bacteria 1869
284 Ga0495610_0000384 3300046512 Bacteria 45667
285 Ga0495620_0014877 3300046515 Bacteria 3944
286 Ga0495632_0005056 3300046519 Bacteria 8826
287 Ga0495643_0003644 3300046522 Bacteria 11186
288 Ga0495643_0008735 3300046522 Bacteria 6388
289 Ga0495609_0019628 3300046538 Bacteria 3125
290 Ga0495668_0062394 3300046616 Bacteria 2054
291 Ga0495625_0019297 3300046660 Bacteria 5293
292 Ga0495681_0000114 3300047470 Bacteria 69843
293 Ga0495681_0069583 3300047470 Bacteria 1598
294 Ga0495615_0000286 3300048090 Bacteria 9008
295 Ga0495615_0000550 3300048090 Bacteria 5314
296 Ga0496100_0024802 3300048903 Bacteria 3662
297 Ga0496101_0026033 3300048904 Bacteria 4064
298 Ga0496101_0286798 3300048904 Unclassified 1288
299 Ga0496101_0346467 3300048904 Bacteria 1167
300 Ga0496102_0000472 3300048905 Bacteria 44602
301 Ga0496102_0000888 3300048905 Bacteria 28393
302 Ga0496102_0037610 3300048905 Bacteria 4366
303 Ga0496102_0150639 3300048905 Bacteria 2186
304 Ga0496103_0000318 3300048906 Bacteria 44504
305 Ga0496103_0001965 3300048906 Bacteria 13292
306 Ga0496104_0000429 3300048907 Bacteria 36430
307 Ga0496104_0065225 3300048907 Bacteria 3455
308 Ga0496104_0122502 3300048907 Bacteria 2496
309 Ga0496105_0023359 3300048908 Bacteria 5013
310 Ga0496105_0048118 3300048908 Bacteria 3519
311 Ga0496106_0000500 3300048909 Bacteria 27760
312 Ga0496106_0074653 3300048909 Unclassified 2596
313 Ga0496107_0000883 3300048910 Bacteria 17669
314 Ga0496107_0277279 3300048910 Bacteria 1248
315 Ga0496108_0048337 3300048911 Bacteria 3557
316 Ga0496109_0398972 3300048912 Unclassified 1299
317 Ga0496110_0137819 3300048913 Bacteria 2206
318 Ga0496110_0145723 3300048913 Unclassified 2142
319 Ga0496111_0004648 3300048914 Bacteria 8692
320 Ga0496111_0190659 3300048914 Bacteria 1524
321 Ga0496112_0021913 3300048915 Bacteria 6080
322 Ga0496112_0152246 3300048915 Unclassified 2280
323 Ga0496113_0005908 3300048916 Bacteria 7688
324 Ga0496113_0213007 3300048916 Unclassified 1538
325 Ga0496114_0008919 3300048917 Bacteria 7951
326 Ga0496115_0253243 3300048918 Bacteria 1449
327 Ga0496116_0000017 3300048919 Bacteria 554463
328 Ga0496116_0004093 3300048919 Bacteria 14077
329 Ga0496117_0000946 3300048920 Bacteria 44400
330 Ga0496117_0006179 3300048920 Bacteria 12227
331 Ga0496117_0053005 3300048920 Bacteria 2853
332 Ga0496117_0097426 3300048920 Bacteria 1873
333 Ga0496118_0000133 3300048921 Bacteria 131319
334 Ga0496118_0007585 3300048921 Bacteria 11440
335 Ga0496118_0013786 3300048921 Bacteria 7617
336 Ga0496118_0090915 3300048921 Bacteria 2101
337 Ga0496119_0005174 3300048922 Bacteria 12620
338 Ga0496119_0035752 3300048922 Bacteria 3250
339 Ga0496119_0080214 3300048922 Bacteria 1883
340 Ga0496120_0021657 3300048923 Bacteria 4057
341 Ga0496120_0071581 3300048923 Bacteria 1903
342 Ga0496121_0000069 3300048924 Bacteria 253087
343 Ga0496121_0000548 3300048924 Bacteria 70933
344 Ga0496121_0006009 3300048924 Bacteria 15320
345 Ga0496121_0021929 3300048924 Bacteria 6230
346 Ga0496121_0022901 3300048924 Bacteria 6037
347 Ga0496122_0001443 3300048925 Bacteria 38468
348 Ga0496122_0003579 3300048925 Bacteria 20274
349 Ga0496122_0017425 3300048925 Bacteria 6717
350 Ga0496122_0019209 3300048925 Bacteria 6254
351 Ga0496122_0031417 3300048925 Bacteria 4419
352 Ga0496122_0075742 3300048925 Bacteria 2372
353 Ga0496123_0001836 3300048926 Bacteria 27868
354 Ga0496123_0005017 3300048926 Bacteria 13549
355 Ga0496123_0006708 3300048926 Bacteria 11089
356 Ga0496123_0006943 3300048926 Bacteria 10813
357 Ga0496123_0011252 3300048926 Bacteria 7779
358 Ga0496124_0000129 3300048927 Bacteria 156648
359 Ga0496124_0000359 3300048927 Bacteria 83092
360 Ga0496124_0001643 3300048927 Bacteria 32031
361 Ga0496124_0002864 3300048927 Bacteria 21806
362 Ga0496124_0004156 3300048927 Bacteria 17086
363 Ga0496124_0008149 3300048927 Bacteria 11001
364 Ga0496124_0012751 3300048927 Bacteria 8262
365 Ga0496124_0023451 3300048927 Bacteria 5633
366 Ga0496124_0067241 3300048927 Bacteria 2982
367 Ga0496125_0021284 3300048928 Bacteria 6056
368 Ga0496125_0025814 3300048928 Bacteria 5370
369 Ga0496125_0050705 3300048928 Bacteria 3433
370 Ga0496125_0146412 3300048928 Bacteria 1631
371 Ga0496126_0000696 3300048929 Bacteria 61450
372 Ga0496126_0018904 3300048929 Bacteria 6808
373 Ga0496126_0030370 3300048929 Bacteria 5119
374 Ga0496126_0032794 3300048929 Bacteria 4890
375 Ga0501034_0003838 3300049571 Bacteria 16935
376 Ga0501047_0146921 3300049581 Bacteria 2234
377 Ga0501223_000268 3300049663 Bacteria 13035
378 Ga0501224_000019 3300049664 Bacteria 78204
379 Ga0501233_001194 3300049668 Bacteria 4415
380 Ga0501225_0000054 3300049705 Bacteria 38897
381 Ga0501226_000092 3300049853 Bacteria 23051
382 nmdc:mga03683_1148_c1 3300050489 Bacteria 7789
383 nmdc:mga03683_817_c1 3300050489 Bacteria 8911
384 nmdc:mga00v17_133555_c1 3300050491 Bacteria 1587
385 nmdc:mga00v17_24215_c1 3300050491 Bacteria 3520
386 nmdc:mga0yw44_43663_c1 3300050492 Bacteria 2678
387 nmdc:mga0k408_14886_c1 3300050493 Bacteria 4294
388 nmdc:mga0k408_52_c1 3300050493 Bacteria 58194
389 nmdc:mga06z11_402_c1 3300050494 Bacteria 16285
390 nmdc:mga04h51_2827_c1 3300050495 Bacteria 4155
391 nmdc:mga07m45_107_c1 3300050496 Bacteria 33126
392 nmdc:mga07m45_33077_c1 3300050496 Bacteria 2253
393 nmdc:mga07m45_45_c1 3300050496 Bacteria 57783
394 nmdc:mga05p37_539904_c1 3300050507 Bacteria 1330
395 nmdc:mga09592_326240_c1 3300050508 Bacteria 1330
396 nmdc:mga06r32_8875_c1 3300050510 Bacteria 9059
397 nmdc:mga0sz30_1161_c1 3300050516 Bacteria 9436
398 nmdc:mga0sz30_57329_c1 3300050516 Bacteria 1660
399 nmdc:mga0sz30_9015_c1 3300050516 Bacteria 3783
400 Ga0500643_000822 3300053087 Bacteria 20046
401 Ga0500651_0057100 3300053093 Bacteria 2443
402 Ga0500641_0006490 3300053096 Bacteria 4150
403 Ga0500607_004527 3300053121 Bacteria 9528
404 Ga0500607_087926 3300053121 Bacteria 1570
405 Ga0500608_000087 3300053122 Bacteria 37903
406 Ga0500658_0022248 3300053134 Bacteria 2408
407 Ga0500559_0016622 3300053136 Bacteria 3107
408 Ga0500564_001604 3300053138 Bacteria 7927
409 Ga0500573_0144411 3300053140 Bacteria 1308
410 Ga0500588_0012375 3300053146 Bacteria 2114
411 Ga0500590_024960 3300053148 Bacteria 3104
412 Ga0500567_005407 3300053723 Bacteria 5891
413 Ga0500625_000009 3300053729 Bacteria 159296
414 2511128215 2510917021 Bacteria 5705459
415 2513589806 2513237087 Bacteria 5817514
416 2585260537 2582581305 Bacteria 4895574
417 2600228813 2599185359 Bacteria 4772316
418 2738709774 2738541275 Bacteria 4830863
419 2738848199 2738541301 Bacteria 4834102
420 2738863928 2738541304 Bacteria 4833665
421 2739296446 2738543022 Bacteria 4835059
422 2739358124 2738543033 Bacteria 4833336
423 2739649393 2739367664 Bacteria 4114334
424 2740027866 2739367865 Bacteria 4114482
425 2819552519 2818991438 Bacteria 5793701
426 2819714639 2818991466 Bacteria 4748179
427 2828307026 2828305725 Bacteria 4916900
428 2829748968 2829745981 Bacteria 5406054
429 2830076602 2830075706 Bacteria 3855215
430 2861696866 2861691609 Bacteria 5628931
431 2879165261 2879163058 Bacteria 4223965
432 2896185188 2896184354 Bacteria 3258548
433 2896255588 2896253425 Bacteria 3418029
434 2919141720 2919138771 Bacteria 5281312
435 2928101330 2928100450 Bacteria 4837635
436 2928529142 2928526807 Bacteria 4760224
437 2928960259 2928959182 Bacteria 4725774
438 2928968686 2928968154 Bacteria 4633371
439 2946789609 2946787523 Bacteria 4366789
440 3003669336 3003665799 Bacteria 7279786
441 643592745 643348564 Bacteria 8839022
442 Ga0496121_0025160
443 SwRhRL2b_contig_3113019
444 JGI24739J22299_10000805
445 JGI24739J22299_10020437
446 JGI24737J22298_10001946
447 JGI24735J21928_10003470
448 JGI24738J21930_10000931
449 JGI24751J29686_10000239
450 JGI25406J46586_10006065
451 Ga0065714_10120717
452 Ga0065704_10000192
453 Ga0065704_10000296
454 Ga0065712_10076521
455 Ga0070658_10000730
456 Ga0070658_10003221
457 Ga0070658_10114082
458 Ga0070658_10153542
459 Ga0070690_100009382
460 Ga0068869_100150232
461 Ga0070666_10015224
462 Ga0070682_100122500
463 Ga0070660_100017147
464 Ga0070689_100000449
465 Ga0070687_100000786
466 Ga0070661_100010033
467 Ga0070661_100387350
468 Ga0070692_10231507
469 Ga0070668_100033518
470 Ga0070669_100000137
471 Ga0070669_100000455
472 Ga0070669_100012477
473 Ga0070669_100098689
474 Ga0070675_100000663
475 Ga0070671_100000031
476 Ga0070671_100000444
477 Ga0070671_100003952
478 Ga0070673_100002486
479 Ga0070688_100006712
480 Ga0070667_100000157
481 Ga0070667_100000654
482 Ga0070667_100004476
483 Ga0070667_100020216
484 Ga0070667_100106786
485 Ga0070701_10004515
486 Ga0070678_100071530
487 Ga0070662_100297654
488 Ga0068867_100103174
489 Ga0070685_10172841
490 Ga0070679_100013935
491 Ga0070679_100031084
492 Ga0070684_100006160
493 Ga0068853_100079017
494 Ga0068853_100191542
495 Ga0070672_100014110
496 Ga0070686_100008879
497 Ga0070686_100017781
498 Ga0070665_100000766
499 Ga0070665_100000969
500 Ga0070665_100001456
501 Ga0070665_100010323
502 Ga0070665_100017767
503 Ga0070665_100037203
504 Ga0070665_100110886
505 Ga0068855_100033012
506 Ga0068855_100076548
507 Ga0068855_100323450
508 Ga0070664_100003031
509 Ga0068857_100005868
510 Ga0068857_100009973
511 Ga0068857_100426011
512 Ga0068854_100006417
513 Ga0068854_100142899
514 Ga0068854_100214748
515 Ga0068856_100019387
516 Ga0070702_100000425
517 Ga0068852_100000148
518 Ga0068852_100086874
519 Ga0068859_100005918
520 Ga0068859_100020191
521 Ga0068864_100007996
522 Ga0068861_100015327
523 Ga0068861_100046362
524 Ga0068870_10056709
525 Ga0068863_100000138
526 Ga0068863_100003773
527 Ga0068863_100019679
528 Ga0068863_100044925
529 Ga0068863_100077267
530 Ga0068863_100131671
531 Ga0068858_100019904
532 Ga0068858_100154555
533 Ga0068858_100201054
534 Ga0068860_100000028
535 Ga0068860_100013293
536 Ga0068860_100019515
537 Ga0068860_100022159
538 Ga0068860_100023042
539 Ga0068860_100029116
540 Ga0068860_100078683
541 Ga0068862_100008189
542 Ga0068862_100012039
543 Ga0068862_100077513
544 Ga0068862_100103842
545 Ga0081455_10004524
546 Ga0081539_10000016
547 Ga0075365_10007600
548 Ga0075368_10000279
549 Ga0075363_100171339
550 Ga0075364_10133776
551 Ga0075432_10016234
552 Ga0075362_10000038
553 Ga0075362_10005134
554 Ga0075367_10074944
555 Ga0075369_10009512
556 Ga0075369_10059451
557 Ga0075366_10000020
558 Ga0075366_10041170
559 Ga0075370_10000020
560 Ga0075370_10005413
561 Ga0075370_10071163
562 Ga0068871_100279063
563 Ga0075429_100007838
564 Ga0068865_100027761
565 Ga0097620_100005918
566 Ga0097620_100020191
567 Ga0075435_100452758
568 Ga0105251_10010139
569 Ga0105250_10005557
570 Ga0105240_10002335
571 Ga0105240_10013604
572 Ga0105240_10032880
573 Ga0105247_10064763
574 Ga0114129_10002803
575 Ga0105243_10218757
576 Ga0105248_10002853
577 Ga0105248_10020718
578 Ga0105248_10031000
579 Ga0105248_10492493
580 Ga0105237_10020113
581 Ga0105237_10060111
582 Ga0105249_10030187
583 Ga0105249_10064131
584 Ga0105239_10000031
585 Ga0163162_10017641
586 Ga0163162_10063790
587 Ga0163162_10072254
588 Ga0163162_10177883
589 Ga0157372_10034954
590 Ga0157375_10080503
591 Ga0163163_10005747
592 Ga0157377_10002348
593 Ga0157379_10228719
594 Ga0209455_1002960
595 Ga0207696_1008139
596 Ga0207713_1005355
597 Ga0207713_1009507
598 Ga0207710_10116074
599 Ga0207688_10029044
600 Ga0207647_10003114
601 Ga0207647_10111615
602 Ga0207705_10000023
603 Ga0207705_10004449
604 Ga0207705_10010586
605 Ga0207705_10047990
606 Ga0207695_10005422
607 Ga0207695_10044466
608 Ga0207671_10006733
609 Ga0207671_10020607
610 Ga0207662_10009814
611 Ga0207657_10013700
612 Ga0207649_10030250
613 Ga0207649_10355875
614 Ga0207652_10001918
615 Ga0207652_10030673
616 Ga0207652_10222094
617 Ga0207681_10000590
618 Ga0207681_10024312
619 Ga0207681_10088880
620 Ga0207650_10018477
621 Ga0207644_10000018
622 Ga0207644_10002089
623 Ga0207644_10002518
624 Ga0207644_10012093
625 Ga0207690_10101889
626 Ga0207690_10118583
627 Ga0207706_10009478
628 Ga0207706_10035701
629 Ga0207670_10007016
630 Ga0207704_10031549
631 Ga0207691_10065489
632 Ga0207711_10004261
633 Ga0207711_10197359
634 Ga0207679_10008797
635 Ga0207667_10027763
636 Ga0207667_10240521
637 Ga0207651_10019316
638 Ga0207712_10027543
639 Ga0207712_10168948
640 Ga0207640_10000228
641 Ga0207640_10124419
642 Ga0207640_10253304
643 Ga0207658_10005189
644 Ga0207658_10005346
645 Ga0207658_10009876
646 Ga0207658_10044345
647 Ga0207703_10002196
648 Ga0207703_10038060
649 Ga0207703_10102027
650 Ga0207703_10113745
651 Ga0207639_10160932
652 Ga0207702_10024781
653 Ga0207641_10001046
654 Ga0207641_10002102
655 Ga0207641_10013549
656 Ga0207641_10016444
657 Ga0207641_10232864
658 Ga0207648_10043168
659 Ga0207676_10006646
660 Ga0207676_10118686
661 Ga0207676_10174710
662 Ga0207674_10008384
663 Ga0207674_10016159
664 Ga0207675_100001659
665 Ga0207675_100025903
666 Ga0207683_10035813
667 Ga0207698_10000685
668 Ga0207698_10045554
669 Ga0207698_10314479
670 Ga0209813_10000047
671 Ga0207428_10052393
672 Ga0268266_10000002
673 Ga0268266_10001804
674 Ga0268266_10029255
675 Ga0268266_10042451
676 Ga0268266_10070700
677 Ga0268265_10004619
678 Ga0268265_10007669
679 Ga0268265_10011165
680 Ga0268264_10000066
681 Ga0268264_10016487
682 Ga0268264_10027474
683 Ga0268264_10060571
684 Ga0268264_10100148
685 Ga0265331_10049502
686 Ga0307408_100005165
687 Ga0316576_10239821
688 Ga0307405_10117274
689 Ga0307413_10104392
690 Ga0307406_10062463
691 Ga0307406_10340919
692 Ga0307412_10003836
693 Ga0307412_10009936
694 Ga0307412_10023532
695 Ga0307412_10267154
696 Ga0307416_100016829
697 Ga0307416_100100151
698 Ga0307414_10007583
699 Ga0307414_10048286
700 Ga0316583_10015786
701 Ga0316574_0003601
702 Ga0316584_0020811
703 Ga0395900_0054248
704 Ga0395905_0064102
705 Ga0395901_0027288
706 Ga0400487_36419
707 Ga0400487_54596
708 Ga0436363_0911720
709 Ga0439448_0004676
710 Ga0439448_0051257
711 Ga0439458_0000191
712 Ga0439464_0041373
713 Ga0466966_0014858
714 Ga0466961_0046743
715 Ga0453684_0224038
716 Ga0466971_0092454
717 Ga0466970_0007112
718 Ga0451576_0000023
719 Ga0451576_0082464
720 Ga0495627_001124
721 Ga0495650_0003145
722 Ga0495596_0000193
723 Ga0495607_0003996
724 Ga0495606_0091557
725 Ga0495610_0000384
726 Ga0495620_0014877
727 Ga0495632_0005056
728 Ga0495643_0003644
729 Ga0495643_0008735
730 Ga0495609_0019628
731 Ga0495668_0062394
732 Ga0495625_0019297
733 Ga0495681_0000114
734 Ga0495681_0069583
735 Ga0495615_0000286
736 Ga0495615_0000550
737 Ga0496100_0024802
738 Ga0496101_0026033
739 Ga0496101_0286798
740 Ga0496101_0346467
741 Ga0496102_0000472
742 Ga0496102_0000888
743 Ga0496102_0037610
744 Ga0496102_0150639
745 Ga0496103_0000318
746 Ga0496103_0001965
747 Ga0496104_0000429
748 Ga0496104_0065225
749 Ga0496104_0122502
750 Ga0496105_0023359
751 Ga0496105_0048118
752 Ga0496106_0000500
753 Ga0496106_0074653
754 Ga0496107_0000883
755 Ga0496107_0277279
756 Ga0496108_0048337
757 Ga0496109_0398972
758 Ga0496110_0137819
759 Ga0496110_0145723
760 Ga0496111_0004648
761 Ga0496111_0190659
762 Ga0496112_0021913
763 Ga0496112_0152246
764 Ga0496113_0005908
765 Ga0496113_0213007
766 Ga0496114_0008919
767 Ga0496115_0253243
768 Ga0496116_0000017
769 Ga0496116_0004093
770 Ga0496117_0000946
771 Ga0496117_0006179
772 Ga0496117_0053005
773 Ga0496117_0097426
774 Ga0496118_0000133
775 Ga0496118_0007585
776 Ga0496118_0013786
777 Ga0496118_0090915
778 Ga0496119_0005174
779 Ga0496119_0035752
780 Ga0496119_0080214
781 Ga0496120_0021657
782 Ga0496120_0071581
783 Ga0496121_0000069
784 Ga0496121_0000548
785 Ga0496121_0006009
786 Ga0496121_0021929
787 Ga0496121_0022901
788 Ga0496122_0001443
789 Ga0496122_0003579
790 Ga0496122_0017425
791 Ga0496122_0019209
792 Ga0496122_0031417
793 Ga0496122_0075742
794 Ga0496123_0001836
795 Ga0496123_0005017
796 Ga0496123_0006708
797 Ga0496123_0006943
798 Ga0496123_0011252
799 Ga0496124_0000129
800 Ga0496124_0000359
801 Ga0496124_0001643
802 Ga0496124_0002864
803 Ga0496124_0004156
804 Ga0496124_0008149
805 Ga0496124_0012751
806 Ga0496124_0023451
807 Ga0496124_0067241
808 Ga0496125_0021284
809 Ga0496125_0025814
810 Ga0496125_0050705
811 Ga0496125_0146412
812 Ga0496126_0000696
813 Ga0496126_0018904
814 Ga0496126_0030370
815 Ga0496126_0032794
816 Ga0501034_0003838
817 Ga0501047_0146921
818 Ga0501223_000268
819 Ga0501224_000019
820 Ga0501233_001194
821 Ga0501225_0000054
822 Ga0501226_000092
823 nmdc:mga03683_1148_c1
824 nmdc:mga03683_817_c1
825 nmdc:mga00v17_133555_c1
826 nmdc:mga00v17_24215_c1
827 nmdc:mga0yw44_43663_c1
828 nmdc:mga0k408_14886_c1
829 nmdc:mga0k408_52_c1
830 nmdc:mga06z11_402_c1
831 nmdc:mga04h51_2827_c1
832 nmdc:mga07m45_107_c1
833 nmdc:mga07m45_33077_c1
834 nmdc:mga07m45_45_c1
835 nmdc:mga05p37_539904_c1
836 nmdc:mga09592_326240_c1
837 nmdc:mga06r32_8875_c1
838 nmdc:mga0sz30_1161_c1
839 nmdc:mga0sz30_57329_c1
840 nmdc:mga0sz30_9015_c1
841 Ga0500643_000822
842 Ga0500651_0057100
843 Ga0500641_0006490
844 Ga0500607_004527
845 Ga0500607_087926
846 Ga0500608_000087
847 Ga0500658_0022248
848 Ga0500559_0016622
849 Ga0500564_001604
850 Ga0500573_0144411
851 Ga0500588_0012375
852 Ga0500590_024960
853 Ga0500567_005407
854 Ga0500625_000009
855 2511128215
856 2513589806
857 2585260537
858 2600228813
859 2738709774
860 2738848199
861 2738863928
862 2739296446
863 2739358124
864 2739649393
865 2740027866
866 2819552519
867 2819714639
868 2828307026
869 2829748968
870 2830076602
871 2861696866
872 2879165261
873 2896185188
874 2896255588
875 2919141720
876 2928101330
877 2928529142
878 2928960259
879 2928968686
880 2946789609
881 3003669336
882 643592745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01032

FecCD

FecCD transport family

40

354

0.94

PF00950

ABC-3

ABC 3 transport family

114

343

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.8974 3 306
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.8731 3 306
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.8726 3 306
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.8657 3 305
5b57-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.8587 7 306
ID Description Score Start End Superfamily
af_Q57552_11_347_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8932 3 308 1.10.3470.10
af_Q2G1Z1_6_337_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8817 3 308 1.10.3470.10
af_P23877_5_330_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8755 3 310 1.10.3470.10
af_P15030_4_332_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8754 10 307 1.10.3470.10
af_Q57552_11_347_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8741 3 308 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A7V8DRU5-F1-model_v4 Hemin transport system permease HmuU 0.9507 1 310 GO:0005886
GO:0022857
GO:0033214
AF-A3WQY2-F1-model_v4 ABC-type Fe3+-siderophore transport system permease component 0.9423 3 311 GO:0005886
GO:0022857
AF-A0A7V8DRU5-F1-model_v4 Hemin transport system permease HmuU 0.9418 1 310 GO:0005886
GO:0022857
GO:0033214
AF-A0A812INN5-F1-model_v4 YvrB protein 0.9411 32 303 GO:0004553
GO:0005524
GO:0005886
GO:0005975
GO:0016887
GO:0022857
AF-A0A160TIP4-F1-model_v4 Vitamin B12 ABC transporter, permease component BtuC 0.9347 9 309 GO:0005886
GO:0022857
GO:0033214

Map